BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5859

Length=985
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004229612.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    198   1e-58   
ref|XP_009783307.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    198   2e-58   Nicotiana sylvestris
ref|XP_009591907.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    197   2e-58   Nicotiana tomentosiformis
ref|XP_006345468.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    190   2e-55   Solanum tuberosum [potatoes]
ref|XP_009631181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    183   5e-53   Nicotiana tomentosiformis
ref|XP_009773992.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    182   1e-52   Nicotiana sylvestris
gb|ACR56827.1|  At3g12630-like protein                                  181   3e-52   Solanum hirtum
gb|ACR56824.1|  At3g12630-like protein                                  178   3e-51   Solanum hirtum
ref|XP_008461273.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    178   3e-51   Cucumis melo [Oriental melon]
gb|ACR56825.1|  At3g12630-like protein                                  177   4e-51   Solanum quitoense [lulo]
ref|XP_003546877.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    176   4e-50   Glycine max [soybeans]
ref|XP_004135919.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    175   6e-50   Cucumis sativus [cucumbers]
ref|XP_008375146.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    174   3e-49   Malus domestica [apple tree]
ref|XP_009354712.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    172   1e-48   Pyrus x bretschneideri [bai li]
emb|CDP07749.1|  unnamed protein product                                172   2e-48   Coffea canephora [robusta coffee]
ref|XP_011025412.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    170   8e-48   Populus euphratica
ref|XP_009365003.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    169   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009365002.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    169   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009365004.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    168   4e-47   
gb|KHN29214.1|  Zinc finger A20 and AN1 domain-containing stress-...    167   5e-47   Glycine soja [wild soybean]
ref|XP_004306522.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    167   6e-47   Fragaria vesca subsp. vesca
ref|XP_007218519.1|  hypothetical protein PRUPE_ppa012532mg             167   6e-47   Prunus persica
ref|XP_008231311.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    167   7e-47   Prunus mume [ume]
ref|XP_008349960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    167   8e-47   
ref|XP_010557789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    167   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_002314027.1|  zinc finger family protein                         167   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002298442.1|  zinc finger family protein                         167   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010106958.1|  Zinc finger A20 and AN1 domain-containing st...    165   6e-46   Morus notabilis
ref|XP_012065536.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    164   1e-45   Jatropha curcas
ref|XP_010257261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    163   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_004499868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    163   3e-45   Cicer arietinum [garbanzo]
ref|NP_001240258.1|  zinc finger A20 and AN1 domain-containing st...    163   3e-45   Glycine max [soybeans]
ref|XP_010547246.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    163   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_006298707.1|  hypothetical protein CARUB_v10014801mg             163   3e-45   Capsella rubella
ref|XP_006407313.1|  hypothetical protein EUTSA_v10021683mg             162   4e-45   Eutrema salsugineum [saltwater cress]
gb|EYU27075.1|  hypothetical protein MIMGU_mgv1a014771mg                163   5e-45   Erythranthe guttata [common monkey flower]
ref|XP_011087429.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    162   8e-45   Sesamum indicum [beniseed]
ref|XP_007149048.1|  hypothetical protein PHAVU_005G036400g             166   1e-44   Phaseolus vulgaris [French bean]
ref|XP_006482901.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    162   1e-44   Citrus sinensis [apfelsine]
ref|XP_010067883.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    162   1e-44   Eucalyptus grandis [rose gum]
ref|XP_006438985.1|  hypothetical protein CICLE_v10032882mg             161   2e-44   Citrus clementina [clementine]
emb|CDY52666.1|  BnaC01g38560D                                          160   3e-44   Brassica napus [oilseed rape]
ref|XP_009120462.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    160   3e-44   Brassica rapa
ref|XP_003633555.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    160   4e-44   Vitis vinifera
gb|KFK38611.1|  hypothetical protein AALP_AA3G136800                    160   5e-44   Arabis alpina [alpine rockcress]
gb|KJB25036.1|  hypothetical protein B456_004G173900                    160   8e-44   Gossypium raimondii
ref|XP_010534277.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    159   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_007052561.1|  Zinc finger A20 and AN1 domain-containing st...    159   1e-43   Theobroma cacao [chocolate]
ref|XP_009146604.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    158   2e-43   Brassica rapa
ref|XP_010279007.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    158   2e-43   Nelumbo nucifera [Indian lotus]
emb|CDY00788.1|  BnaC03g37720D                                          157   3e-43   
emb|CDX73811.1|  BnaA03g32360D                                          157   3e-43   
ref|XP_009135242.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    157   4e-43   Brassica rapa
ref|XP_011025067.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    160   4e-43   Populus euphratica
gb|AIJ00004.1|  zinc finger A20 and AN1 domain-containing stress-...    157   7e-43   Gossypium hirsutum [American cotton]
emb|CDY08419.1|  BnaA05g26550D                                          156   8e-43   Brassica napus [oilseed rape]
ref|NP_566429.1|  E3 ligase SAP5                                        156   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011093526.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    157   1e-42   Sesamum indicum [beniseed]
ref|XP_008461789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    156   1e-42   Cucumis melo [Oriental melon]
ref|XP_010499267.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    155   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002882783.1|  hypothetical protein ARALYDRAFT_478622             154   4e-42   
emb|CDY67538.1|  BnaUnng02260D                                          154   6e-42   Brassica napus [oilseed rape]
gb|KJB22229.1|  hypothetical protein B456_004G036200                    153   2e-41   Gossypium raimondii
ref|XP_010497315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    153   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004149600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    151   1e-40   Cucumis sativus [cucumbers]
ref|XP_010913137.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    149   4e-40   Elaeis guineensis
ref|XP_010465038.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    151   4e-40   
gb|EYU31355.1|  hypothetical protein MIMGU_mgv1a014767mg                149   7e-40   Erythranthe guttata [common monkey flower]
ref|XP_010928494.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    147   2e-39   
ref|XP_008795709.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    147   2e-39   Phoenix dactylifera
gb|AAR83854.1|  induced stolon tip protein                              145   3e-39   Capsicum annuum
ref|XP_003599112.1|  Zinc finger A20 and AN1 domain-containing st...    146   6e-39   Medicago truncatula
ref|XP_008776561.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    145   2e-38   Phoenix dactylifera
gb|ACM68451.1|  stress-associated protein 1                             141   8e-38   Solanum pennellii
gb|EMT33843.1|  Zinc finger A20 and AN1 domain-containing stress-...    139   5e-36   
gb|AGQ04323.1|  SAP1                                                    138   5e-36   Oryza punctata
gb|EAZ45178.1|  hypothetical protein OsJ_29820                          137   3e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003542858.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    135   4e-35   Glycine max [soybeans]
gb|AGQ04314.1|  SAP1                                                    135   7e-35   Oryza sativa f. spontanea
gb|EAZ09556.1|  hypothetical protein OsI_31833                          135   8e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001063521.1|  Os09g0486500                                       135   8e-35   
ref|XP_009391817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    135   9e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510979.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    135   1e-34   Cicer arietinum [garbanzo]
gb|AGQ04316.1|  SAP1                                                    134   2e-34   Oryza glumipatula
gb|ADF80942.1|  zinc finger protein                                     134   2e-34   Phyllostachys praecox [zaozhu]
dbj|BAJ90521.1|  predicted protein                                      134   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007133828.1|  hypothetical protein PHAVU_011G212300g             134   2e-34   Phaseolus vulgaris [French bean]
ref|XP_002460447.1|  hypothetical protein SORBIDRAFT_02g028240          134   2e-34   Sorghum bicolor [broomcorn]
gb|AFK36400.1|  unknown                                                 133   4e-34   Medicago truncatula
ref|XP_003627722.1|  Zinc finger A20 and AN1 domain-containing st...    133   4e-34   Medicago truncatula
gb|AGQ04324.1|  SAP1                                                    132   9e-34   Oryza officinalis
ref|XP_002445913.1|  hypothetical protein SORBIDRAFT_07g027940          132   2e-33   Sorghum bicolor [broomcorn]
ref|XP_003540534.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    131   2e-33   Glycine max [soybeans]
gb|ACJ84133.1|  unknown                                                 131   2e-33   Medicago truncatula
gb|AGQ04319.1|  SAP1                                                    130   4e-33   Oryza meridionalis [Australian wild rice]
ref|XP_004973853.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    131   4e-33   Setaria italica
ref|XP_002513177.1|  zinc finger protein, putative                      130   5e-33   Ricinus communis
gb|AGQ04317.1|  SAP1                                                    129   1e-32   Oryza longistaminata [long-staminate rice]
ref|XP_009770817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    127   7e-32   Nicotiana sylvestris
ref|XP_006365818.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    127   1e-31   Solanum tuberosum [potatoes]
gb|AGQ04315.1|  SAP1                                                    127   1e-31   Oryza rufipogon [common wild rice]
ref|XP_009418201.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    125   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004252868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    125   4e-31   
gb|ACM68460.1|  stress-associated protein 10                            125   4e-31   Solanum pennellii
ref|XP_009415054.1|  PREDICTED: zinc finger AN1 domain-containing...    124   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006850149.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    124   1e-30   Amborella trichopoda
ref|XP_010257702.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    124   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_009416648.1|  PREDICTED: zinc finger AN1 domain-containing...    124   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009618607.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    125   2e-30   Nicotiana tomentosiformis
gb|EMT06701.1|  Zinc finger A20 and AN1 domain-containing stress-...    123   3e-30   
ref|XP_010925078.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    123   3e-30   Elaeis guineensis
gb|ACM68447.1|  stress-associated protein 10                            122   6e-30   Solanum lycopersicum
ref|XP_003557532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    122   6e-30   Brachypodium distachyon [annual false brome]
ref|XP_010928202.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    122   6e-30   Elaeis guineensis
ref|XP_009589288.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    122   1e-29   Nicotiana tomentosiformis
ref|XP_011090386.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    121   1e-29   Sesamum indicum [beniseed]
ref|NP_001140650.1|  uncharacterized protein LOC100272725               122   1e-29   Zea mays [maize]
ref|XP_009765432.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    123   1e-29   Nicotiana sylvestris
ref|XP_008794968.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    121   1e-29   Phoenix dactylifera
ref|XP_010228315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    122   1e-29   
ref|XP_011080262.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    121   1e-29   Sesamum indicum [beniseed]
gb|ABS72032.1|  putative AN1-like zinc finger protein                   119   2e-29   Olea europaea
ref|XP_009799138.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    120   2e-29   Nicotiana sylvestris
gb|EYU18023.1|  hypothetical protein MIMGU_mgv1a015860mg                120   3e-29   Erythranthe guttata [common monkey flower]
emb|CBI16411.3|  unnamed protein product                                120   3e-29   Vitis vinifera
ref|XP_002285543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   3e-29   Vitis vinifera
ref|XP_008808665.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    120   4e-29   Phoenix dactylifera
ref|XP_009596933.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   5e-29   Nicotiana tomentosiformis
gb|ABK21092.1|  unknown                                                 120   6e-29   Picea sitchensis
dbj|BAK03526.1|  predicted protein                                      119   7e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006660763.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    120   7e-29   Oryza brachyantha
ref|XP_009402699.1|  PREDICTED: zinc finger AN1 domain-containing...    119   9e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011094369.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   1e-28   Sesamum indicum [beniseed]
ref|XP_009406414.1|  PREDICTED: zinc finger AN1 domain-containing...    118   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP20562.1|  unnamed protein product                                118   3e-28   Coffea canephora [robusta coffee]
ref|XP_006660259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    116   3e-28   
ref|XP_007206025.1|  hypothetical protein PRUPE_ppa012468mg             118   3e-28   Prunus persica
gb|ABK90631.1|  zinc finger protein                                     117   3e-28   Aeluropus littoralis
ref|XP_006427949.1|  hypothetical protein CICLE_v10026622mg             118   4e-28   
ref|XP_004288126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   5e-28   Fragaria vesca subsp. vesca
gb|EPS66139.1|  hypothetical protein M569_08638                         114   5e-28   Genlisea aurea
ref|XP_002279037.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   5e-28   Vitis vinifera
gb|ADF80943.1|  zinc finger protein                                     117   7e-28   Phyllostachys vivax
dbj|BAJ88745.1|  predicted protein                                      117   7e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010545575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   7e-28   Tarenaya hassleriana [spider flower]
gb|EYU46288.1|  hypothetical protein MIMGU_mgv1a015852mg                116   7e-28   Erythranthe guttata [common monkey flower]
ref|XP_004798521.1|  PREDICTED: AN1-type zinc finger protein 6          117   8e-28   
ref|XP_010261028.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   9e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009589284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   1e-27   Nicotiana tomentosiformis
gb|KDO50474.1|  hypothetical protein CISIN_1g030772mg                   116   1e-27   Citrus sinensis [apfelsine]
gb|ACL01101.1|  zinc finger protein                                     116   1e-27   Phyllostachys edulis [kikko-chiku]
gb|EYU31356.1|  hypothetical protein MIMGU_mgv1a014938mg                116   1e-27   Erythranthe guttata [common monkey flower]
gb|ABI23728.1|  stress-tolerance zinc finger protein                    116   1e-27   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011622536.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    116   2e-27   Amborella trichopoda
ref|NP_001062181.1|  Os08g0504700                                       115   2e-27   
ref|XP_005148802.1|  PREDICTED: AN1-type zinc finger protein 6 is...    115   3e-27   Melopsittacus undulatus
ref|XP_005521625.1|  PREDICTED: AN1-type zinc finger protein 6 is...    115   3e-27   
gb|EMT17725.1|  Zinc finger A20 and AN1 domain-containing stress-...    115   3e-27   
dbj|BAJ94586.1|  predicted protein                                      115   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01503.1|  predicted protein                                      115   4e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010018692.1|  PREDICTED: AN1-type zinc finger protein 6 is...    115   4e-27   Nestor notabilis
ref|XP_009376157.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   4e-27   Pyrus x bretschneideri [bai li]
gb|ACM68454.1|  stress-associated protein 4                             114   5e-27   Solanum pennellii
ref|XP_009770813.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   5e-27   Nicotiana sylvestris
ref|XP_004229614.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   5e-27   
gb|ACM68441.1|  stress-associated protein 4                             114   5e-27   Solanum lycopersicum
ref|XP_009942070.1|  PREDICTED: AN1-type zinc finger protein 6 is...    115   6e-27   Opisthocomus hoazin [hoatzin]
ref|XP_006345467.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   6e-27   Solanum tuberosum [potatoes]
ref|XP_006339126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   7e-27   Solanum tuberosum [potatoes]
ref|XP_010489793.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009416009.1|  PREDICTED: zinc finger AN1 domain-containing...    114   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004957171.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   8e-27   Setaria italica
ref|XP_012075269.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   8e-27   Jatropha curcas
ref|NP_001058985.1|  Os07g0168800                                       114   8e-27   
ref|XP_010268591.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   9e-27   Nelumbo nucifera [Indian lotus]
ref|XP_011080265.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   9e-27   Sesamum indicum [beniseed]
ref|XP_008935048.1|  PREDICTED: AN1-type zinc finger protein 6 is...    114   1e-26   Merops nubicus
ref|XP_010139451.1|  PREDICTED: AN1-type zinc finger protein 6 is...    114   1e-26   Buceros rhinoceros silvestris
gb|EYU46282.1|  hypothetical protein MIMGU_mgv1a014897mg                114   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_009507913.1|  PREDICTED: AN1-type zinc finger protein 6 is...    114   1e-26   Phalacrocorax carbo [common cormorant]
gb|AAQ84334.1|  stress-associated protein 8                             114   1e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001058066.1|  Os06g0612800                                       114   1e-26   
ref|XP_010544224.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_003574738.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_008461274.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   1e-26   Cucumis melo [Oriental melon]
ref|XP_009876598.1|  PREDICTED: AN1-type zinc finger protein 6 is...    114   1e-26   Apaloderma vittatum
ref|XP_002513466.1|  zinc finger protein, putative                      114   1e-26   Ricinus communis
ref|XP_007028890.1|  Zinc finger A20 and AN1 domain-containing st...    114   1e-26   
ref|XP_008490199.1|  PREDICTED: AN1-type zinc finger protein 6 is...    114   1e-26   Calypte anna
ref|XP_005419656.1|  PREDICTED: AN1-type zinc finger protein 6 is...    114   2e-26   Geospiza fortis
ref|XP_008923640.1|  PREDICTED: AN1-type zinc finger protein 6 is...    114   2e-26   
ref|XP_011659456.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-26   Cucumis sativus [cucumbers]
gb|EMS47592.1|  Zinc finger A20 and AN1 domain-containing stress-...    116   2e-26   Triticum urartu
ref|XP_010157333.1|  PREDICTED: AN1-type zinc finger protein 6 is...    114   2e-26   Eurypyga helias
ref|XP_007028887.1|  Zinc finger A20 and AN1 domain-containing st...    113   2e-26   
ref|XP_010912823.1|  PREDICTED: zinc finger AN1 domain-containing...    112   2e-26   Elaeis guineensis
ref|XP_010174709.1|  PREDICTED: AN1-type zinc finger protein 6 is...    113   2e-26   Antrostomus carolinensis
ref|XP_011093525.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-26   Sesamum indicum [beniseed]
gb|AFK43974.1|  unknown                                                 113   3e-26   Lotus japonicus
ref|XP_009584789.1|  PREDICTED: AN1-type zinc finger protein 6 is...    113   3e-26   Fulmarus glacialis
ref|XP_011093524.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   3e-26   
ref|XP_008791733.1|  PREDICTED: zinc finger AN1 domain-containing...    112   3e-26   Phoenix dactylifera
ref|XP_009385134.1|  PREDICTED: zinc finger AN1 domain-containing...    112   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010195894.1|  PREDICTED: AN1-type zinc finger protein 6 is...    113   3e-26   Colius striatus
ref|XP_005436662.1|  PREDICTED: AN1-type zinc finger protein 6 is...    113   3e-26   
ref|XP_010302402.1|  PREDICTED: AN1-type zinc finger protein 6 is...    113   3e-26   Balearica regulorum gibbericeps
ref|XP_008812241.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   3e-26   Phoenix dactylifera
ref|XP_008384532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   3e-26   
ref|XP_010228642.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   3e-26   
ref|XP_010228638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   3e-26   
gb|EPS60974.1|  hypothetical protein M569_13826                         112   4e-26   Genlisea aurea
gb|EEC76316.1|  hypothetical protein OsI_13859                          113   4e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010286312.1|  PREDICTED: AN1-type zinc finger protein 6 is...    112   4e-26   Phaethon lepturus
ref|NP_001106266.1|  LOC100127541                                       112   4e-26   Zea mays [maize]
ref|XP_009976938.1|  PREDICTED: AN1-type zinc finger protein 6 is...    112   5e-26   Tauraco erythrolophus
ref|XP_004249448.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   5e-26   
ref|XP_006487967.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   5e-26   Citrus sinensis [apfelsine]
ref|XP_010031824.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   5e-26   Eucalyptus grandis [rose gum]
ref|XP_004513637.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   5e-26   
gb|EPS64266.1|  hypothetical protein M569_10515                         111   5e-26   Genlisea aurea
ref|XP_002466323.1|  hypothetical protein SORBIDRAFT_01g005640          112   5e-26   Sorghum bicolor [broomcorn]
gb|ACT53874.1|  zinc finger protein                                     112   6e-26   Saccharum officinarum [noble cane]
ref|XP_004513638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   6e-26   Cicer arietinum [garbanzo]
ref|XP_008804197.1|  PREDICTED: zinc finger AN1 domain-containing...    111   6e-26   
ref|XP_009701714.1|  PREDICTED: AN1-type zinc finger protein 6 is...    112   7e-26   Cariama cristata
gb|ABK21003.1|  unknown                                                 112   7e-26   Picea sitchensis
ref|XP_008638302.1|  PREDICTED: AN1-type zinc finger protein 6 is...    112   7e-26   
ref|XP_010189201.1|  PREDICTED: AN1-type zinc finger protein 6 is...    112   8e-26   Mesitornis unicolor
ref|XP_009393780.1|  PREDICTED: zinc finger AN1 domain-containing...    110   8e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010031823.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   9e-26   Eucalyptus grandis [rose gum]
ref|XP_010531421.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   9e-26   Tarenaya hassleriana [spider flower]
ref|XP_009416000.1|  PREDICTED: zinc finger AN1 domain-containing...    110   9e-26   
ref|XP_009411960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002282913.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   1e-25   Vitis vinifera
gb|AAX14637.1|  zinc finger protein                                     111   1e-25   Zea mays [maize]
ref|NP_001266661.1|  multiple stress-responsive zinc-finger prote...    111   1e-25   
gb|ACG26325.1|  zinc finger A20 and AN1 domains-containing protein      111   1e-25   Zea mays [maize]
ref|XP_011839092.1|  PREDICTED: AN1-type zinc finger protein 6 is...    111   1e-25   Mandrillus leucophaeus
gb|ABK26062.1|  unknown                                                 111   1e-25   Picea sitchensis
gb|EEE60081.1|  hypothetical protein OsJ_12913                          112   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002306229.2|  zinc finger family protein                         110   2e-25   
ref|NP_001106260.1|  LOC100127534                                       110   2e-25   Zea mays [maize]
gb|KEH16280.1|  zinc finger A20 and AN1 domain stress-associated ...    110   2e-25   Medicago truncatula
ref|XP_004421951.1|  PREDICTED: AN1-type zinc finger protein 6 is...    111   2e-25   
ref|XP_006657485.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-25   Oryza brachyantha
ref|NP_001106263.1|  AN110                                              110   2e-25   
gb|KEH16279.1|  zinc finger A20 and AN1 domain stress-associated ...    110   2e-25   Medicago truncatula
dbj|BAG50058.1|  transcription factor C2H2                              110   2e-25   Lotus japonicus
ref|XP_004250869.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-25   
ref|NP_001130325.1|  LOC100191419                                       110   2e-25   Zea mays [maize]
gb|ABK92973.1|  unknown                                                 110   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011046278.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-25   Populus euphratica
ref|XP_010555326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_009082778.1|  PREDICTED: AN1-type zinc finger protein 6 is...    110   2e-25   Acanthisitta chloris
emb|CDY25219.1|  BnaC06g04440D                                          110   2e-25   Brassica napus [oilseed rape]
gb|ADK63395.1|  AN1-like zinc finger protein                            110   2e-25   Brassica rapa
ref|NP_001051527.1|  Os03g0792900                                       110   2e-25   
ref|XP_011037831.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-25   Populus euphratica
ref|XP_002304765.2|  zinc finger family protein                         110   2e-25   
ref|NP_001288874.1|  zinc finger A20 and AN1 domain-containing st...    110   3e-25   Brassica rapa
ref|XP_009391886.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155611.1|  hypothetical protein PHAVU_003G216400g             109   3e-25   Phaseolus vulgaris [French bean]
gb|ACM68452.1|  stress-associated protein 2                             110   3e-25   Solanum pennellii
ref|XP_002297783.1|  zinc finger family protein                         110   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009405572.1|  PREDICTED: zinc finger AN1 domain-containing...    109   3e-25   
ref|XP_006189680.1|  PREDICTED: AN1-type zinc finger protein 6 is...    110   3e-25   
emb|CDP10083.1|  unnamed protein product                                111   3e-25   Coffea canephora [robusta coffee]
gb|AFW87479.1|  zinc finger protein1                                    110   3e-25   
dbj|BAO74166.1|  zinc finger protein                                    110   3e-25   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_009418488.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAO74165.1|  zinc finger protein                                    110   3e-25   Cucurbita pepo subsp. ovifera
ref|XP_006354259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   3e-25   Solanum tuberosum [potatoes]
ref|XP_009802017.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    109   3e-25   Nicotiana sylvestris
ref|XP_010928861.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   4e-25   Elaeis guineensis
ref|NP_001275387.1|  zinc finger A20 and AN1 domain-containing st...    109   4e-25   Solanum tuberosum [potatoes]
ref|XP_002993103.1|  hypothetical protein SELMODRAFT_187216             110   4e-25   
ref|XP_008786424.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-25   Phoenix dactylifera
ref|XP_009147775.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-25   Brassica rapa
ref|XP_011078867.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-25   Sesamum indicum [beniseed]
ref|XP_009376154.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-25   
ref|XP_003557802.2|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   4e-25   
ref|XP_007014975.1|  Zinc finger A20 and AN1 domain-containing st...    109   4e-25   
ref|XP_007447131.1|  PREDICTED: AN1-type zinc finger protein 6 is...    110   5e-25   
ref|XP_001756532.1|  predicted protein                                  109   5e-25   
dbj|BAO74167.1|  zinc finger protein                                    109   5e-25   
ref|XP_011044990.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   5e-25   
ref|XP_003606132.1|  Zinc finger A20 and AN1 domain-containing st...    109   5e-25   
ref|XP_010233975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   5e-25   
ref|XP_004278382.1|  PREDICTED: AN1-type zinc finger protein 6 is...    109   5e-25   
gb|EPS60034.1|  hypothetical protein M569_14771                         109   5e-25   
ref|XP_002283050.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   6e-25   
ref|XP_004493535.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   6e-25   
ref|XP_010673602.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   6e-25   
ref|XP_009411822.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   6e-25   
ref|XP_009902209.1|  PREDICTED: AN1-type zinc finger protein 6 is...    109   6e-25   
ref|XP_011042076.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   6e-25   
ref|XP_002310618.2|  hypothetical protein POPTR_0007s06890g             108   6e-25   
gb|ACM68455.1|  stress-associated protein 5                             109   7e-25   
ref|XP_010544226.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   7e-25   
ref|XP_006593451.1|  PREDICTED: uncharacterized protein LOC100802...    109   7e-25   
ref|XP_009560016.1|  PREDICTED: AN1-type zinc finger protein 6 is...    109   7e-25   
ref|XP_007145644.1|  hypothetical protein PHAVU_007G256400g             108   8e-25   
ref|XP_010907320.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   8e-25   
gb|ACF80251.1|  unknown                                                 108   8e-25   
ref|XP_006361216.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   8e-25   
ref|XP_007014974.1|  Zinc finger A20 and AN1 domain-containing st...    109   8e-25   
ref|XP_009785364.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   9e-25   
ref|XP_010911243.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   9e-25   
gb|EMS62344.1|  Zinc finger A20 and AN1 domain-containing stress-...    107   9e-25   
ref|XP_006888306.1|  PREDICTED: AN1-type zinc finger protein 6 is...    109   9e-25   
ref|XP_010279014.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   9e-25   
ref|XP_008782899.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-24   
ref|XP_002603180.1|  hypothetical protein BRAFLDRAFT_226485             109   1e-24   
ref|XP_006656245.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-24   
ref|XP_002285530.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-24   
gb|EMS48100.1|  Zinc finger A20 and AN1 domain-containing stress-...    112   1e-24   
ref|XP_012089967.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-24   
ref|XP_008384536.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-24   
emb|CDY13347.1|  BnaC06g14100D                                          108   1e-24   
ref|XP_011087441.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   1e-24   
ref|XP_009374543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-24   
gb|EMT32776.1|  Zinc finger A20 and AN1 domain-containing stress-...    112   1e-24   
ref|XP_011075194.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-24   
ref|XP_008788284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-24   
ref|XP_002975420.1|  hypothetical protein SELMODRAFT_150464             108   1e-24   
ref|XP_007150082.1|  hypothetical protein PHAVU_005G125000g             108   1e-24   
ref|XP_002312908.1|  zinc finger family protein                         108   1e-24   
ref|XP_009601977.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   1e-24   
ref|NP_001229848.1|  AN1-type zinc finger protein 6 isoform d           108   2e-24   
ref|XP_002116218.1|  hypothetical protein TRIADDRAFT_50857              108   2e-24   
ref|XP_010105325.1|  Zinc finger A20 and AN1 domain-containing st...    108   2e-24   
ref|XP_001779169.1|  predicted protein                                  108   2e-24   
ref|XP_007066909.1|  PREDICTED: AN1-type zinc finger protein 6 is...    108   2e-24   
ref|XP_008804805.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   2e-24   
ref|XP_010557404.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    107   2e-24   
ref|NP_001105248.1|  uncharacterized protein LOC542155                  109   2e-24   
ref|XP_002528717.1|  zinc finger protein, putative                      107   2e-24   
gb|EPS60935.1|  induced stolon tip protein                              107   2e-24   
ref|XP_011087449.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   2e-24   
ref|XP_009609312.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   2e-24   
ref|XP_003597446.1|  Zinc finger A20 and AN1 domain-containing st...    107   2e-24   
ref|XP_002160663.2|  PREDICTED: AN1-type zinc finger protein 6-like     107   2e-24   
ref|XP_011653588.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   2e-24   
gb|ACM68453.1|  stress-associated protein 3                             107   2e-24   
ref|XP_009419155.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   2e-24   
ref|XP_007145317.1|  hypothetical protein PHAVU_007G228900g             107   3e-24   
ref|XP_004594633.1|  PREDICTED: AN1-type zinc finger protein 6 is...    107   3e-24   
ref|XP_001770822.1|  predicted protein                                  107   3e-24   
gb|ABK24386.1|  unknown                                                 107   3e-24   
ref|XP_006381027.1|  hypothetical protein POPTR_0006s05520g             107   3e-24   
gb|ACM68459.1|  stress-associated protein 9                             107   3e-24   
ref|XP_002323304.1|  hypothetical protein POPTR_0016s05220g             107   3e-24   
ref|XP_011090378.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   3e-24   
dbj|BAO74169.1|  zinc finger protein                                    107   3e-24   
gb|ACM68440.1|  stress-associated protein 3                             107   3e-24   
ref|XP_004361654.1|  putative zinc finger protein                       106   3e-24   
ref|XP_004228358.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   3e-24   
ref|XP_009783306.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   3e-24   
ref|XP_006650711.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   3e-24   
ref|NP_001055132.1|  Os05g0299700                                       107   4e-24   
ref|XP_008373747.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   4e-24   
ref|XP_004088382.1|  PREDICTED: AN1-type zinc finger protein 6          107   4e-24   
ref|XP_006870970.1|  PREDICTED: AN1-type zinc finger protein 6 is...    107   4e-24   
ref|XP_006410805.1|  hypothetical protein EUTSA_v10017322mg             107   4e-24   
gb|ACJ83925.1|  unknown                                                 107   4e-24   
dbj|BAO74168.1|  zinc finger protein                                    107   4e-24   
ref|XP_006490054.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   5e-24   
ref|XP_006046437.1|  PREDICTED: AN1-type zinc finger protein 6-li...    108   5e-24   
gb|KHN07399.1|  Zinc finger A20 and AN1 domain-containing stress-...    107   5e-24   
emb|CDM83619.1|  unnamed protein product                                105   5e-24   
ref|XP_006654239.1|  PREDICTED: zinc finger AN1 domain-containing...    107   5e-24   
ref|XP_010045231.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   5e-24   
ref|XP_010913940.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   5e-24   
ref|XP_007950007.1|  PREDICTED: AN1-type zinc finger protein 6 is...    107   5e-24   
ref|XP_009776796.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   5e-24   
ref|XP_008449732.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   5e-24   
gb|EMT33494.1|  Zinc finger A20 and AN1 domain-containing stress-...    105   6e-24   
dbj|GAM26264.1|  hypothetical protein SAMD00019534_094390               105   6e-24   
ref|XP_004324566.1|  PREDICTED: AN1-type zinc finger protein 6-li...    107   6e-24   
ref|XP_005889815.1|  PREDICTED: AN1-type zinc finger protein 6 is...    107   6e-24   
ref|XP_003784626.1|  PREDICTED: AN1-type zinc finger protein 6-li...    107   6e-24   
ref|XP_009958821.1|  PREDICTED: AN1-type zinc finger protein 6-like     106   6e-24   
ref|XP_006644627.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   7e-24   
ref|XP_008354997.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   7e-24   
ref|XP_004658309.1|  PREDICTED: AN1-type zinc finger protein 6 is...    106   7e-24   
ref|XP_010053387.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   8e-24   
ref|XP_004951572.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   8e-24   
ref|XP_009408498.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   8e-24   
gb|EPY73931.1|  AN1-type zinc finger protein 5                          105   8e-24   
gb|EFA78520.1|  putative zinc finger protein                            105   8e-24   
gb|ABK25818.1|  unknown                                                 106   9e-24   
ref|XP_001771457.1|  predicted protein                                  106   9e-24   
ref|XP_010494181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   9e-24   
ref|XP_006576194.1|  PREDICTED: uncharacterized protein LOC100527...    105   1e-23   
ref|XP_006424263.1|  hypothetical protein CICLE_v10029439mg             105   1e-23   
ref|XP_002387848.1|  hypothetical protein MPER_13207                    105   1e-23   
gb|ABN08135.1|  Zinc finger, AN1-type; Zinc finger, A20-type            105   1e-23   
ref|XP_010002353.1|  PREDICTED: AN1-type zinc finger protein 6 is...    106   1e-23   
gb|ABK21043.1|  unknown                                                 105   1e-23   
emb|CDP15398.1|  unnamed protein product                                105   1e-23   
ref|XP_010271706.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   1e-23   
ref|XP_009351048.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   1e-23   
ref|XP_004421950.1|  PREDICTED: AN1-type zinc finger protein 6 is...    106   1e-23   
ref|XP_004969762.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   1e-23   
ref|XP_007447130.1|  PREDICTED: AN1-type zinc finger protein 6 is...    106   1e-23   
ref|XP_010244455.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   1e-23   
ref|XP_005077919.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   1e-23   
gb|EPS61935.1|  hypothetical protein M569_12860                         105   1e-23   
ref|XP_004387551.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   1e-23   
ref|XP_006850157.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   1e-23   
emb|CBI29889.3|  unnamed protein product                                104   1e-23   
ref|XP_004278381.1|  PREDICTED: AN1-type zinc finger protein 6 is...    106   1e-23   
ref|XP_010645797.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   1e-23   
ref|XP_006108289.1|  PREDICTED: AN1-type zinc finger protein 6-li...    105   1e-23   
ref|NP_001229846.1|  AN1-type zinc finger protein 6 isoform b           106   1e-23   
ref|XP_004056692.1|  PREDICTED: AN1-type zinc finger protein 6 is...    106   1e-23   
gb|AFK93416.1|  stress-response protein                                 105   1e-23   
gb|KJB36067.1|  hypothetical protein B456_006G139100                    105   1e-23   
ref|XP_011025579.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   2e-23   
ref|XP_009385326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   2e-23   
gb|EMT31119.1|  Zinc finger A20 and AN1 domain-containing stress-...    105   2e-23   
ref|XP_005889816.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   2e-23   
ref|XP_003294671.1|  hypothetical protein DICPUDRAFT_93260              104   2e-23   
ref|NP_001106259.1|  AN12                                               104   2e-23   
gb|ABI31653.1|  zinc finger protein                                     105   2e-23   
ref|XP_004738186.1|  PREDICTED: AN1-type zinc finger protein 6-li...    105   2e-23   
ref|XP_004617671.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   2e-23   
ref|XP_009593342.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   2e-23   
ref|XP_008996765.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   2e-23   
ref|NP_565844.1|  zinc finger A20 and AN1 domain-containing stres...    104   2e-23   
dbj|BAJ86013.1|  predicted protein                                      105   2e-23   
ref|XP_006430236.1|  hypothetical protein CICLE_v10012937mg             104   2e-23   
gb|EAW99126.1|  zinc finger, A20 domain containing 3, isoform CRA_c     106   2e-23   
ref|XP_004365991.2|  zinc finger protein                                105   2e-23   
ref|XP_008159435.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   3e-23   
ref|NP_194013.1|  A20/AN1-like zinc finger family protein               104   3e-23   
ref|XP_004406082.1|  PREDICTED: AN1-type zinc finger protein 6-li...    105   3e-23   
ref|XP_004516195.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   3e-23   
ref|XP_003434430.2|  PREDICTED: AN1-type zinc finger protein 6 is...    105   3e-23   
ref|XP_009115980.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   3e-23   
ref|XP_008066695.1|  PREDICTED: AN1-type zinc finger protein 6          105   3e-23   
ref|XP_004951575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   4e-23   
ref|XP_008462560.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   4e-23   
ref|XP_002269276.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   4e-23   
ref|XP_008935047.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   4e-23   
ref|XP_007027699.1|  A20/AN1-like zinc finger family protein, put...    103   4e-23   
ref|XP_008490198.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   4e-23   
ref|XP_004658308.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   4e-23   
ref|XP_005989640.1|  PREDICTED: AN1-type zinc finger protein 6 is...    105   4e-23   
ref|XP_006189679.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   4e-23   
ref|XP_005148801.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   4e-23   
ref|XP_006888305.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   5e-23   
ref|XP_010089848.1|  Zinc finger A20 and AN1 domain-containing st...    103   5e-23   
gb|AIN39820.1|  hypothetical protein                                    103   5e-23   
ref|XP_005521624.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   5e-23   
ref|XP_010036457.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   5e-23   
ref|XP_004387550.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   5e-23   
ref|XP_002876168.1|  hypothetical protein ARALYDRAFT_485652             103   5e-23   
ref|XP_004480728.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   5e-23   
ref|NP_001237029.1|  uncharacterized protein LOC100527251               103   6e-23   
ref|XP_004930543.1|  PREDICTED: AN1-type zinc finger protein 6-li...    103   6e-23   
ref|XP_004143315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   6e-23   
ref|XP_005419655.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   6e-23   
ref|XP_009617203.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   6e-23   
ref|XP_010174701.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   6e-23   
gb|ABD65463.1|  DNA binding/zinc ion binding protein                    103   6e-23   
ref|XP_010913090.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   6e-23   
ref|XP_011660127.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   6e-23   
gb|KJB51967.1|  hypothetical protein B456_008G240900                    103   6e-23   
ref|XP_010123597.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   6e-23   
ref|NP_001044076.1|  Os01g0718000                                       103   6e-23   
ref|XP_011793775.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   6e-23   
ref|NP_001237386.1|  uncharacterized protein LOC100306347               103   7e-23   
ref|XP_004249192.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   7e-23   
ref|XP_005077918.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   7e-23   
ref|XP_009081982.1|  PREDICTED: AN1-type zinc finger protein 6-like     103   7e-23   
ref|XP_005180142.1|  PREDICTED: AN1-type zinc finger protein 5          104   7e-23   
ref|XP_003431370.1|  PREDICTED: AN1-type zinc finger protein 6          104   7e-23   
ref|XP_009125231.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   7e-23   
ref|XP_004594631.1|  PREDICTED: AN1-type zinc finger protein 6 is...    103   8e-23   
ref|XP_008780854.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   8e-23   
ref|XP_007052555.1|  Zinc finger A20 and AN1 domain-containing st...    103   8e-23   
ref|XP_004955567.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   8e-23   
ref|XP_006142699.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   8e-23   
ref|XP_009758333.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   9e-23   
ref|XP_001637086.1|  predicted protein                                  103   9e-23   
ref|XP_009482427.1|  PREDICTED: AN1-type zinc finger protein 6 is...    103   9e-23   
emb|CBI16408.3|  unnamed protein product                                102   1e-22   
ref|XP_011020305.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   1e-22   
ref|XP_004617670.1|  PREDICTED: AN1-type zinc finger protein 6 is...    104   1e-22   
ref|XP_010504026.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   1e-22   
ref|XP_004658306.1|  PREDICTED: AN1-type zinc finger protein 6 is...    103   1e-22   
ref|XP_011839091.1|  PREDICTED: AN1-type zinc finger protein 6 is...    103   1e-22   
ref|XP_010076997.1|  PREDICTED: AN1-type zinc finger protein 6 is...    103   1e-22   
ref|XP_005695117.1|  PREDICTED: AN1-type zinc finger protein 6 is...    103   1e-22   
gb|ACJ85990.1|  unknown                                                 102   1e-22   
ref|XP_005708852.1|  zinc finger (AN1-like) family protein              103   1e-22   
dbj|BAD31782.1|  zinc finger protein-like                               102   1e-22   
ref|XP_006219718.1|  PREDICTED: AN1-type zinc finger protein 5-li...    103   1e-22   
ref|XP_001928215.1|  PREDICTED: AN1-type zinc finger protein 6 is...    103   2e-22   



>ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Solanum lycopersicum]
 gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum]
Length=188

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 130/170 (76%), Gaps = 14/170 (8%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEK------SP  386
            IT C+NNCGVTGNPATN+MCQKCFNATTAA+++SS + +   V IPH FAEK      S 
Sbjct  19   ITLCINNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGTSVTIPHNFAEKLVRSEKSA  78

Query  387  RSTFRRTSPGR------TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGL  548
            R +  R+SP R         DLKK+ D+    +E   ++S  PAKREVNRCSGCRRKVGL
Sbjct  79   RFSSLRSSPDRKSDLDRMSQDLKKVGDTMMVKEEDQLKASLPPAKREVNRCSGCRRKVGL  138

Query  549  TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            TGFRCRCGELFCGEHRYSDRHDCSYDYK AGREAIARENPVV+AAKI K+
Sbjct  139  TGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENPVVKAAKIIKV  188



>ref|XP_009783307.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana sylvestris]
Length=180

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 129/164 (79%), Gaps = 10/164 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssv--aastvPIPHKFAEKSPRS----  392
            IT CVNNCGVTGNPATN+MCQKCFNATTAA+++S+     S V IPHKFAEK  RS    
Sbjct  19   ITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSAVTIPHKFAEKLARSERSA  78

Query  393  --TFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCR  566
              +  R+SP R   DL++        ++K  ES P PAKREVNRCSGCRRKVGLTGFRCR
Sbjct  79   RFSSLRSSPERK-SDLERTSQHLTVKEDKLKESEP-PAKREVNRCSGCRRKVGLTGFRCR  136

Query  567  CGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CGELFCGEHRYSDRHDCSYDYK+AGR+AIARENPVV+AAKI K+
Sbjct  137  CGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVVKAAKIIKV  180



>ref|XP_009591907.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana tomentosiformis]
Length=180

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 10/164 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssv--aastvPIPHKFAEKSPRS----  392
            IT CVNNCGVTGNPATN+MCQKCFNATTAA+++S+     S V IPHKFAEK  RS    
Sbjct  19   ITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSVVTIPHKFAEKLARSERSA  78

Query  393  --TFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCR  566
              +  R+SP R   DL++        ++K  ES P PAKREVNRCSGCRRKVGLTGFRCR
Sbjct  79   RFSLLRSSPERK-SDLERTSQHLTVKEDKMKESVP-PAKREVNRCSGCRRKVGLTGFRCR  136

Query  567  CGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CG+LFCGEHRYSDRHDCSYDYK+AGR+AIARENPVV+AAKI K+
Sbjct  137  CGDLFCGEHRYSDRHDCSYDYKSAGRDAIARENPVVKAAKIIKV  180



>ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=187

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 126/170 (74%), Gaps = 15/170 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEKSPRSTF--  398
            IT C+N CGVTGNPATN+MCQKCFNATTAA+++SS + +   V IPHKFAEK  RS    
Sbjct  19   ITLCIN-CGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPHKFAEKLVRSEKSA  77

Query  399  ----------RRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGL  548
                      R++   R   DLKK+ D     +E   + S  PAKREVNRCSGCRRKVGL
Sbjct  78   RFSSLRSLPDRKSDLDRMSQDLKKVGDWMMVKEEDQLKESLPPAKREVNRCSGCRRKVGL  137

Query  549  TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            TGFRCRCGELFCGEHRYSDRHDC+YDYK AGREAIARENPVV+AAKI K+
Sbjct  138  TGFRCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENPVVKAAKIIKV  187



>ref|XP_009631181.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=156

 Score =   183 bits (464),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 110/156 (71%), Gaps = 20/156 (13%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +T CV +CGV GNPATN+MCQ CFNA+++              PHKFA    RST     
Sbjct  21   LTLCVKSCGVIGNPATNNMCQNCFNASSSKV----------AYPHKFANILTRST-----  65

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
                  DLKK  D   K D+K  ES  +PAK EVNRCSGCRRK+GLTGFRCRCGELFCGE
Sbjct  66   ----SSDLKKYVDRAVKDDDKAKES-VSPAKSEVNRCSGCRRKLGLTGFRCRCGELFCGE  120

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCSYDY+ AGREAIAR+NP+V+A+KI KL
Sbjct  121  HRYSDRHDCSYDYRTAGREAIARQNPLVKASKIVKL  156



>ref|XP_009773992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=158

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 112/156 (72%), Gaps = 17/156 (11%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT CV NCGV GNPATN+MCQ C       S S+S ++S V  PHKFA    RST     
Sbjct  20   ITLCVKNCGVIGNPATNNMCQNC-------SNSTSASSSKVAYPHKFANILTRST-----  67

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
                  DLK   D   K D+K  ES  +PAKREVNRCSGCRRKVGLTGFRCRCGELFCGE
Sbjct  68   ----SSDLKNYVDRAVKDDDKVKES-VSPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  122

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCSYDY+ AGREAIAR+NP+V+AAKI KL
Sbjct  123  HRYSDRHDCSYDYRTAGREAIARQNPLVKAAKIVKL  158



>gb|ACR56827.1| At3g12630-like protein, partial [Solanum hirtum]
Length=151

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 120/149 (81%), Gaps = 5/149 (3%)
 Frame = +3

Query  246  NNCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEKSPRS--TFRRTSP  413
            +NCGVTGNPATN+MCQKCFNATTAA+++SS + +   V IP KFAEK  RS  + R +  
Sbjct  4    HNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLL  63

Query  414  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
              +  DLKK+ D T K +++  ES P PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH
Sbjct  64   RSSSQDLKKVGDRTXKEEDQLKESLP-PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  122

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRA  680
            RYSDRHDC YDYK AGREAIARENPVV+A
Sbjct  123  RYSDRHDCXYDYKTAGREAIARENPVVKA  151



>gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum]
Length=147

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +3

Query  249  NCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEKSPRS--TFRRTSPG  416
            NCGVTGNPATN+MCQKCFNATTAA+++SS + +   V IP KFAEK  RS  + R +   
Sbjct  1    NCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLLR  60

Query  417  RTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  596
             +  DLKK+ D   K +++  ES P PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR
Sbjct  61   SSSQDLKKVGDRKVKEEDQLKESLP-PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  119

Query  597  YSDRHDCSYDYKAAGREAIARENPVVRA  680
            YSDRHDC+YDYK AGREAIARENPVV+A
Sbjct  120  YSDRHDCNYDYKTAGREAIARENPVVKA  147



>ref|XP_008461273.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Cucumis melo]
Length=159

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 118/161 (73%), Gaps = 24/161 (15%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA-EKSPRSTFRRT  407
            IT CVNNCG+TGNPATN+MCQKCFNATT  ++          +  KF+ EKSPRST  R+
Sbjct  18   ITLCVNNCGLTGNPATNNMCQKCFNATTTTAS----------MAMKFSGEKSPRSTISRS  67

Query  408  -SPGRTVPDLKKLEDSTDKIDEKTGESSPAP---AKREVNRCSGCRRKVGLTGFRCRCGE  575
                R V + +++  + D+         P P   AKREVNRCSGCR++VGLTGFRCRCG+
Sbjct  68   PEKFRFVSESRRIITAADR---------PKPDESAKREVNRCSGCRKRVGLTGFRCRCGD  118

Query  576  LFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LFC EHRYSDRHDCS+DYKAAGREAIARENPVV+AAKI ++
Sbjct  119  LFCAEHRYSDRHDCSFDYKAAGREAIARENPVVKAAKIVRV  159



>gb|ACR56825.1| At3g12630-like protein, partial [Solanum quitoense]
 gb|ACR56826.1| At3g12630-like protein, partial [Solanum quitoense]
Length=150

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = +3

Query  243  VNNCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEKSPRS--TFRRTS  410
             +NCG TGNPATN+MCQKCFNATTAA+++SS + +   V IP KFAEK  RS  + R + 
Sbjct  2    AHNCGFTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSL  61

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
               +  DLKK+ D T K +++  ES P PAKREV+RCSGCRRKVGLTGFRCRCGELFCGE
Sbjct  62   LRSSSQDLKKVGDRTVKEEDQLKESLP-PAKREVSRCSGCRRKVGLTGFRCRCGELFCGE  120

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRA  680
            HRYSDRHDCSYDYK AGREAIARENPVV+A
Sbjct  121  HRYSDRHDCSYDYKTAGREAIARENPVVKA  150



>ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Glycine max]
Length=161

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 110/156 (71%), Gaps = 12/156 (8%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT CVNNCGVTGNPATN+MCQKCF A+TA ++ +  A    P         P+       
Sbjct  18   ITLCVNNCGVTGNPATNNMCQKCFTASTATTSGAGGAGIASPATRSGVSARPQK------  71

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
              R+ P+    E S       + +++P+ AKR VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  72   --RSFPE----EPSPVADPPSSDQTTPSEAKRVVNRCSGCRRKVGLTGFRCRCGELFCAE  125

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCSYDYKAAGREAIARENPV+RAAKI K+
Sbjct  126  HRYSDRHDCSYDYKAAGREAIARENPVIRAAKIVKV  161



>ref|XP_004135919.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Cucumis sativus]
 gb|KGN45146.1| hypothetical protein Csa_7G428830 [Cucumis sativus]
Length=159

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 118/161 (73%), Gaps = 24/161 (15%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA-EKSPRSTFRRT  407
            IT CVNNCG+TGNP TN+MCQKCFNATTA ++          +  KF+ EKSPRST  R+
Sbjct  18   ITLCVNNCGLTGNPTTNNMCQKCFNATTATAS----------MAIKFSGEKSPRSTTSRS  67

Query  408  -SPGRTVPDLKKLEDSTDKIDEKTGESSPAP---AKREVNRCSGCRRKVGLTGFRCRCGE  575
                R V + +++  + D+         P P   AKREVNRCSGCR++VGLTGFRCRCG+
Sbjct  68   PEKFRFVSESRRIITAADR---------PKPDESAKREVNRCSGCRKRVGLTGFRCRCGD  118

Query  576  LFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LFC EHRYSDRHDCS+DYKAAGREAIARENPVV+AAKI ++
Sbjct  119  LFCAEHRYSDRHDCSFDYKAAGREAIARENPVVKAAKIVRV  159



>ref|XP_008375146.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=165

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 120/159 (75%), Gaps = 14/159 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF-AEKSPRST--FR  401
            +T CVNNCGVTGNP+TN+MCQKCFNA +AA+T+SS ++S   +  KF AEKSPRST  F 
Sbjct  18   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAIL--KFSAEKSPRSTSSFS  75

Query  402  RTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  581
              +P   V   +K   S      +   S  +P +R VNRCSGCRRKVGLTGFRCRCGELF
Sbjct  76   FEAP---VETFRKTTAS------EIARSDESPNRRVVNRCSGCRRKVGLTGFRCRCGELF  126

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            C EHRYSDRH CSYDYKAAGREAIARENPVV+AAKI +L
Sbjct  127  CSEHRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRL  165



>ref|XP_009354712.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Pyrus x bretschneideri]
Length=165

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 117/159 (74%), Gaps = 14/159 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF-AEKSPRST--FR  401
            +T CVNNCGVTGNP+TN+MCQKCFNA +AA+T+SS ++S   +  KF AEKSPRST  F 
Sbjct  18   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAIL--KFSAEKSPRSTSSFS  75

Query  402  RTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  581
              +   T      LE            S  +P +R VNRCSGCRRKVGLTGFRCRCG+LF
Sbjct  76   FEAQAETFRKTTALE---------IARSDESPNRRVVNRCSGCRRKVGLTGFRCRCGDLF  126

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            C EHRYSDRH CSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  127  CSEHRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRV  165



>emb|CDP07749.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 126/171 (74%), Gaps = 15/171 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPH---------KFAEKS  383
            ITPCVNNCGVTGNPATN+MCQKCFNAT++ASTSSS ++S+              KF EKS
Sbjct  19   ITPCVNNCGVTGNPATNNMCQKCFNATSSASTSSSSSSSSSTSSSVTSSVAGAIKFGEKS  78

Query  384  PRSTFRRTSPGRTVPDLKKL-EDSTDKIDEKTG-----ESSPAPAKREVNRCSGCRRKVG  545
            PRS+  +        DL ++  D  +++ E +       ++ A  KREVNRCSGCRRKVG
Sbjct  79   PRSSSSKRLSPERTTDLAEIRRDLKEEVKEASSAHATAPATAAAVKREVNRCSGCRRKVG  138

Query  546  LTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LTGFRCRCGELFC EHRYSDRHDCSYDYKAAGREAIARENPVV+AAK+ KL
Sbjct  139  LTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENPVVKAAKLVKL  189



>ref|XP_011025412.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
 ref|XP_011007335.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=179

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 115/169 (68%), Gaps = 20/169 (12%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNatt-------------aastsssvaastvPIPHKF  371
            +T C+NNCGVTGNPATN+MCQKCFNATT                 +++ + S   I    
Sbjct  18   LTSCINNCGVTGNPATNNMCQKCFNATTSTSNSSSSSTATSMTFAATATSVSNNEILKFT  77

Query  372  AEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  551
             EKS RS+  R+     V D +K   S +K  +K    +   AK+EVNRCSGCRR+VGLT
Sbjct  78   GEKSARSSISRS----LVKDPQK---SPEKASDKERSCASHVAKKEVNRCSGCRRRVGLT  130

Query  552  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GFRCRCGELFC EHRYSDRHDCSYDYK AGREAIARENPVV+AAKI ++
Sbjct  131  GFRCRCGELFCWEHRYSDRHDCSYDYKTAGREAIARENPVVKAAKIVRV  179



>ref|XP_009365003.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X2 [Pyrus x bretschneideri]
Length=168

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 114/157 (73%), Gaps = 10/157 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF-AEKSPRSTFRRT  407
            +T CVNNCGVTGNP+TN+MCQKCFNA +AA+ ++S ++S   +  KF AEKSPRS+    
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSSAAIL--KFSAEKSPRSSSSFN  78

Query  408  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
                  P  K       + DE        P +R VNRCSGCRRKVGLTGFRCRCGELFC 
Sbjct  79   FEAAPPPCRKTTASEIARSDE-------TPNRRVVNRCSGCRRKVGLTGFRCRCGELFCS  131

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            EHRYSDRH CSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  132  EHRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRV  168



>ref|XP_009365002.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X1 [Pyrus x bretschneideri]
Length=168

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 114/157 (73%), Gaps = 10/157 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF-AEKSPRSTFRRT  407
            +T CVNNCGVTGNP+TN+MCQKCFNA +AA+ +++ ++S   +  KF AEKSPRS+    
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAAATSSSSAAIL--KFSAEKSPRSSSSFN  78

Query  408  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
                  P  K       + DE        P +R VNRCSGCRRKVGLTGFRCRCGELFC 
Sbjct  79   FEAAPPPCRKTTASEIARSDE-------TPNRRVVNRCSGCRRKVGLTGFRCRCGELFCS  131

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            EHRYSDRH CSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  132  EHRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRV  168



>ref|XP_009365004.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X3 [Pyrus x bretschneideri]
Length=167

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 112/156 (72%), Gaps = 9/156 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +T CVNNCGVTGNP+TN+MCQKCFNA +AA+ ++S +++   I    AEKSPRS+     
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSAA--ILKFSAEKSPRSSSSFNF  78

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
                 P  K       + DE        P +R VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  79   EAAPPPCRKTTASEIARSDE-------TPNRRVVNRCSGCRRKVGLTGFRCRCGELFCSE  131

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  132  HRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRV  167



>gb|KHN29214.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Glycine soja]
Length=136

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 101/156 (65%), Gaps = 37/156 (24%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT CVNNCGVTGNPATN+MCQKCF A+TA ++ +  A    P                T 
Sbjct  18   ITLCVNNCGVTGNPATNNMCQKCFTASTATTSGAGGAGIASPA---------------TR  62

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
             G T                      P+ AKR VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  63   SGTT----------------------PSEAKRVVNRCSGCRRKVGLTGFRCRCGELFCAE  100

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCSYDYKAAGREAIARENPV+RAAKI K+
Sbjct  101  HRYSDRHDCSYDYKAAGREAIARENPVIRAAKIVKV  136



>ref|XP_004306522.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Fragaria vesca subsp. vesca]
Length=170

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 117/161 (73%), Gaps = 13/161 (8%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF---AEKSPRST-F  398
            +T CVNNCGVTGNPATN+MCQKCFNATT+  T+ + A ++      F    EK PRS+ F
Sbjct  18   LTHCVNNCGVTGNPATNNMCQKCFNATTSTPTTVATATTSSTTAAVFKFSGEKVPRSSSF  77

Query  399  RRTSP-GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGE  575
            R  +P   T+       +ST     ++ ESS    +R VNRCSGCRRKVGLTGFRCRCGE
Sbjct  78   RFDAPPSETIRKAAASAEST-----RSEESS---MRRVVNRCSGCRRKVGLTGFRCRCGE  129

Query  576  LFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LFC EHRYSDRH CSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  130  LFCSEHRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRV  170



>ref|XP_007218519.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
 gb|EMJ19718.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
Length=165

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 115/158 (73%), Gaps = 15/158 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA-EKSPRST-FRR  404
            +T CVNNCGVTGNP+TN+MCQKCFNA++A +T++S +     +  KF+ EKSPRS+ F  
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSS----AVTLKFSGEKSPRSSSFSF  76

Query  405  TSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  584
             +P          E +      +   S  +  +R VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  77   EAPA---------EITRRTTASEIARSDESANRRVVNRCSGCRRKVGLTGFRCRCGELFC  127

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             EHRYSDRH CSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  128  SEHRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRV  165



>ref|XP_008231311.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Prunus mume]
Length=165

 Score =   167 bits (423),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 115/158 (73%), Gaps = 15/158 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA-EKSPRST-FRR  404
            +T CVNNCGVTGNP+TN+MCQKCFNA++A +T++S +     +  KF+ EKSPRS+ F  
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSS----AVTLKFSGEKSPRSSSFSF  76

Query  405  TSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  584
             +P          E +      +   S  +  +R VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  77   EAPA---------EITRRTTASEIARSDESANRRVVNRCSGCRRKVGLTGFRCRCGELFC  127

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             EHRYSDRH CSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  128  SEHRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRV  165



>ref|XP_008349960.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
 ref|XP_008349986.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=169

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 112/156 (72%), Gaps = 7/156 (4%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +T CVNNCGVTGNP+TN+MCQKC NA +AA+ +++ ++S+  I    AEKSPRS+   + 
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCXNAASAAAAAATSSSSSAAILKFSAEKSPRSSSSFSF  80

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
                    K       + DE        P +R VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  81   EAAAETCRKTTASEIARSDE-------TPNRRVVNRCSGCRRKVGLTGFRCRCGELFCSE  133

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  134  HRYSDRHVCSYDYKAAGREAIARENPVVKAAKIVRV  169



>ref|XP_010557789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=175

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 115/163 (71%), Gaps = 12/163 (7%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK-------FAEKSPR  389
            +T CVNNCGVTGNPATN+MCQKCFNATTA++ SS  +A+     +         A+K  R
Sbjct  18   LTLCVNNCGVTGNPATNNMCQKCFNATTASAVSSPPSAAAANNNNNSVKDGGLIAKKPAR  77

Query  390  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  569
             +  R+S  R+     K+  S ++     G  +    K+ VNRCSGCRRKVGLTGFRCRC
Sbjct  78   CSALRSSSDRSGLSAAKVIISRNR-----GNDAVEEEKKIVNRCSGCRRKVGLTGFRCRC  132

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GELFC EHRYS RHDCSYDYKAAGREAIARENPVV+AAKI K+
Sbjct  133  GELFCAEHRYSARHDCSYDYKAAGREAIARENPVVKAAKIIKV  175



>ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE87982.1| zinc finger family protein [Populus trichocarpa]
Length=179

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 113/169 (67%), Gaps = 20/169 (12%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNatt-------------aastsssvaastvPIPHKF  371
            +T C+NNCGVTGNPATN+MCQKCFNA+T                 +++ + S   I    
Sbjct  18   LTSCINNCGVTGNPATNNMCQKCFNASTSTSNSSSSSTATSMTFAATATSVSNNEILKFT  77

Query  372  AEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  551
             EKS RS+  R+        +K  + S +   +K    +   AK+EVNRCSGCRR+VGLT
Sbjct  78   GEKSARSSISRSL-------VKDPQKSPETASDKERSCAYHVAKKEVNRCSGCRRRVGLT  130

Query  552  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GFRCRCGELFC EHRYSDRHDCSYDYK AGREAIARENPVV+AAKI ++
Sbjct  131  GFRCRCGELFCWEHRYSDRHDCSYDYKTAGREAIARENPVVKAAKIVRV  179



>ref|XP_002298442.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK94884.1| unknown [Populus trichocarpa]
 gb|EEE83247.1| zinc finger family protein [Populus trichocarpa]
Length=181

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 114/171 (67%), Gaps = 22/171 (13%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssva---------------astvPIPH  365
            +T C+NNCGVTGNPATN+MCQKCFNA+T+ S  SS                  ST  I  
Sbjct  18   LTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSSTTTTTTTITFAATTNGVSTNEILK  77

Query  366  KFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVG  545
              +EKS RS+  R SP +      K     ++ D      S + AK+EVNRCSGCRR+VG
Sbjct  78   FTSEKSLRSSISR-SPAKDHQRQPKTASDKERSD------SSSVAKKEVNRCSGCRRRVG  130

Query  546  LTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LTGFRCRCGELFC EHRYSDRHDCSYDYK  GREAIARENPVV+AAKI ++
Sbjct  131  LTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREAIARENPVVKAAKIVRV  181



>ref|XP_010106958.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
Length=172

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT CVNNCGV GNPATN+MCQ CFNATT  + +S+   + +    + +  S  S+  R +
Sbjct  18   ITLCVNNCGVIGNPATNNMCQNCFNATTTTAAASTSTTANLKFSGEKSSSSAISSSSRPT  77

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
              R+    +    +T     ++ E    PAKR VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  78   DRRSASPAENSRKTTAD-SARSEEDEAVPAKRVVNRCSGCRRKVGLTGFRCRCGELFCAE  136

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCSYDYK+ GREAIARENPVV+AAKI ++
Sbjct  137  HRYSDRHDCSYDYKSVGREAIARENPVVKAAKIVRV  172



>ref|XP_012065536.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Jatropha curcas]
 gb|KDP43451.1| hypothetical protein JCGZ_16738 [Jatropha curcas]
Length=185

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 117/176 (66%), Gaps = 28/176 (16%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP--------  386
            +T CVNNCG TGNPATN+MCQKCFNATT+ S S++V A    +P      +         
Sbjct  18   LTLCVNNCGFTGNPATNNMCQKCFNATTSTSNSATVTA---AVPANTTSTTTTTSSAAVV  74

Query  387  -------RSTFRRTSPGRTVPD-----LKKLEDSTDKIDEKTGESSPAPAKREVNRCSGC  530
                   R + R +     + D      +K++ STD+      +S  A A+REVNRCSGC
Sbjct  75   SSGSEILRKSPRSSLSRSPIRDPLRQTNQKVQTSTDR-----EKSDAAVARREVNRCSGC  129

Query  531  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGREAI RENPVV+AAKI ++
Sbjct  130  RRKVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKAAGREAITRENPVVKAAKIVRV  185



>ref|XP_010257261.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=163

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 109/161 (68%), Gaps = 19/161 (12%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKS-PRSTFRRT  407
            +T C+NNCG  GNP TN+MCQ CF A+                P KF+ K  PRS+  R 
Sbjct  17   LTLCINNCGFPGNPTTNNMCQNCFKASAGVL-----------TPLKFSGKDKPRSSSVR-  64

Query  408  SPGRT----VPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGE  575
            SP R+     P++  L + T +      E + +  +REVNRCSGCRRKVGLTGFRCRCG+
Sbjct  65   SPERSDRPAEPEI--LREVTKRDTTAAAEVTSSVVRREVNRCSGCRRKVGLTGFRCRCGD  122

Query  576  LFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LFC EHRYSDRH+CSYDYKAAGREAI+RENPVV+AAKI K+
Sbjct  123  LFCSEHRYSDRHECSYDYKAAGREAISRENPVVKAAKIVKI  163



>ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=165

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 14/159 (9%)
 Frame = +3

Query  231  ITPCVNNCGVT--GNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRR  404
            IT C+NNCGVT  GN ATN+MCQ CF A+TA ++S+   +S        +  S RS    
Sbjct  18   ITVCINNCGVTVTGNAATNNMCQNCFTASTATTSSTVGISSQSSRSGVISVNSVRS----  73

Query  405  TSPGRTVPDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  581
              P R++P     E+S++  D  +  +++ + AKR V+RCSGCRRKVGLTGFRCRCG+LF
Sbjct  74   --PKRSLP-----EESSEITDRNSSDQTTISEAKRVVSRCSGCRRKVGLTGFRCRCGDLF  126

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            C EHRYSDRHDCS+DYKAAGREAIARENPV+RAAKI K+
Sbjct  127  CSEHRYSDRHDCSFDYKAAGREAIARENPVIRAAKIVKV  165



>ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
5-like [Glycine max]
 gb|ADK25058.1| AN1-like transcription factor [Glycine max]
Length=164

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 109/156 (70%), Gaps = 9/156 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT CVNNCGVTGNPATN+MCQKCF A T ++ ++S A          A  + RS      
Sbjct  18   ITLCVNNCGVTGNPATNNMCQKCFTAFTTSTATTSGAGG-----AGIASPATRSGI----  68

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
              R +      E S       + +++P+ AKR VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  69   SARPLKRSFPEEPSPPADPPSSDQTTPSEAKRVVNRCSGCRRKVGLTGFRCRCGELFCAE  128

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCSYDYKAAGREAIARENPV+RAAKI K+
Sbjct  129  HRYSDRHDCSYDYKAAGREAIARENPVIRAAKIVKV  164



>ref|XP_010547246.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=179

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 115/171 (67%), Gaps = 24/171 (14%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaast---------------vPIPH  365
            +T CVNNCGVTGNPATN+MCQKCFNATTA+S+SSSV++                  PI  
Sbjct  18   LTLCVNNCGVTGNPATNNMCQKCFNATTASSSSSSVSSIAGANNVVKEGGVGVGGGPISK  77

Query  366  KFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVG  545
            K A  S     R  S  R+  DL  ++     I  +  ES     ++ VNRCSGCRRKVG
Sbjct  78   KTARSSA---LRSLSKDRS--DLSPVK----VIIGRNRESDVTEVEKIVNRCSGCRRKVG  128

Query  546  LTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LTGFRCRCGELFC EHRYSDRHDCSYDYKA GRE IARENPVV+AAKI K+
Sbjct  129  LTGFRCRCGELFCAEHRYSDRHDCSYDYKAVGRETIARENPVVKAAKIVKV  179



>ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
 gb|EOA31605.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
Length=163

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 106/151 (70%), Gaps = 17/151 (11%)
 Frame = +3

Query  246  NNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTV  425
            NNCGVT NPATN+MCQKCFNA+  ++ +S V   T  I     ++S RS   R+SP + V
Sbjct  30   NNCGVTANPATNNMCQKCFNASLVSAATSGVVVDTGSI----LKRSARSVNLRSSPAKVV  85

Query  426  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSD  605
              ++  E    K D++            VNRCSGCR+KVGLTGFRCRCGELFC EHRYSD
Sbjct  86   --IRPREMDAVKRDQQV-----------VNRCSGCRKKVGLTGFRCRCGELFCSEHRYSD  132

Query  606  RHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  133  RHDCSYDYKTAGREAIARENPVVKAAKMVKV  163



>ref|XP_006407313.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
 gb|ESQ48766.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
Length=158

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 106/153 (69%), Gaps = 22/153 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT NPATN+MCQKCFNA+ AA+   S +           ++S RS   R++P +
Sbjct  28   CSNNCGVTANPATNNMCQKCFNASVAAAGVESGS---------MLKRSARSVNLRSTPAK  78

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V  ++  E    K D++T           VNRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  79   VV--IRSREIDPVKRDQQT-----------VNRCSGCRKKVGLTGFRCRCGDLFCAEHRY  125

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  126  SDRHDCSYDYKTAGREAIARENPVVKAAKMVKV  158



>gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata]
Length=178

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 113/167 (68%), Gaps = 19/167 (11%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastv----PIPHKFAEKSPRSTF  398
            I+ CV  CGV GN ATN++C  CFN+T  A+ +++ AA+         H F EKS RS+ 
Sbjct  20   ISLCVK-CGVAGNCATNNLCHTCFNSTAPAAAAAAAAAAGGDKLPAASHVFVEKSFRSSS  78

Query  399  -------RRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGF  557
                   +R  P  T  DL+KL+DS           +  P KREVNRCSGCRRKVGLTGF
Sbjct  79   SVRLLPEKRIIPAETSRDLRKLDDSP-------AAEAALPLKREVNRCSGCRRKVGLTGF  131

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RCRCG+LFC +HRYSDRHDCSYDYK+AGREAI RENPVV+AAKI K+
Sbjct  132  RCRCGDLFCADHRYSDRHDCSYDYKSAGREAIERENPVVKAAKIIKI  178



>ref|XP_011087429.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=170

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 111/159 (70%), Gaps = 10/159 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK---FAEKSPRSTFR  401
            I+ CVN CGV GN A N++CQKCFN TTA++ +S+ A S     H    F EKS RS   
Sbjct  19   ISLCVN-CGVAGNSAANNLCQKCFNTTTASTAASAAATSPGGAKHVNNVFVEKSFRSI--  75

Query  402  RTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  581
              SP R         D++  +  +  E    P KR+VNRCSGCRRKVGLTGFRCRCGELF
Sbjct  76   TCSPERKFDSA----DTSGDLKIEAAEVEAPPVKRQVNRCSGCRRKVGLTGFRCRCGELF  131

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            C +HRYSDRHDCSYDYKAAGR+AIARENPVV+AAKI K+
Sbjct  132  CADHRYSDRHDCSYDYKAAGRQAIARENPVVKAAKIVKI  170



>ref|XP_007149048.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
 gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
Length=301

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 114/156 (73%), Gaps = 9/156 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT CVNNCGVTGNPATN+MCQ CF A TA++ ++S AAS        +  S RS      
Sbjct  155  ITLCVNNCGVTGNPATNNMCQNCFTAFTASTATTSSAASA-----GISSPSARSVASARP  209

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
              R+ P+    E S+      + +++P+ AKR VNRCSGCRRKVGLTGFRCRCG+LFC E
Sbjct  210  QKRSFPE----EPSSAADPPSSDQNAPSEAKRVVNRCSGCRRKVGLTGFRCRCGDLFCAE  265

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCSYDYKAAGREAIARENPVVRAAKI K+
Sbjct  266  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIVKV  301



>ref|XP_006482901.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Citrus sinensis]
 gb|KDO36542.1| hypothetical protein CISIN_1g030404mg [Citrus sinensis]
Length=178

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 112/166 (67%), Gaps = 15/166 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaast---------vPIPHKFAEKS  383
            +T CVNNCG TGNPATN+MCQKCFNAT   + S+   +ST         V I    +EKS
Sbjct  18   LTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGGGGGGGSGVAIIKFSSEKS  77

Query  384  PRST-FRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFR  560
             RS    R+          + ++ TD+      E      KR VNRCSGCRRKVGLTGFR
Sbjct  78   LRSRPIIRSGSSDAAGTTGQNQELTDR-----REKEANVEKRVVNRCSGCRRKVGLTGFR  132

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCGELFCGEHRYSDRHDCSYDYK+AGR+AIARENPV++AAKI ++
Sbjct  133  CRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV  178



>ref|XP_010067883.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Eucalyptus grandis]
 gb|KCW66121.1| hypothetical protein EUGRSUZ_G03392 [Eucalyptus grandis]
Length=190

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 117/179 (65%), Gaps = 29/179 (16%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaa------------------stvP  356
            +T CVNNCG  GNPATN+MCQKCFNA++++S+SS+  +                  +  P
Sbjct  18   LTLCVNNCGFAGNPATNNMCQKCFNASSSSSSSSTTTSTTASTASSAPTTSSSAGLTGGP  77

Query  357  IPHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAP-----AKREVNRC  521
               KF+ +       R+ P    PD   L  +   I   TG S P+      A+REVNRC
Sbjct  78   SVLKFSAER----IHRSGPFSRSPDRSGL--AMGMIRRDTGASPPSSTESNSARREVNRC  131

Query  522  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SGCR++VGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  132  SGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENPVVKAAKIVRV  190



>ref|XP_006438985.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
 gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
Length=179

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 112/167 (67%), Gaps = 16/167 (10%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaast----------vPIPHKFAEK  380
            +T CVNNCG TGNPATN+MCQKCFNAT   + S+   +ST          V I    +EK
Sbjct  18   LTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTSGGGGGGGSGVAIIKFSSEK  77

Query  381  SPRST-FRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGF  557
            S RS    R+          + ++ TD+      E      KR VNRCSGCRRKVGLTGF
Sbjct  78   SLRSRPIIRSGSSDAAGTTGQNQELTDR-----REKEANVEKRVVNRCSGCRRKVGLTGF  132

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RCRCGELFCGEHRYSDRHDCSYDYK+AGR+AIARENPV++AAKI ++
Sbjct  133  RCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV  179



>emb|CDY52666.1| BnaC01g38560D [Brassica napus]
Length=155

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 22/153 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT NPATN+MCQKCFNA+ AA+   S +           ++S RS   R++P +
Sbjct  25   CSNNCGVTANPATNNMCQKCFNASVAAAGVDSTS---------ILKRSARSVNLRSTPAK  75

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V  ++  E    K D++T           +NRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  76   VV--IRPREIDPVKRDQQT-----------INRCSGCRKKVGLTGFRCRCGDLFCAEHRY  122

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  123  SDRHDCSYDYKTAGREAIARENPVVKAAKMVKV  155



>ref|XP_009120462.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Brassica rapa]
 emb|CDY50536.1| BnaA01g30440D [Brassica napus]
Length=156

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 22/153 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT NPATN+MCQKCFNA+ AA+   S +           ++S RS   R++P +
Sbjct  26   CSNNCGVTANPATNNMCQKCFNASVAAAGVDSTS---------ILKRSARSVNLRSTPAK  76

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V  ++  E    K D++T           +NRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  77   VV--IRPREIDPVKRDQQT-----------INRCSGCRKKVGLTGFRCRCGDLFCAEHRY  123

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  124  SDRHDCSYDYKTAGREAIARENPVVKAAKMVKV  156



>ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=172

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 104/156 (67%), Gaps = 1/156 (1%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +  CVNNCG TGNPATN+MCQKCF+A+ +A+ +++  A              RS+  R S
Sbjct  18   LALCVNNCGFTGNPATNNMCQKCFSASASAAAAAAAGALKSSHKVSGGAADARSSSAR-S  76

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P R     +   D T               KREVNRCSGCRRKVGLTGFRCRCG+LFC E
Sbjct  77   PERMDSLAETSLDRTKDAASAAAVEEVGKVKREVNRCSGCRRKVGLTGFRCRCGDLFCAE  136

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRY+DRH+CSYDYK AGREAIARENPVV+AAKI ++
Sbjct  137  HRYTDRHECSYDYKTAGREAIARENPVVKAAKIVRV  172



>gb|KFK38611.1| hypothetical protein AALP_AA3G136800 [Arabis alpina]
Length=160

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 107/151 (71%), Gaps = 21/151 (14%)
 Frame = +3

Query  246  NNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTV  425
            NNCGVT NPATN+MCQKCFNA+ A +++ S +           ++S RS   R+S  + V
Sbjct  31   NNCGVTANPATNNMCQKCFNASIAVASADSGS---------ILKRSARSVNLRSSQTKVV  81

Query  426  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSD  605
               +++ DS+ K D++            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSD
Sbjct  82   IRNREI-DSSVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSD  129

Query  606  RHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  130  RHDCSYDYKTAGREAIARENPVVKAAKMVKV  160



>gb|KJB25036.1| hypothetical protein B456_004G173900 [Gossypium raimondii]
Length=180

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 115/166 (69%), Gaps = 13/166 (8%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +T CVNNCGVTGNPATN+MCQKCF+ATTAA++SSS + +         +KS RST  R+ 
Sbjct  18   LTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSTNNTATSAT-DDKSSRSTPTRSQ  76

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPA----------KREVNRCSGCRRKVGLTGFR  560
              R+  D      +          +SP  A          K+ VNRCSGCR++VGLTGFR
Sbjct  77   DNRS--DSAPPTTAATTATATATTNSPMTASNRSGYDTAEKKSVNRCSGCRKRVGLTGFR  134

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCGELFC +HRYSDRHDCSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  135  CRCGELFCSDHRYSDRHDCSYDYKAAGREAIARENPVVKAAKIIRV  180



>ref|XP_010534277.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=189

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 113/179 (63%), Gaps = 30/179 (17%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaas-----------------------tsssva  341
            +T CVNNCGVTGNPA N+MCQKCFNATTA S                             
Sbjct  18   LTLCVNNCGVTGNPANNNMCQKCFNATTATSSSSSAAASASASSLPSAAATSASNGVKDG  77

Query  342  astvPIPHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRC  521
            A  + +    ++KS RS+  R+S  R+ P L K+    ++      ES     K+ VNRC
Sbjct  78   AFGLGVGGPISKKSLRSSAIRSSD-RSGPYLAKVTIIRNR------ESDGTEEKKIVNRC  130

Query  522  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGREAIARENPVV+ AKI K+
Sbjct  131  SGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENPVVKPAKIVKV  189



>ref|XP_007052561.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
 gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
Length=192

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 117/175 (67%), Gaps = 19/175 (11%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPI--------------PHK  368
            +T C+NNCGVTGNPATN+MCQKCFNATTA  +SSS ++S+                 P  
Sbjct  18   LTLCINNCGVTGNPATNNMCQKCFNATTATPSSSSSSSSSATSPSATGGAIAGGASIPKF  77

Query  369  FAEKSPRSTFRRTSPGRTVPD----LKKLEDSTDKIDEKTGESSPAPA-KREVNRCSGCR  533
              ++S RST  R+   R+          + +S      ++G    A A K+ VNRCSGCR
Sbjct  78   SDDQSSRSTPSRSQQNRSDSSPPTTAATVTNSRTTAWNRSGNDPAAAAEKKVVNRCSGCR  137

Query  534  RKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            ++VGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGREAIARENPVV+AAKI ++
Sbjct  138  KRVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKTAGREAIARENPVVKAAKIIRV  192



>ref|XP_009146604.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 106/153 (69%), Gaps = 22/153 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT NPATN+MCQKCFNA+ AA+   S +          ++++ RS   R SP +
Sbjct  29   CSNNCGVTANPATNNMCQKCFNASIAAAGVDSGST---------SKRASRSVNLRPSPAK  79

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V  ++  E    K D++T           VNRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  80   VV--IRPREIDPVKRDQQT-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRY  126

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  127  SDRHDCSYDYKTAGREAIARENPVVKAAKMVKV  159



>ref|XP_010279007.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=164

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 105/159 (66%), Gaps = 14/159 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKS-PRSTFRRT  407
            +T C+NNCG  GNP TN+MCQ CF A+                P KF+ K  PRS+  R+
Sbjct  17   LTLCINNCGFPGNPTTNNMCQNCFKASAGVL-----------TPLKFSGKDKPRSSSVRS  65

Query  408  SPGRTVPDLKKLEDSTDKID--EKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  581
                  P   ++     K D    +  +S A  KREVNRCSGCRRKVGLTGFRCRCGELF
Sbjct  66   PERSDRPAETRIFKEVTKRDTTAASEAASAAVVKREVNRCSGCRRKVGLTGFRCRCGELF  125

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            C EHRYSDRH+CS+DYKAAGREAIARENPVV+AAKI ++
Sbjct  126  CSEHRYSDRHECSFDYKAAGREAIARENPVVKAAKIVRV  164



>emb|CDY00788.1| BnaC03g37720D [Brassica napus]
Length=155

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 101/153 (66%), Gaps = 25/153 (16%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT +P+TN+MCQKCFNA               P P   A++S RS   R++P +
Sbjct  27   CSNNCGVTASPSTNNMCQKCFNAGID------------PTP--IAKRSARSVSLRSTPAK  72

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
                ++  E    K D           ++ VNRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  73   AA--IRPRETDPVKRDHH---------QQTVNRCSGCRKKVGLTGFRCRCGDLFCAEHRY  121

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRHDCSYDYK AGREAIARENPVV+AAK+ KL
Sbjct  122  SDRHDCSYDYKTAGREAIARENPVVKAAKMVKL  154



>emb|CDX73811.1| BnaA03g32360D [Brassica napus]
Length=159

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 102/153 (67%), Gaps = 22/153 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT +P+TN+MCQKCFNA+ +              P    ++S RS   R++P R
Sbjct  28   CSNNCGVTASPSTNNMCQKCFNASVSGID-----------PTPIVKRSARSVSLRSTPAR  76

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V  ++  E    K D           ++ VNRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  77   AV--IRPRETDPVKRDHH---------QQTVNRCSGCRKKVGLTGFRCRCGDLFCSEHRY  125

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRH+CSYDYK AGREAIARENPVV+AAK+ KL
Sbjct  126  SDRHECSYDYKTAGREAIARENPVVKAAKMVKL  158



>ref|XP_009135242.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 102/153 (67%), Gaps = 22/153 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT +P+TN+MCQKCFNA+ +              P    ++S RS   R++P R
Sbjct  28   CSNNCGVTASPSTNNMCQKCFNASVSGID-----------PTPIVKRSARSVSLRSTPAR  76

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V  ++  E    K D           ++ +NRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  77   AV--IRPRETDPVKRDHH---------QQTINRCSGCRKKVGLTGFRCRCGDLFCAEHRY  125

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRH+CSYDYK AGREAIARENPVV+AAK+ KL
Sbjct  126  SDRHECSYDYKTAGREAIARENPVVKAAKMVKL  158



>ref|XP_011025067.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=249

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 138/240 (58%), Gaps = 21/240 (9%)
 Frame = +3

Query  42   TQPKSDSLP-ISLSLSVY---FNLSSLS-----LELFIQKSfvfff*eifvvvkmvqkte  194
            T P+S  +P ISL LS     F+L SLS     L+L   K             + + +  
Sbjct  10   TDPQSLQIPHISLRLSTKPQPFSLLSLSEPNKKLQLLRTKDSSILNSCRKNNNQEMAQRT  69

Query  195  keetefkvvpetITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA  374
            ++E     VPE +T C+NNCGVTGNPATN+MCQKCFNA+T+ S  SS  ++T        
Sbjct  70   EKEETECKVPENLTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSTTSNTTAATTTTI  129

Query  375  EK-------SPRSTFRRTSP-----GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNR  518
                     S     + TS        +    K  +       +K    S + AK+EVNR
Sbjct  130  TFAATTNGVSTNEILKFTSEKSLRSSISRSLAKDHQKQPKTASDKERSDSSSVAKKEVNR  189

Query  519  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK  GREAIARENPVV+AAKI ++
Sbjct  190  CSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREAIARENPVVKAAKIVRV  249



>gb|AIJ00004.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Gossypium hirsutum]
Length=180

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 117/167 (70%), Gaps = 15/167 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAE-KSPRSTFRRT  407
            +T CVNNCGVTGNPATN+MCQKCF+ATTAA++SSS ++ST        + KS RST  R+
Sbjct  18   LTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSSSTNNTATSATDDKSSRSTPTRS  77

Query  408  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPA----------KREVNRCSGCRRKVGLTGF  557
               R+         +T         +SP  A          K+ VNRCSGCR++VGLTGF
Sbjct  78   QDNRS----DSAPPTTAATTATATTNSPMTASNRSGYDTAEKKSVNRCSGCRKRVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RCRCGELFC +HRYSDRHDCSYDYKAAGREAIARENPVV+AAKI ++
Sbjct  134  RCRCGELFCSDHRYSDRHDCSYDYKAAGREAIARENPVVKAAKIIRV  180



>emb|CDY08419.1| BnaA05g26550D [Brassica napus]
Length=159

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 22/153 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT NPATN+MCQKCFNA+ AA+   S +          ++++ RS   R SP +
Sbjct  29   CSNNCGVTANPATNNMCQKCFNASIAAAGVDSGST---------SKRASRSVNLRPSPAK  79

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V  ++  E    K D++T           VNRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  80   VV--IRPREIDPVKRDQQT-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRY  126

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRH+CSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  127  SDRHECSYDYKTAGREAIARENPVVKAAKMVKV  159



>ref|NP_566429.1| E3 ligase SAP5 [Arabidopsis thaliana]
 sp|Q9LHJ8.1|SAP5_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 5; Short=AtSAP5 [Arabidopsis thaliana]
 gb|AAG51008.1|AC069474_7 unknown protein; 15087-14605 [Arabidopsis thaliana]
 dbj|BAB02254.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM61324.1| unknown [Arabidopsis thaliana]
 gb|AAP88348.1| At3g12630 [Arabidopsis thaliana]
 dbj|BAF00270.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75226.1| E3 ligase SAP5 [Arabidopsis thaliana]
Length=160

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 104/148 (70%), Gaps = 18/148 (12%)
 Frame = +3

Query  255  GVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTVPDL  434
            GVT NPATN+MCQKCFNA+  ++ +  V + +        ++S RS   R+SP + V   
Sbjct  31   GVTANPATNNMCQKCFNASLVSAAAGVVESGS------ILKRSARSVNLRSSPAKVVIRP  84

Query  435  KKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHD  614
            +++ D+  K D++            VNRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHD
Sbjct  85   REI-DAVKKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHD  132

Query  615  CSYDYKAAGREAIARENPVVRAAKIFKL  698
            CSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  133  CSYDYKTAGREAIARENPVVKAAKMVKV  160



>ref|XP_011093526.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Sesamum indicum]
Length=177

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 108/161 (67%), Gaps = 7/161 (4%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastv-----PIPHKFAEKSPRST  395
            IT CV  CGV GN ATN++CQ C++   AASTS+    +       P  H F  KS RS+
Sbjct  19   ITLCVK-CGVAGNSATNNLCQTCYSTPAAASTSAVGTPAASAGGPKPKNHVFVGKSFRSS  77

Query  396  FRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGE  575
                S      ++ +      K   +T + +P P KREVNRCSGCRRKVGLTGFRCRCGE
Sbjct  78   SSTRSSLERSLNMSETSGDLKKEASETADVAP-PVKREVNRCSGCRRKVGLTGFRCRCGE  136

Query  576  LFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LFC +HRYSDRHDCSYDYK AGREAIARENPVV+AAKI K+
Sbjct  137  LFCADHRYSDRHDCSYDYKTAGREAIARENPVVKAAKIVKI  177



>ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis melo]
Length=169

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 114/159 (72%), Gaps = 10/159 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK---FAEKSPRSTFR  401
            IT CVNNCG TGNP TN+MCQKCFNATTA +T+++ ++S   I        EKS RS  R
Sbjct  18   ITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTGISSSRKLSGEKSLRS--R  75

Query  402  RTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  581
              SP   + D  +       +D    E S   AKR+VNRCSGCR++VGLTGFRCRCGELF
Sbjct  76   SRSP--VLMDSVRDNSRNMSMDRFKSEES---AKRQVNRCSGCRKRVGLTGFRCRCGELF  130

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            C EHRYSDRHDCS+DYKAAGR+AIARENPVV+A KI ++
Sbjct  131  CAEHRYSDRHDCSFDYKAAGRDAIARENPVVKAPKIVRV  169



>ref|XP_010499267.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Camelina sativa]
Length=166

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 104/151 (69%), Gaps = 18/151 (12%)
 Frame = +3

Query  246  NNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTV  425
            NNCGVT NPATN+MCQKCFNA+  ++    V + +  +     ++  RS   R+SP + V
Sbjct  34   NNCGVTANPATNNMCQKCFNASLVSTGVVVVDSGSSVL-----KRPARSVNLRSSPAKVV  88

Query  426  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSD  605
              ++  E    K D++            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSD
Sbjct  89   --IRPREIDAVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSD  135

Query  606  RHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  136  RHDCSYDYKTAGREAIARENPVVKAAKMVKV  166



>ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59042.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 102/148 (69%), Gaps = 19/148 (13%)
 Frame = +3

Query  255  GVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTVPDL  434
            GVT NPATN+MCQKCFNA+  ++ +  V + +        ++S RS   R+SP + V  +
Sbjct  32   GVTANPATNNMCQKCFNASLVSAAAGVVESGS------ILKRSARSVNLRSSPAKVV--I  83

Query  435  KKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHD  614
            +  E    K D++            VNRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHD
Sbjct  84   RTREIDAVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHD  132

Query  615  CSYDYKAAGREAIARENPVVRAAKIFKL  698
            CSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  133  CSYDYKTAGREAIARENPVVKAAKMVKV  160



>emb|CDY67538.1| BnaUnng02260D [Brassica napus]
Length=159

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 104/153 (68%), Gaps = 22/153 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCGVT NPATN+MCQKCFNA+ AA+   S +           +++ RS   R +P +
Sbjct  29   CSNNCGVTANPATNNMCQKCFNASIAAAGVDSGSTL---------KRASRSVNLRPTPAK  79

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V  ++  E    K D++T           VNRCSGCR+KVGLTGFRCRCG+LFC EHRY
Sbjct  80   VV--IRPREIDPVKRDQQT-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRY  126

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRH+CSYDYK AGREAIARENPVV+AAK  K+
Sbjct  127  SDRHECSYDYKTAGREAIARENPVVKAAKTVKV  159



>gb|KJB22229.1| hypothetical protein B456_004G036200 [Gossypium raimondii]
Length=173

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 111/158 (70%), Gaps = 4/158 (3%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAE-KSPRSTFRRT  407
            +T CVN+CGV GNPATN+MCQ CFNATT  ST++ V++ST           + RST  R+
Sbjct  18   LTLCVNDCGVIGNPATNNMCQNCFNATTPKSTAAVVSSSTGGASSGGVSILNQRSTTSRS  77

Query  408  SPGRTVPDLKKLEDST-DKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  584
               R+  DL   + +T  +      +  P   K+ VNRCSGCR++VGLTGFRCRCGELFC
Sbjct  78   INKRS--DLSPPKTTTFVRSSGSRYDPEPGTEKKVVNRCSGCRKRVGLTGFRCRCGELFC  135

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             +HRYSDRHDCSYDYK  GREAIARENPVV+AAKI K+
Sbjct  136  ADHRYSDRHDCSYDYKTVGREAIARENPVVKAAKIIKV  173



>ref|XP_010497315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=170

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 105/152 (69%), Gaps = 16/152 (11%)
 Frame = +3

Query  246  NNCGVTGNPATNS-MCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRT  422
            NNCGVT NPATN+ MCQKCFNA+  ++T+  V   +        ++S RS   R+SP + 
Sbjct  34   NNCGVTANPATNNNMCQKCFNASLVSATTGVVVVDSGSSSV--LKRSARSVNLRSSPAKV  91

Query  423  VPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYS  602
            V  ++  E    K D++            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYS
Sbjct  92   V--IRPREIDAVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYS  138

Query  603  DRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            DRHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  139  DRHDCSYDYKTAGREAIARENPVVKAAKMVKV  170



>ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN58601.1| hypothetical protein Csa_3G697940 [Cucumis sativus]
Length=169

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 113/157 (72%), Gaps = 6/157 (4%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT CVNNCG TGNP TN+MCQKCFNATTA +T+++ ++S   I    +     S  + + 
Sbjct  18   ITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTGI----SSSRKLSGEKSSR  73

Query  411  PGRTVPDL-KKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
                 P L   + DS+  I     +S  + AKR+VNRCSGCR++VGLTGFRCRCGELFC 
Sbjct  74   SRSRSPVLMDSVRDSSRNISMDRFKSEES-AKRQVNRCSGCRKRVGLTGFRCRCGELFCA  132

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            EHRYSDRHDCS+DYKAAGR+AIARENPVV+A KI ++
Sbjct  133  EHRYSDRHDCSFDYKAAGRDAIARENPVVKAPKIVRV  169



>ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Elaeis guineensis]
Length=158

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 104/156 (67%), Gaps = 13/156 (8%)
 Frame = +3

Query  234  TPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRST-FRRTS  410
            T CVNNCG  GNPATN+MCQ CF A   AS+SS  + S          + PRS  FR   
Sbjct  15   TLCVNNCGFYGNPATNNMCQACFQAAGFASSSSPPSCS--------GHEKPRSAPFRLPD  66

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P        ++E    K        +PA   R+VNRC+GCR++VGLTGFRCRCGELFC E
Sbjct  67   PA-AEGGRGRVEGPAAKAVAAATRLAPA---RQVNRCAGCRKRVGLTGFRCRCGELFCAE  122

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCS+DYKAAGREAIARENP+VRAAK+ K+
Sbjct  123  HRYSDRHDCSFDYKAAGREAIARENPLVRAAKLVKI  158



>ref|XP_010465038.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=213

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 105/155 (68%), Gaps = 22/155 (14%)
 Frame = +3

Query  246  NNCGVTGNPATNS-MCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRT  422
            NNCGVT NPATN+ MCQKCFNA+  ++T+  V   +        ++S RS   R+SP + 
Sbjct  77   NNCGVTANPATNNNMCQKCFNASLVSATTGVVVVDSGS--SSVLKRSARSVNLRSSPAKV  134

Query  423  VPDLKKLEDSTDKIDEKTGESSPAPAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEH  593
            V   ++++                P KR+   VNRCSGCR+KVGLTGFRCRCGELFC EH
Sbjct  135  VIRPREID----------------PVKRDQQIVNRCSGCRKKVGLTGFRCRCGELFCSEH  178

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RYS RHDCSYDYK AGREAIARENPVV+AAK+ K+
Sbjct  179  RYSGRHDCSYDYKTAGREAIARENPVVKAAKMVKV  213



>gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata]
Length=179

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 112/163 (69%), Gaps = 9/163 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaast-------vPIPHKFAEKSPR  389
            I  CV  CGV GN A N++CQKCF++TTA +++S+VAA+         P    F EKS R
Sbjct  19   IALCVK-CGVPGNSAANNLCQKCFSSTTAEASTSAVAAAPASSSGGAKPKSLVFGEKSFR  77

Query  390  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  569
            S     S      +L       +K      +++P PAKREVNRC+GCRRKVGLTGFRCRC
Sbjct  78   SRSSTRSSPERRLNLPVTVLDLEKNPSAVADAAP-PAKREVNRCTGCRRKVGLTGFRCRC  136

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GELFC +HRYSDRHDCSYDYK AGREAIARENPVV+AAKI K+
Sbjct  137  GELFCADHRYSDRHDCSYDYKTAGREAIARENPVVKAAKIVKI  179



>ref|XP_010928494.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Elaeis guineensis]
Length=161

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 99/158 (63%), Gaps = 12/158 (8%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +T CVNNCG  GNPATN+MCQ CF A    S S          P +   + P ST  R S
Sbjct  14   LTLCVNNCGFYGNPATNNMCQACFQAAGFTSPSP---------PSRSGHEKPSSTPTR-S  63

Query  411  PGRTVPDLKKLEDS--TDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  584
            P   V   +   +S            +    + R VNRC+GCR++VGLTGFRCRCG LFC
Sbjct  64   PDPAVEAGRGGAESPAAKTDAATAAAAVGVASARRVNRCAGCRKRVGLTGFRCRCGNLFC  123

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             EHRYSDRHDCS+DYKAAGREAIARENPVVRAAKI K+
Sbjct  124  VEHRYSDRHDCSFDYKAAGREAIARENPVVRAAKIVKI  161



>ref|XP_008795709.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
 ref|XP_008778992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
Length=157

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 100/157 (64%), Gaps = 14/157 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-RSTFRRT  407
            +T CVNNCG  GNPATN+MCQ CF A   AS S           H+ A  +P RS     
Sbjct  14   LTLCVNNCGFYGNPATNNMCQACFQAAGFASPSPPSR-----SSHEKASSAPARSLDPAA  68

Query  408  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
              GR        E +     +    ++     R V+RC+GCR++VGLTGFRCRCG+LFC 
Sbjct  69   EAGR--------EGAEGPAGKADAAAAVVSPARRVSRCAGCRKRVGLTGFRCRCGKLFCA  120

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            +HRYSDRHDCS+DYKAAGREAIARENPVVRAAKI K+
Sbjct  121  QHRYSDRHDCSFDYKAAGREAIARENPVVRAAKIVKI  157



>gb|AAR83854.1| induced stolon tip protein [Capsicum annuum]
Length=88

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 77/90 (86%), Gaps = 5/90 (6%)
 Frame = +3

Query  429  DLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDR  608
            DLKK++   D++     + S  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDR
Sbjct  4    DLKKVKQEDDQL-----KDSLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDR  58

Query  609  HDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HDCSYDYK AGREAIARENPVV+AAKI K+
Sbjct  59   HDCSYDYKTAGREAIARENPVVKAAKIIKV  88



>ref|XP_003599112.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AES69363.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
 gb|AFK37674.1| unknown [Medicago truncatula]
Length=163

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 94/156 (60%), Gaps = 18/156 (12%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            I  C+ NCGV GNP+TN+MCQ CF A+T     SS  +   P   +    S       T 
Sbjct  26   INLCIKNCGVVGNPSTNNMCQNCFTASTTILPPSSSRSVRSPKRSRQESSSSSEEEGSTD  85

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
                           D +DEKT     +  KR V+RCSGCRRKVGL GFRCRCGELFC +
Sbjct  86   H--------------DLVDEKT----VSEVKRVVSRCSGCRRKVGLAGFRCRCGELFCAD  127

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDC YDYK  GRE IARENPV+RAAKI K+
Sbjct  128  HRYSDRHDCGYDYKKVGREEIARENPVIRAAKIVKV  163



>ref|XP_008776561.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Phoenix dactylifera]
Length=160

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 100/155 (65%), Gaps = 9/155 (6%)
 Frame = +3

Query  234  TPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  413
            T CVNNCG  GNPATN+MCQ CF A   A+ SS  + S        + + PRS   R+  
Sbjct  15   TLCVNNCGFYGNPATNNMCQACFQAAGFAAPSSPPSCS--------SHEKPRSAPARSPD  66

Query  414  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
                    +      K D     +    AKR VNRC+GCR++VGLTGFRCRCGELFC EH
Sbjct  67   PAAEGGWGEARGPPAKPDAAAAAAGVTLAKR-VNRCAGCRKRVGLTGFRCRCGELFCAEH  125

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RYSDRHDCS+DYKAAGREAI RENPVVRA+KI K+
Sbjct  126  RYSDRHDCSFDYKAAGREAITRENPVVRASKIVKI  160



>gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii]
Length=87

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  438  KLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDC  617
            K+ D     +E   ++S  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDC
Sbjct  1    KVGDRMMVKEEDQLKASLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDC  60

Query  618  SYDYKAAGREAIARENPVVRAAKIFKL  698
            SYDYK AGREAIARENPVV+AAKI K+
Sbjct  61   SYDYKTAGREAIARENPVVKAAKIIKV  87



>gb|EMT33843.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
11 [Aegilops tauschii]
Length=172

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 99/157 (63%), Gaps = 6/157 (4%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A++++ + S+ +  +       +  +    F +  
Sbjct  21   ITLCANSCGFPGNPATKNLCQNCFLASSSSPSPSAASPPS-----PSSSPAAFPLFDKLR  75

Query  411  PGRTVPDLKKLEDSTDKIDE-KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
            P      L +       +D    G + P  +K  VNRC  CR++VGLTGFRCRCGE+FCG
Sbjct  76   PAAVASPLLQAAPVYMAVDRPAAGPADPKASKSSVNRCHNCRKRVGLTGFRCRCGEMFCG  135

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             HRYSDRHDCSYDYK+A R+AIARENPVVRAAKI + 
Sbjct  136  AHRYSDRHDCSYDYKSAARDAIARENPVVRAAKIVRF  172



>gb|AGQ04323.1| SAP1, partial [Oryza punctata]
Length=146

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 100/158 (63%), Gaps = 15/158 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A +A+++S S      P+     +K PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASASTSSLSSLPGLSPV----LDKPPRPA-----  52

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  584
                 P ++        ++E     +PA A +   VNRCS CR++V LTGFRCRCG LFC
Sbjct  53   ----TPLVESQAPLPPPVEEMVSAPAPALAAKTSAVNRCSRCRKRVSLTGFRCRCGHLFC  108

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GEHRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI ++
Sbjct  109  GEHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRI  146



>gb|EAZ45178.1| hypothetical protein OsJ_29820 [Oryza sativa Japonica Group]
Length=164

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 102/158 (65%), Gaps = 14/158 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A TA ++S S  +S V       ++ PR       
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAATAFTSSPSSLSSPV-----LDKQPPRPAAPLVE  73

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  584
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  74   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  126

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GEHRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI + 
Sbjct  127  GEHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF  164



>ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=137

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 86/115 (75%), Gaps = 14/115 (12%)
 Frame = +3

Query  360  PHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDE--KTGESSPAPAKREVNRCSGCR  533
            P +F + +  +T  R SP R++P           +DE  +T +++ +  KR VNRCSGCR
Sbjct  35   PSRFFDATTPATSSR-SPKRSLP-----------LDEESQTDQTTSSEPKRAVNRCSGCR  82

Query  534  RKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            R+VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGREAIARENPVV+AAKI K+
Sbjct  83   RRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENPVVKAAKIVKV  137



>gb|AGQ04314.1| SAP1, partial [Oryza nivara]
 gb|AGQ04318.1| SAP1, partial [Oryza barthii]
 gb|AGQ04320.1| SAP1, partial [Oryza glaberrima]
 gb|AGQ04321.1| SAP1, partial [Oryza sativa Indica Group]
 gb|AGQ04322.1| SAP1, partial [Oryza sativa Japonica Group]
Length=147

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 103/158 (65%), Gaps = 14/158 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  56

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  584
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  57   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GEHRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI + 
Sbjct  110  GEHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF  147



>gb|EAZ09556.1| hypothetical protein OsI_31833 [Oryza sativa Indica Group]
Length=164

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 103/158 (65%), Gaps = 14/158 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  73

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  584
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  74   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  126

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GEHRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI + 
Sbjct  127  GEHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF  164



>ref|NP_001063521.1| Os09g0486500 [Oryza sativa Japonica Group]
 sp|A2Z2J6.1|SAP1_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Indica Group]
 sp|A3C039.2|SAP1_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Japonica Group]
 gb|AAF74344.1|AF140722_1 multiple stress-responsive zinc-finger protein [Oryza sativa 
Indica Group]
 gb|AAN15744.1| multiple stress-associated zinc-finger protein [Oryza sativa 
Indica Group]
 dbj|BAF25435.1| Os09g0486500 [Oryza sativa Japonica Group]
 gb|EAZ09557.1| hypothetical protein OsI_31835 [Oryza sativa Indica Group]
 gb|ABQ12733.1| Zn-finger protein [Oryza sativa Indica Group]
 gb|ABR26098.1| multiple stress-responsive zinc-finger protein isap1 [Oryza sativa 
Indica Group]
 dbj|BAG87708.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91792.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97589.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99795.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 103/158 (65%), Gaps = 14/158 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  73

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  584
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  74   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  126

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GEHRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI + 
Sbjct  127  GEHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF  164



>ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Musa acuminata subsp. malaccensis]
Length=155

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 104/161 (65%), Gaps = 27/161 (17%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +T CVNNCG  GNPATN+MCQ CF A+T A++         P PH     SPRS     S
Sbjct  17   LTLCVNNCGFPGNPATNNMCQSCFQASTIAAS---------PAPHSC---SPRSALPIRS  64

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAK-----REVNRCSGCRRKVGLTGFRCRCGE  575
            P          E + ++ D +T E+  A        R+V+RC  CR++VGLTGFRCRCG+
Sbjct  65   P----------ERAAEERDARTSEAPAAAVSAPAPARQVSRCFSCRKRVGLTGFRCRCGD  114

Query  576  LFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LFCGEHRYSDRHDCSYDYKAA R AIAR NPVVRAAKI ++
Sbjct  115  LFCGEHRYSDRHDCSYDYKAAARAAIARANPVVRAAKIVRV  155



>ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=160

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 81/115 (70%), Gaps = 10/115 (9%)
 Frame = +3

Query  360  PHKFAE--KSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCR  533
            P +F E   + RS     SP R+ P        +D   +   +++ + AKR VNRCSGCR
Sbjct  54   PSRFFEDKSTARSATSSRSPKRSHP--------SDDDTQVQPQTTSSEAKRAVNRCSGCR  105

Query  534  RKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            R+VGLTGFRCRCG+LFC EHRYSDRHDCSYDYK  GREAIARENPVVRAAKI KL
Sbjct  106  RRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTVGREAIARENPVVRAAKIVKL  160



>gb|AGQ04316.1| SAP1, partial [Oryza glumipatula]
Length=147

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 103/158 (65%), Gaps = 14/158 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  56

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  584
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  57   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GEHRYSDRH CSYDY++A R+AIAR+NPVVRAAKI + 
Sbjct  110  GEHRYSDRHGCSYDYQSAARDAIARDNPVVRAAKIVRF  147



>gb|ADF80942.1| zinc finger protein [Phyllostachys praecox]
Length=165

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 98/156 (63%), Gaps = 8/156 (5%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N CG  GNPAT ++CQ CF+A +A+++S              +  S  S+    S
Sbjct  18   ITLCANGCGFPGNPATQNLCQNCFSAASASTSSPPSP-------SSSSSSSSSSSLPGLS  70

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P    P    +E ++  +D        A  K  VNRCS CR++VGLTGFRCRCGELFCGE
Sbjct  71   PVVDKPRPAPVELASPAVDRAPAVEVKA-GKTSVNRCSSCRKRVGLTGFRCRCGELFCGE  129

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYKAA R+AIAR+NPVVRAAKI + 
Sbjct  130  HRYSDRHGCSYDYKAATRDAIARDNPVVRAAKIVRF  165



>dbj|BAJ90521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 95/156 (61%), Gaps = 15/156 (10%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A++++  S S +    P+            F +  
Sbjct  21   ITLCANSCGFPGNPATKNLCQNCFLASSSSPPSPSSSPPAFPL------------FDKPR  68

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P        +       +D     + P  +K  VNRC  CR++VGLTGFRCRCGE+FCG 
Sbjct  69   PAAAASPALQAPPVYMAVDR---PADPKASKSSVNRCHNCRKRVGLTGFRCRCGEMFCGA  125

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRHDCSYDYK+A R+AIARENPVVRAAKI + 
Sbjct  126  HRYSDRHDCSYDYKSAARDAIARENPVVRAAKIVRF  161



>ref|XP_007133828.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
 gb|AAA33773.1| PVPR3 [Phaseolus vulgaris]
 gb|ESW05822.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
Length=137

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 10/113 (9%)
 Frame = +3

Query  360  PHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRK  539
            P +F + +  +T  R SP R++P    LED+ +   ++T  S P   KR VNRCSGCRR+
Sbjct  35   PSRFFDAATPATSSR-SPKRSLP----LEDAANA--DRTVASEP---KRAVNRCSGCRRR  84

Query  540  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            VGLTGFRCRCG+LFC EHRY+DRHDCSYDYK  GREAIARENPVV+AAKI K+
Sbjct  85   VGLTGFRCRCGDLFCAEHRYTDRHDCSYDYKTVGREAIARENPVVKAAKIVKV  137



>ref|XP_002460447.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
 gb|EER96968.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
Length=172

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C NNCG  GNPAT ++CQ CF+A TA+ +SS  + ++       ++  P +     +
Sbjct  18   ITLCANNCGFPGNPATQNLCQSCFSAATASRSSSPSSPTSSSSASAVSQPRPAALVDAAA  77

Query  411  PGRTV-PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
                   D   +  S + +      ++ A     VNRCS CR++VGLTGFRCRCGELFCG
Sbjct  78   VELLASADAAAVGQSMEVVAAAP--AATAARSSAVNRCSSCRKRVGLTGFRCRCGELFCG  135

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             HRYSDRH CSYDYK AGR+AIARENPVVRAAKI + 
Sbjct  136  AHRYSDRHGCSYDYKGAGRDAIARENPVVRAAKIVRF  172



>gb|AFK36400.1| unknown [Medicago truncatula]
Length=151

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  480  ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIAR  659
            +++ + AKR VNRCSGCR++VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGRE+IAR
Sbjct  79   QTTSSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIAR  138

Query  660  ENPVVRAAKIFKL  698
            ENPVV+AAKI KL
Sbjct  139  ENPVVKAAKIVKL  151



>ref|XP_003627722.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AET02198.1| AN1-like zinc finger protein [Medicago truncatula]
 gb|AFK41885.1| unknown [Medicago truncatula]
Length=151

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  480  ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIAR  659
            +++ + AKR VNRCSGCR++VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGRE+IAR
Sbjct  79   QTTSSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIAR  138

Query  660  ENPVVRAAKIFKL  698
            ENPVV+AAKI KL
Sbjct  139  ENPVVKAAKIVKL  151



>gb|AGQ04324.1| SAP1, partial [Oryza officinalis]
Length=145

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 100/157 (64%), Gaps = 14/157 (9%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPR-STFRRT  407
            IT C N+CG  GNPAT ++CQ CF A +A+++S S  A   P+     +K PR +T    
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASASTSSPSSLAGLSPV----LDKPPRPATPLVE  57

Query  408  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
            +     P  +++  +      KT           VNRCS CR++VGLTGFRCRCG LFCG
Sbjct  58   AKAPLPPPAEEMASAPAPAPAKTSA---------VNRCSRCRKRVGLTGFRCRCGHLFCG  108

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            EHRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI + 
Sbjct  109  EHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF  145



>ref|XP_002445913.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
 gb|EES15408.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
Length=176

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 100/168 (60%), Gaps = 22/168 (13%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +T C N+CG  GNPATN++CQ CF A TA+S S+SV+  +       +     + F+   
Sbjct  19   LTLCANSCGFPGNPATNNLCQACFQAATASSASASVSPPSP----SSSLSPSPAVFKFDE  74

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAK------------REVNRCSGCRRKVGLTG  554
                 P       +T    ++  E  PAPA               VNRC  CR++VGLTG
Sbjct  75   QQHARPS------ATAVFADRPAEQPPAPASARPIRTTSTSSSSSVNRCQSCRKRVGLTG  128

Query  555  FRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            FRCRCGELFCG HRYSDRHDC +DYKA GR+AIARENPVVRAAKI + 
Sbjct  129  FRCRCGELFCGAHRYSDRHDCCFDYKAVGRDAIARENPVVRAAKIVRF  176



>ref|XP_003540534.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=135

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 10/113 (9%)
 Frame = +3

Query  360  PHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRK  539
            P +F + +  +T  R SP R++P    L+D +     +T +++ +  KR V+RCS CRR+
Sbjct  33   PSRFFDATTPATSSR-SPKRSLP----LDDES-----QTDQTASSEPKRVVSRCSCCRRR  82

Query  540  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGREAIARENPVV+AAKI K+
Sbjct  83   VGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENPVVKAAKIVKV  135



>gb|ACJ84133.1| unknown [Medicago truncatula]
Length=151

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  480  ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIAR  659
            +++ + AKR VNRCSGCR++VGLTGF CRCG+LFC EHRYSDRHDCSYDYKAAGRE+IAR
Sbjct  79   QTTSSEAKRAVNRCSGCRKRVGLTGFHCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIAR  138

Query  660  ENPVVRAAKIFKL  698
            ENPVV+AAKI KL
Sbjct  139  ENPVVKAAKIVKL  151



>gb|AGQ04319.1| SAP1, partial [Oryza meridionalis]
Length=146

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 100/157 (64%), Gaps = 13/157 (8%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A TA+++S S  +S         +K PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSS------PVLDKPPRPAAPLVE  55

Query  411  PGRTVPD-LKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
            P   +P  ++++  +         ++S       VNRCS CR++VGLTGFRCRCG LFCG
Sbjct  56   PQAPLPPPVEEMASALAPAPAPVVKTS------AVNRCSRCRKRVGLTGFRCRCGHLFCG  109

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            EHRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI + 
Sbjct  110  EHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF  146



>ref|XP_004973853.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Setaria italica]
Length=178

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 98/160 (61%), Gaps = 4/160 (3%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP----RSTF  398
            +T C N+CG  GNPAT ++CQ CF A +A++++S    S  P     A   P     S F
Sbjct  19   LTLCANSCGFPGNPATKNLCQNCFLAASASASASVSPPSPSPSTTTAAFDKPWPAAASAF  78

Query  399  RRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGEL  578
               +P   V       D       ++  S+ AP    VNRC  CR++VGLTGFRCRCGEL
Sbjct  79   SAPTPLAVVAPFSPAVDRPAGGPVESSSSNKAPRTSSVNRCHNCRKRVGLTGFRCRCGEL  138

Query  579  FCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            FCG HRYSDRHDC++DYK  GR+AIARENPVVRAAKI + 
Sbjct  139  FCGAHRYSDRHDCNFDYKGVGRDAIARENPVVRAAKIVRF  178



>ref|XP_002513177.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF49168.1| zinc finger protein, putative [Ricinus communis]
Length=140

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  498  AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVR  677
            AKR+VNRCSGCRRKVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK  GREAIARENPVV+
Sbjct  74   AKRDVNRCSGCRRKVGLTGFRCRCGDLFCWEHRYSDRHDCSYDYKTVGREAIARENPVVK  133

Query  678  AAKIFKL  698
            AAKI ++
Sbjct  134  AAKIVRV  140



>gb|AGQ04317.1| SAP1, partial [Oryza longistaminata]
Length=147

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 97/156 (62%), Gaps = 10/156 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  56

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P   +P   +   S           + A     VNRCS CR++VGLTGFRCRCG LFCGE
Sbjct  57   PQAPLPPPVEEVSSALATAPAPAAKTSA-----VNRCSRCRKRVGLTGFRCRCGHLFCGE  111

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI + 
Sbjct  112  HRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF  147



>ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=151

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 61/67 (91%), Gaps = 2/67 (3%)
 Frame = +3

Query  504  REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVR  677
            RE NRCSG  CRRKVGL GFRCRCGE+FC EHRYSDRHDCSYDYKAAGREAIARENPVVR
Sbjct  85   REANRCSGIGCRRKVGLIGFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIARENPVVR  144

Query  678  AAKIFKL  698
            AAKI K+
Sbjct  145  AAKILKV  151



>ref|XP_006365818.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=159

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 69/86 (80%), Gaps = 6/86 (7%)
 Frame = +3

Query  447  DSTDKIDEKTGESSPAPAKREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCS  620
            +STD +  KTG       +RE NRCSG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCS
Sbjct  78   ESTDLVGRKTG----VKRQREANRCSGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCS  133

Query  621  YDYKAAGREAIARENPVVRAAKIFKL  698
            YDYKAAGREAIA+ENPVV+AAKI K+
Sbjct  134  YDYKAAGREAIAKENPVVKAAKILKV  159



>gb|AGQ04315.1| SAP1, partial [Oryza rufipogon]
Length=149

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 97/156 (62%), Gaps = 8/156 (5%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  56

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P   +P   +   S           +   A   VNRCS CR++VGLTGFRCRCG LFCGE
Sbjct  57   PQAPLPPPVEEMASALATATAPAPVAKTSA---VNRCSRCRKRVGLTGFRCRCGHLFCGE  113

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI + 
Sbjct  114  HRYSDRHGCSYDYKSAARDAIARDNPVVRAAKIVRF  149



>ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Musa acuminata subsp. malaccensis]
Length=155

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 96/161 (60%), Gaps = 27/161 (17%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            +  C+NNCG  G+PATN+MCQ CF A+ A                  +   PRS  RR++
Sbjct  17   LALCINNCGFPGDPATNNMCQTCFQASPA----------------AASSSLPRSCSRRSA  60

Query  411  PGRTVPDLKKLEDSTDKIDEK-----TGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGE  575
            P    PD        D+ +E+        S      R+VNRC  CR++VG TGFRCRCGE
Sbjct  61   PSIRSPD------PADRAEEQGAPTAALASPAPAPARKVNRCLSCRKRVGFTGFRCRCGE  114

Query  576  LFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            LFCGEHRYSDRHDC YDYKAA R AIAR NP+VRAAKI ++
Sbjct  115  LFCGEHRYSDRHDCGYDYKAAARAAIARANPIVRAAKIVRV  155



>ref|XP_004252868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum lycopersicum]
Length=160

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 68/86 (79%), Gaps = 6/86 (7%)
 Frame = +3

Query  447  DSTDKIDEKTGESSPAPAKREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCS  620
            +S D +  KTG       +RE NRCSG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCS
Sbjct  79   ESMDLVGRKTG----VKRQREANRCSGMGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCS  134

Query  621  YDYKAAGREAIARENPVVRAAKIFKL  698
            YDYKAAGREAIA+ENPVV+AAKI K+
Sbjct  135  YDYKAAGREAIAKENPVVKAAKILKV  160



>gb|ACM68460.1| stress-associated protein 10 [Solanum pennellii]
Length=160

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 68/86 (79%), Gaps = 6/86 (7%)
 Frame = +3

Query  447  DSTDKIDEKTGESSPAPAKREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCS  620
            +S D +  KTG       +RE NRCSG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCS
Sbjct  79   ESMDLVGRKTG----VKRQREANRCSGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCS  134

Query  621  YDYKAAGREAIARENPVVRAAKIFKL  698
            YDYKAAGREAIA+ENPVV+AAKI K+
Sbjct  135  YDYKAAGREAIAKENPVVKAAKILKV  160



>ref|XP_009415054.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 gb|AAR96005.1| hypothetical protein [Musa acuminata]
Length=157

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +3

Query  423  VPDLKKLEDSTDKIDEKT---GESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
             P +     ST K+DE+    GE SPAP  R  NRCS CR+KVGLTGFRCRCG+LFCG H
Sbjct  64   APTITFAASSTPKLDEEPSNPGEESPAPV-RFSNRCSACRKKVGLTGFRCRCGDLFCGRH  122

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RYSD H+CS+DYKAAGRE IA+ NPV++AAKI K+
Sbjct  123  RYSDAHECSFDYKAAGREEIAKANPVIKAAKIIKI  157



>ref|XP_006850149.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Amborella trichopoda]
 gb|ERN11730.1| hypothetical protein AMTR_s00022p00236720 [Amborella trichopoda]
Length=145

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  450  STDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDY  629
            S++KI  K  E SP    R  NRC  CR++VGLTGFRCRCG+LFCGEHRYSDRH CS+DY
Sbjct  63   SSEKISRKRPEESPENPTRYPNRCQSCRKRVGLTGFRCRCGDLFCGEHRYSDRHVCSFDY  122

Query  630  KAAGREAIARENPVVRAAKIFKL  698
            KA G+EAIARENPVV+AAKI K+
Sbjct  123  KAVGKEAIARENPVVKAAKIIKI  145



>ref|XP_010257702.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=170

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 92/153 (60%), Gaps = 6/153 (4%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+ ATN++C KC+            A++  P+  K       ST  +  P  
Sbjct  24   CANNCGFFGSAATNNLCSKCYRDMFMKQQQQFKASTVTPVAEKV---QATSTLVQLEPVV  80

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
               +   +E+   K+  + G S+    K+  NRC  C+++VGLTGF+CRCG +FCG HRY
Sbjct  81   GRVNNNNIEE---KLTLQEGSSTYETNKQPPNRCLACQKRVGLTGFKCRCGGIFCGVHRY  137

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            S++H CSYDY++AGR+AIA+ NPVV+A KI K+
Sbjct  138  SEKHGCSYDYRSAGRDAIAKANPVVKAEKIEKI  170



>ref|XP_009416648.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416649.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=153

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 74/106 (70%), Gaps = 6/106 (6%)
 Frame = +3

Query  390  STFRRTSPGRTVPDLKKLEDSTDKIDE---KTGESSPAPAKREVNRCSGCRRKVGLTGFR  560
            ST  R  P    P +     ST K+DE   K GE SP P  R  NRCS CR+KVGLTGFR
Sbjct  51   STIHR--PESPAPAMTVAASSTTKLDEESSKPGEESPTPV-RFSNRCSTCRKKVGLTGFR  107

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG+LFCG HRYSD H+CS+DYKA GRE IAR NPV++AAKI K+
Sbjct  108  CRCGDLFCGRHRYSDAHECSFDYKALGREEIARANPVIKAAKIIKI  153



>ref|XP_009618607.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=205

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 66/86 (77%), Gaps = 6/86 (7%)
 Frame = +3

Query  447  DSTDKIDEKTGESSPAPAKREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCS  620
            +STD +  K     P    RE NRC G  CRRKVGL  FRCRCGE+FC EHRYSDRHDCS
Sbjct  124  ESTDLVGRKAATKRP----REANRCCGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCS  179

Query  621  YDYKAAGREAIARENPVVRAAKIFKL  698
            YDYKAAGREAIARENPVV+AAKI K+
Sbjct  180  YDYKAAGREAIARENPVVKAAKILKV  205



>gb|EMT06701.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Aegilops tauschii]
Length=165

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 9/156 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A  A+++ SS ++S+  +P      +P     R  
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSSSSSSSSLP---GVSAPTPVIDRPR  75

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P     +L +         E        PA+  VNRCS CR++VGLTGFRCRCG++FCGE
Sbjct  76   PAPLEAELARPAVDLAPATEAK------PARTSVNRCSSCRKRVGLTGFRCRCGDMFCGE  129

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYKAA R+AIAR+NPVVRAAKI + 
Sbjct  130  HRYSDRHGCSYDYKAAARDAIARDNPVVRAAKIVRF  165



>ref|XP_010925078.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 94/155 (61%), Gaps = 12/155 (8%)
 Frame = +3

Query  234  TPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  413
            T C NNCG  G+PATN++C KC+     + + +S+    VP P +      +   ++++ 
Sbjct  22   TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASIETLLVPPPVE-----AKKVEKKSAG  76

Query  414  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
            G         E       E+   S  AP K+  NRCS C +KVGL GF+CRCGE+FC  H
Sbjct  77   GDG-------EAKDGSFTEEGAPSGGAPVKKPPNRCSFCNKKVGLMGFKCRCGEVFCSVH  129

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RYSD+HDC++DY+ AG++AIA+ NPVV+A K+ K+
Sbjct  130  RYSDKHDCAFDYRGAGQDAIAKANPVVKADKVEKI  164



>gb|ACM68447.1| stress-associated protein 10 [Solanum lycopersicum]
Length=160

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 6/86 (7%)
 Frame = +3

Query  447  DSTDKIDEKTGESSPAPAKREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCS  620
            +S D +  KTG       +RE NR SG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCS
Sbjct  79   ESMDLVGRKTG----VKRQREANRSSGMGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCS  134

Query  621  YDYKAAGREAIARENPVVRAAKIFKL  698
            YDYKAAGREAIA+ENPVV+AAKI K+
Sbjct  135  YDYKAAGREAIAKENPVVKAAKILKV  160



>ref|XP_003557532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_003557533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_010228317.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
Length=160

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 86/153 (56%), Gaps = 14/153 (9%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  GN  TN+MC KC+      +T +       P+  K A  +  S+     P +
Sbjct  22   CVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAV------PVVEKKAFAAASSSMVPLEPAK  75

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
                    ED          +++  P K   NRC  CR+KVGLTGF+CRCG  FC  HRY
Sbjct  76   --------EDEVPAAAVVDSQAAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSMHRY  127

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            +D H+CS+DYKAAGRE IA++NPVV A K+ K+
Sbjct  128  ADSHECSFDYKAAGREQIAKQNPVVIAEKVNKI  160



>ref|XP_010928202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 94/158 (59%), Gaps = 18/158 (11%)
 Frame = +3

Query  234  TPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  413
            T C NNCG  G+PATN++C KC+     + + +S+    VP P               + 
Sbjct  22   TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASIETLVVPPP---------------AE  66

Query  414  GRTVPDLKKLEDSTDKIDEKTGESSPA---PAKREVNRCSGCRRKVGLTGFRCRCGELFC  584
             + V +     D   K++    E +P+   PAK+  NRCS C +KVGL GF+CRCGE+FC
Sbjct  67   AKKVEEKAAGGDGEAKVESFAEEGAPSGESPAKKPTNRCSFCNKKVGLMGFKCRCGEVFC  126

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
              HRYSD+H+C++DYK AG++AIA+ NP+V+  K+ K+
Sbjct  127  SLHRYSDKHNCAFDYKGAGQDAIAKANPLVKPDKVEKI  164



>ref|XP_009589288.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=151

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 59/67 (88%), Gaps = 2/67 (3%)
 Frame = +3

Query  504  REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVR  677
            RE NRCSG  CRRKVGL GFRCRCG++FC EHRYSDRH CSYDYKA GREAIARENPVVR
Sbjct  85   REANRCSGIGCRRKVGLIGFRCRCGDVFCSEHRYSDRHGCSYDYKAVGREAIARENPVVR  144

Query  678  AAKIFKL  698
            AAKI K+
Sbjct  145  AAKILKV  151



>ref|XP_011090386.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=143

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +3

Query  456  DKIDEKTGESSPAPAKREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDY  629
            D ++++ G   P    REV RCSG  CR+++GL GFRCRCG++FC EHRYSDRHDCSYDY
Sbjct  65   DLVEKRGGLKRP----REVTRCSGSGCRKRIGLMGFRCRCGDVFCSEHRYSDRHDCSYDY  120

Query  630  KAAGREAIARENPVVRAAKIFKL  698
            KAAGREAIARENPVVRAAK+ K+
Sbjct  121  KAAGREAIARENPVVRAAKLLKV  143



>ref|NP_001140650.1| uncharacterized protein LOC100272725 [Zea mays]
 gb|ACF84270.1| unknown [Zea mays]
 tpg|DAA47934.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=176

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 100/163 (61%), Gaps = 12/163 (7%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCF-------NattaastsssvaastvPIPHKFAEKSPR  389
            +T C N+CG  GNPATN++CQ CF       +A+ + S     ++S+ P   +F E+  +
Sbjct  19   LTLCANSCGFPGNPATNNLCQACFLAATASSSASASVSPPPPSSSSSSPAVLQFDEQQQQ  78

Query  390  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  569
               R  +P  + P      +   +    +  +    +   V RC  CR++VGLTGFRCRC
Sbjct  79   QNPRPRAPAASGP-----TEEPPRPARASAPAPAPASSSSVRRCQTCRKRVGLTGFRCRC  133

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G+LFCG HRYSDRHDC +DY+AAGR+AIAR+NPVVRAAKI + 
Sbjct  134  GDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNPVVRAAKIVRF  176



>ref|XP_009765432.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nicotiana sylvestris]
Length=226

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 66/86 (77%), Gaps = 6/86 (7%)
 Frame = +3

Query  447  DSTDKIDEKTGESSPAPAKREVNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCS  620
            +STD +  K     P    RE NRC   GCRRKVGL  FRCRCGE+FC EHRYSDRHDCS
Sbjct  145  ESTDLVGRKAAMKRP----REANRCCGIGCRRKVGLLPFRCRCGEVFCSEHRYSDRHDCS  200

Query  621  YDYKAAGREAIARENPVVRAAKIFKL  698
            YDYKAAGR+AIARENPVV+AAKI K+
Sbjct  201  YDYKAAGRDAIARENPVVKAAKILKV  226



>ref|XP_008794968.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 93/155 (60%), Gaps = 12/155 (8%)
 Frame = +3

Query  234  TPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  413
            T C NNCG  G+PATN++C KC+     + + +S+  S VP P   A+K+          
Sbjct  22   TLCANNCGFFGSPATNNLCSKCYKDCFLSKSKASIETSVVP-PSAEAKKAEEK-------  73

Query  414  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
                P     E       E+   S  +PAK   NRCS C ++VGL GF+CRCGELFC  H
Sbjct  74   ----PLGGNGEAKVGSFAEEGASSGESPAKETPNRCSFCNKRVGLMGFKCRCGELFCSLH  129

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RYSD+H+C++DY+ AG++AIA+ NPVV+A K+ K+
Sbjct  130  RYSDKHNCAFDYRGAGQDAIAKANPVVKADKVEKI  164



>ref|XP_010228315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
 ref|XP_010228316.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
Length=205

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 86/153 (56%), Gaps = 14/153 (9%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  GN  TN+MC KC+      +T +       P+  K A  +  S+     P +
Sbjct  67   CVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAV------PVVEKKAFAAASSSMVPLEPAK  120

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
                    ED          +++  P K   NRC  CR+KVGLTGF+CRCG  FC  HRY
Sbjct  121  --------EDEVPAAAVVDSQAAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSMHRY  172

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            +D H+CS+DYKAAGRE IA++NPVV A K+ K+
Sbjct  173  ADSHECSFDYKAAGREQIAKQNPVVIAEKVNKI  205



>ref|XP_011080262.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=147

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 2/67 (3%)
 Frame = +3

Query  504  REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVR  677
            REV RCSG  CR+++GL GFRCRCG++FC EHRYSDRHDCSYDYKAAGREAIARENPVVR
Sbjct  81   REVTRCSGSGCRKRIGLMGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGREAIARENPVVR  140

Query  678  AAKIFKL  698
            AAK+ K+
Sbjct  141  AAKLLKV  147



>gb|ABS72032.1| putative AN1-like zinc finger protein, partial [Olea europaea]
Length=76

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 2/67 (3%)
 Frame = +3

Query  504  REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVR  677
            REV RCSG  CR+K+GL GFRCRCGE+FC EHRYSDRHDC+YDYKAAGREAIARENPVV+
Sbjct  10   REVTRCSGSGCRKKIGLIGFRCRCGEMFCSEHRYSDRHDCNYDYKAAGREAIARENPVVK  69

Query  678  AAKIFKL  698
            AAKI K+
Sbjct  70   AAKILKV  76



>ref|XP_009799138.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=142

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 72/104 (69%), Gaps = 12/104 (12%)
 Frame = +3

Query  423  VPDLKKLEDSTDKIDEKTGESSPAPA----------KREVNRCSG--CRRKVGLTGFRCR  566
            +P+ K     +D + +   E +PA            + E NRCSG  CRRKVGL GFRCR
Sbjct  39   LPNFKGSRPRSDLVSQPQPEKNPAGEDNNRQSMKRPREEANRCSGIGCRRKVGLIGFRCR  98

Query  567  CGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CGE+FC EHRYSDRH CSYDYKAAGREAIARENPVVRAAK+ K+
Sbjct  99   CGEVFCYEHRYSDRHSCSYDYKAAGREAIARENPVVRAAKLVKV  142



>gb|EYU18023.1| hypothetical protein MIMGU_mgv1a015860mg [Erythranthe guttata]
Length=143

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 2/67 (3%)
 Frame = +3

Query  504  REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVR  677
            REV RCSG  CR+++GLTGF+CRCG+ FC EHRYSDRHDCSYDYKAAGREAIARENPVVR
Sbjct  77   REVTRCSGSGCRKRIGLTGFQCRCGDTFCSEHRYSDRHDCSYDYKAAGREAIARENPVVR  136

Query  678  AAKIFKL  698
            AAK+ K+
Sbjct  137  AAKLVKV  143



>emb|CBI16411.3| unnamed protein product [Vitis vinifera]
Length=142

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  492  APAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPV  671
            A  +REVNRCSGC+RK+GL GFRCRCGE+FC +HRYSDRH+C +DYKAAGRE IA+ENPV
Sbjct  74   AVRRREVNRCSGCKRKLGLIGFRCRCGEMFCSKHRYSDRHECRFDYKAAGREMIAKENPV  133

Query  672  VRAAKIFKL  698
            VR AKI K+
Sbjct  134  VRPAKILKV  142



>ref|XP_002285543.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=126

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  492  APAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPV  671
            A  +REVNRCSGC+RK+GL GFRCRCGE+FC +HRYSDRH+C +DYKAAGRE IA+ENPV
Sbjct  58   AVRRREVNRCSGCKRKLGLIGFRCRCGEMFCSKHRYSDRHECRFDYKAAGREMIAKENPV  117

Query  672  VRAAKIFKL  698
            VR AKI K+
Sbjct  118  VRPAKILKV  126



>ref|XP_008808665.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808673.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808683.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 94/158 (59%), Gaps = 18/158 (11%)
 Frame = +3

Query  234  TPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  413
            T C NNCG  G+PATN++C KC+     + + +SV    VP P +               
Sbjct  22   TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASVETLLVPPPVE---------------  66

Query  414  GRTVPDLKKLEDSTDKIDEKTGESSPA---PAKREVNRCSGCRRKVGLTGFRCRCGELFC  584
             + V +     D   K    T E++P+   P K+  NRCS C ++VGL GF+CRCGE+FC
Sbjct  67   AKKVEEKPAGGDGEAKGGSFTDEAAPSEGSPVKKPPNRCSFCNKRVGLMGFKCRCGEVFC  126

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
              HRYSD+HDC++DY+ AG++AIA+ NPVV+A K+ K+
Sbjct  127  SLHRYSDKHDCAFDYRGAGQDAIAKANPVVKADKVEKI  164



>ref|XP_009596933.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=142

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = +3

Query  501  KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVV  674
            + E NRCSG  CRRKVGL GFRCRCGE+FC EHRYSDRH CSYDYKAAGREAIARENPVV
Sbjct  75   REEANRCSGIGCRRKVGLIGFRCRCGEVFCYEHRYSDRHSCSYDYKAAGREAIARENPVV  134

Query  675  RAAKIFKL  698
            RAAK+ K+
Sbjct  135  RAAKLVKV  142



>gb|ABK21092.1| unknown [Picea sitchensis]
 gb|ABR17716.1| unknown [Picea sitchensis]
Length=181

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 90/162 (56%), Gaps = 9/162 (6%)
 Frame = +3

Query  234  TPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  413
            T C NNCG  G+ AT ++C KC+         ++ A +   +   FA  SP      +SP
Sbjct  22   TLCANNCGFFGSSATRNLCSKCYRDLIMKEAQATSAMAA--VEKSFAAGSPMDEVPLSSP  79

Query  414  GRTVPDLK-------KLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCG  572
               V   +           S    D  +  SSP P     NRC  CR++VGLTGF+CRC 
Sbjct  80   DAIVQQNRVQISAAVAGVSSVQLADSGSSSSSPQPPAETPNRCFSCRKRVGLTGFKCRCE  139

Query  573  ELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
              FCG HRY+++H CS+D+KAAGREAIA+ NPVV+AAKI KL
Sbjct  140  NTFCGLHRYAEKHSCSFDFKAAGREAIAKANPVVKAAKIDKL  181



>dbj|BAK03526.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 97/156 (62%), Gaps = 11/156 (7%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A  A+++ S             +   P ++     
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAGPASTSPS-----------SSSSSLPGASVSTPV  67

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
              R  P     E +   +D +   +   PA+  VNRCS CR++VGLTGFRCRCG++FCGE
Sbjct  68   LDRPRPAPVDAELAHPAVDYRATATEAKPARTSVNRCSSCRKRVGLTGFRCRCGDVFCGE  127

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYKAA R+AIAR+NPVVRAAKI + 
Sbjct  128  HRYSDRHGCSYDYKAAARDAIARDNPVVRAAKIVRF  163



>ref|XP_006660763.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Oryza brachyantha]
Length=166

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 100/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A +A+++S +      P+  K A   P ++     
Sbjct  18   ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPASLPGLSPVLDKAAR--PATSLVEAQ  75

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKRE-VNRCSGCRRKVGLTGFRCRCGELFCG  587
                   +++L      ++ K      APAK   VNRCS CR++VGLTGFRCRCG LFCG
Sbjct  76   AAPAAAPVEELASPAPALEVK------APAKTSAVNRCSRCRKRVGLTGFRCRCGYLFCG  129

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            EHRYSDRH C YDYKAA R+AIAR+NPVVRAAKI + 
Sbjct  130  EHRYSDRHGCGYDYKAAARDAIARDNPVVRAAKIVRF  166



>ref|XP_009402699.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 ref|XP_009402700.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=145

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  423  VPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYS  602
            VP++ +   +   +  +   S  AP  R +NRCS CR+KVGLTGFRCRCG+LFC  HRYS
Sbjct  54   VPEMPENSGNAAALSFEMKISKQAPPLRYINRCSTCRKKVGLTGFRCRCGDLFCASHRYS  113

Query  603  DRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            D HDCS+DYKAAGRE IA+ NP++RAAKI K+
Sbjct  114  DTHDCSFDYKAAGREQIAKANPLIRAAKIIKI  145



>ref|XP_011094369.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X1 [Sesamum indicum]
 ref|XP_011094370.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X2 [Sesamum indicum]
Length=160

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 88/153 (58%), Gaps = 8/153 (5%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+PAT +MC KC+   +   ++     ST P P   A+ S  S  +  S   
Sbjct  16   CVNNCGFFGSPATQNMCSKCYRDLSIKKSADFSTPSTAPPPSTAAQLSLSSPDKAESSVA  75

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
            TV        +         + +    +   NRCS CR+KVGLTGFRCRCG  FCG HRY
Sbjct  76   TV--------AAQSPPMPVQQQAQPQPQPPTNRCSTCRKKVGLTGFRCRCGITFCGSHRY  127

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             ++H C++D+KA GREAIA+ NPVV+A K+ K+
Sbjct  128  PEKHGCTFDFKAMGREAIAKANPVVKADKLDKI  160



>ref|XP_009406414.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=161

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  390  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAK----REVNRCSGCRRKVGLTGF  557
            +T RR  P    P +     S+ K+DE++  S P        R   RCS CR+KVGLTGF
Sbjct  55   TTERRERPEIPAPAMTFTASSSSKLDEESESSKPDEESHTPVRFSKRCSTCRKKVGLTGF  114

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RCRCG+LFCG HRYSD H+CS+DYKAAGRE IA+ NP++RAAKI K+
Sbjct  115  RCRCGDLFCGRHRYSDAHECSFDYKAAGREEIAKANPLIRAAKIIKI  161



>emb|CDP20562.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 2/65 (3%)
 Frame = +3

Query  510  VNRCS--GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAA  683
            VNRCS  GCRRK+GL GFRCRCG++FC EHRYSDRHDCSYDYK AGREAIARENPVV+A 
Sbjct  95   VNRCSCTGCRRKLGLMGFRCRCGDMFCSEHRYSDRHDCSYDYKTAGREAIARENPVVKAP  154

Query  684  KIFKL  698
            KI K+
Sbjct  155  KILKV  159



>ref|XP_006660259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Oryza brachyantha]
Length=118

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKI  689
            VNRC  CR++VGLTGFRCRCGELFCG HRYSDRHDCS+DYK+A R+AIARENPVVRAAKI
Sbjct  56   VNRCHSCRKRVGLTGFRCRCGELFCGAHRYSDRHDCSFDYKSAARDAIARENPVVRAAKI  115

Query  690  FKL  698
             + 
Sbjct  116  VRF  118



>ref|XP_007206025.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
 gb|EMJ07224.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
Length=168

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 94/157 (60%), Gaps = 17/157 (11%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPG-  416
            CVNNCG  G+  TN++C KC+       +             K A        ++ S G 
Sbjct  24   CVNNCGFFGSEKTNNLCSKCYKDFLLKQS-------------KTAADDTAVVGKKVSAGD  70

Query  417  RTVPDLKKLEDSTDKIDE---KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
            + + + + ++   +++ +   + G +S  P KR  NRC+ CR++VGLTGF+CRCG+ FC 
Sbjct  71   QDLENKRHVQQVLEEVKQSQVEEGTTSENPEKRPANRCNFCRKRVGLTGFKCRCGQTFCS  130

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             HRYS++H+C +DYK+AG+EAIA+ NPVV+A K+ K+
Sbjct  131  LHRYSNKHNCVFDYKSAGQEAIAKANPVVKAEKVDKI  167



>gb|ABK90631.1| zinc finger protein [Aeluropus littoralis]
Length=159

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 83/153 (54%), Gaps = 12/153 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+  TN+MC KC+          +       I    +   P  T ++     
Sbjct  19   CINNCGFFGSSMTNNMCSKCYRDFVKLMEMDAPVVDKKLITTASSSTVPFETAKQDD---  75

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
            TVPD   ++D          + +  P K   NRCS CR+KVGLTGF+CRCG  FC  HRY
Sbjct  76   TVPDAAAMDDK---------QPAQEPPKPPSNRCSTCRKKVGLTGFQCRCGGTFCSLHRY  126

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            +D H+C++DYK   RE IA++NPVV A KI K+
Sbjct  127  TDSHECTFDYKKVAREQIAKQNPVVIAEKINKI  159



>ref|XP_006427949.1| hypothetical protein CICLE_v10026622mg [Citrus clementina]
 ref|XP_006464510.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Citrus sinensis]
 gb|ESR41189.1| hypothetical protein CICLE_v10026622mg [Citrus clementina]
Length=171

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 91/157 (58%), Gaps = 13/157 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFR----RT  407
            C NNCG  G+ +TN++C KC+           +  S  P P    E+  ++         
Sbjct  24   CANNCGFFGSASTNNLCSKCY-------KDYLLKQSKNPNPSPIEEEKNKNKMNIEQIEA  76

Query  408  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
            +P   V + +        +DE  G SS  P KR  NRCS CR+++GLTGF+CRC + FC 
Sbjct  77   NPVGGVVENRDPAAQVVVVDE--GASSENPEKRPANRCSFCRKRIGLTGFKCRCEQTFCS  134

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             HRYSD+H+C +DYK+AG++AIA+ NPVV+A KI K+
Sbjct  135  LHRYSDKHNCVFDYKSAGQDAIAKANPVVKADKIEKI  171



>ref|XP_004288126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
 ref|XP_004288127.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
Length=167

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 96/153 (63%), Gaps = 9/153 (6%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+  TN +C KC+       +  +V  + + + +K  E    +   ++   +
Sbjct  24   CVNNCGYYGSAKTNDLCSKCYKEFLLTQSKGAVEGTVI-VENKVGEGGA-NVVNKSHVEQ  81

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V ++++      +++E  G +S  P KR  NRCS CR++VGLTGF+CRCG+ FC  HRY
Sbjct  82   VVEEVRQ-----SQVEE--GTTSENPEKRPANRCSFCRKRVGLTGFKCRCGDTFCSLHRY  134

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            S+ H+C +DYK+AG++AIA+ NPV++A KI K+
Sbjct  135  SNSHNCMFDYKSAGQDAIAKANPVIKADKIDKI  167



>gb|EPS66139.1| hypothetical protein M569_08638, partial [Genlisea aurea]
Length=76

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 61/67 (91%), Gaps = 2/67 (3%)
 Frame = +3

Query  504  REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVR  677
            REV RCSG  CR++VGL GFRCRCG+LFC EHRYSDRHDCSYDYKAAGRE+IARENPV++
Sbjct  10   REVARCSGSGCRKRVGLVGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENPVIK  69

Query  678  AAKIFKL  698
            A+K+ K+
Sbjct  70   ASKLLKV  76



>ref|XP_002279037.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 [Vitis vinifera]
 emb|CAN73104.1| hypothetical protein VITISV_042893 [Vitis vinifera]
Length=141

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 88/153 (58%), Gaps = 27/153 (18%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+ ATN++C KC+                     +F  K  +      +   
Sbjct  16   CANNCGFFGSAATNNLCSKCY--------------------KEFVIKQSKEASVVENENN  55

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
            TV      E+S   I+E  G ++ +P K   NRCS CR++VGLTGF+CRCG+ FC  HRY
Sbjct  56   TVG-----ENSGSGIEE--GAAAGSPEKCPANRCSFCRKRVGLTGFKCRCGQTFCSMHRY  108

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SD+H+C +DYK+A ++AIA+ NPVV+A KI K+
Sbjct  109  SDKHNCVFDYKSAAQDAIAKANPVVKADKIEKI  141



>gb|ADF80943.1| zinc finger protein [Phyllostachys vivax]
Length=163

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 100/156 (64%), Gaps = 10/156 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A +A+++S    +S+          SP     R +
Sbjct  18   ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSSSSSSLPGLSPVVDKPRPA  77

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P   V       D    ++ K G++S       VNRCS CR+++GLTGFRCRCGELFCGE
Sbjct  78   P---VELASPAVDRVPAVEVKAGKTS-------VNRCSSCRKRLGLTGFRCRCGELFCGE  127

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYKAA R+AIAR+NPVVRAAKI + 
Sbjct  128  HRYSDRHGCSYDYKAAARDAIARDNPVVRAAKIVRF  163



>dbj|BAJ88745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 100/156 (64%), Gaps = 11/156 (7%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A  A+++ SS ++S        +  +P     R +
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSSSSSLP----GASVSTPVLDRPRPA  74

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
            P          E +   +D +   +   PA+  VNRCS CR++VGLTGFRCRCG++FCG 
Sbjct  75   P-------VDAELAHPAVDYRATATEAKPARTSVNRCSSCRKRVGLTGFRCRCGDVFCGG  127

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYKAA R+AIAR+NPVVRAAKI + 
Sbjct  128  HRYSDRHGCSYDYKAAARDAIARDNPVVRAAKIVRF  163



>ref|XP_010545575.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
Length=170

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKC-----FNattaastsssvaastvPIPHKFAEKSPRSTFRR  404
            C+NNCG  G+PAT +MC KC     F     A  +S V+ S+  I +   E S  S   +
Sbjct  18   CINNCGFFGSPATMNMCSKCHKAMLFQQEQGAKLASVVSGSSSSI-NASKETSVASADVQ  76

Query  405  TSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  584
              P    P+   L+ S+   D  TG +  A  K   +RCS C ++VGLTGF+CRCG LFC
Sbjct  77   AKP--VEPNAGFLQSSSSATD--TGVAVEAKPKEGPSRCSTCNKRVGLTGFKCRCGILFC  132

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G HRY+D+HDCS++Y AA +EAIA++NPVV+A K+ K+
Sbjct  133  GSHRYADKHDCSFNYHAAAQEAIAKDNPVVKAEKLDKI  170



>gb|EYU46288.1| hypothetical protein MIMGU_mgv1a015852mg [Erythranthe guttata]
Length=143

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = +3

Query  504  REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVR  677
            RE  RCSG  CR+++GL GFRCRCG++FC EHRYSDRHDCSYDYKAAGR+AIA+ENPV+R
Sbjct  77   REATRCSGSGCRKRIGLVGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGRDAIAKENPVIR  136

Query  678  AAKIFKL  698
            AAK+ K+
Sbjct  137  AAKLLKV  143



>ref|XP_004798521.1| PREDICTED: AN1-type zinc finger protein 6 [Mustela putorius furo]
Length=170

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 89/159 (56%), Gaps = 8/159 (5%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK--FAEKSPRSTFRRTSP  413
            C   CG  GNP TN MC  C+        +SS      P+ ++   +E    S    TS 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCY-KEHLQRQNSSXXXXXSPVSNQSLLSESVASSQVDSTSV  72

Query  414  GRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  581
             + VPD + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLTGF CRCG ++
Sbjct  73   DKAVPDTEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGLTGFECRCGNVY  131

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CG HRYSD H+CSY+YKA   E I +ENPVV   KI K+
Sbjct  132  CGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI  170



>ref|XP_010261028.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=164

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 89/153 (58%), Gaps = 12/153 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+PATN++C KC+       + +  A +        AEK    +   T    
Sbjct  24   CANNCGFFGSPATNNLCSKCYRDFFLKQSKAVAALTV------VAEKKVGESIVETKGQS  77

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V      E     ++E  G +S  P K   NRCS C+++VGLTGF+CRCG+ FC  HRY
Sbjct  78   GVGP----EAKATLVEE--GTTSGDPGKLPANRCSFCKKRVGLTGFKCRCGQTFCSLHRY  131

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SD+H+C +DYK AG++AIA+ NPVV+A KI K+
Sbjct  132  SDKHNCLFDYKTAGQDAIAKANPVVKANKIEKI  164



>ref|XP_009589284.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
 ref|XP_009589285.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
Length=172

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 92/155 (59%), Gaps = 2/155 (1%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvP--IPHKFAEKSPRSTFRRTSP  413
            C+NNCG  G+ A  +MC KC+  T      + +AA+++   +    A +           
Sbjct  18   CINNCGFFGSAANMNMCSKCYKDTILKQEQAKLAATSIENLVNGSIASEKGPVVVGSVDV  77

Query  414  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
               + + K +   +       GE++   AK   +RCS C++KVGLTGF+CRCG L+CG H
Sbjct  78   QPAMLETKSVVVLSSPPSSSAGEAAELKAKVGPSRCSSCKKKVGLTGFKCRCGNLYCGSH  137

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RYSD+HDC +DY++AGR+AIA+ NPVV+A K+ K+
Sbjct  138  RYSDKHDCQFDYRSAGRDAIAKANPVVKAEKLGKI  172



>gb|KDO50474.1| hypothetical protein CISIN_1g030772mg [Citrus sinensis]
Length=171

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 88/153 (58%), Gaps = 5/153 (3%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+  TN++C KC+          S   +  PI  +  +          +P  
Sbjct  24   CANNCGFFGSANTNNLCSKCY---KDYLLKQSKNPNPSPIEEEKNKNKTNIEQNEANPVG  80

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V + +        +DE  G SS  P KR  NRCS CR+++GLTGF+CRC + FC  HRY
Sbjct  81   GVVENRDPAAQVVVVDE--GASSENPEKRPANRCSFCRKRIGLTGFKCRCEQTFCSLHRY  138

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SD+H+C +DYK+AG++AIA+ NPVV+A KI K+
Sbjct  139  SDKHNCVFDYKSAGQDAIAKANPVVKADKIEKI  171



>gb|ACL01101.1| zinc finger protein [Phyllostachys edulis]
Length=164

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 96/156 (62%), Gaps = 9/156 (6%)
 Frame = +3

Query  231  ITPCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  410
            IT C N+CG  GNPAT ++CQ CF A +A+++S    +S+                +   
Sbjct  18   ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSSSSSSSLPGLSPVVDK---  74

Query  411  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
                 P    +E ++  +D        A  K  VNRCS CR++VGLTGFRCRCGELFCGE
Sbjct  75   -----PRPAPMELASPAVDRAPAVEVKA-GKTSVNRCSSCRKRVGLTGFRCRCGELFCGE  128

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSDRH CSYDYKAA R+AIAR+NPVVRAAKI + 
Sbjct  129  HRYSDRHGCSYDYKAAARDAIARDNPVVRAAKIVRF  164



>gb|EYU31356.1| hypothetical protein MIMGU_mgv1a014938mg [Erythranthe guttata]
Length=173

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 90/168 (54%), Gaps = 26/168 (15%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP-G  416
            CVNNCG  G PAT +MC KC+         +           +FA  S +S    +S  G
Sbjct  17   CVNNCGFFGTPATLNMCSKCYKDVVLKQERA-----------EFAASSFQSIINGSSKNG  65

Query  417  RTVPDLKKL------EDSTDKIDEKTGESSPAPA--------KREVNRCSGCRRKVGLTG  554
              V D            S+D ++     SS +PA        K+   RC  C ++VGLTG
Sbjct  66   AKVSDAATAVIAEANAISSDSMEASRRTSSESPAIGGSDEANKQGPKRCGACNKRVGLTG  125

Query  555  FRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            F CRCG +FCG HRYSD+HDC +DY AAG++AIA+ NPVV+A K+ K+
Sbjct  126  FNCRCGSMFCGVHRYSDKHDCPFDYHAAGQQAIAKANPVVKAEKLDKI  173



>gb|ABI23728.1| stress-tolerance zinc finger protein [Chrysanthemum x morifolium]
Length=170

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKI  689
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A R+AIAR+NPVVRAAKI
Sbjct  108  VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNPVVRAAKI  167

Query  690  FKL  698
             + 
Sbjct  168  VRF  170



>ref|XP_011622536.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 [Amborella trichopoda]
 gb|ERN03878.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
Length=168

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 86/157 (55%), Gaps = 16/157 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C N CG  G+ +TN++C KC+              +   IP                P  
Sbjct  24   CANKCGFFGSASTNNLCSKCYKDFYLKQLKEDENITDKVIP-----------CLNNEPNA  72

Query  420  TVPDLKKLEDSTDKIDEK----TGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
             V D   L++S D    K     G SS  P K+  NRC  CR++VGL GFRCRCG LFC 
Sbjct  73   KV-DAANLQNSEDGKKNKGVVVDGTSSEEPQKQAPNRCRLCRKRVGLAGFRCRCGGLFCS  131

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             HRYSD+H+CS+DY+A+G++AIA+ NPVV+A K+ K+
Sbjct  132  THRYSDKHNCSFDYRASGQDAIAKANPVVKAEKVEKI  168



>ref|NP_001062181.1| Os08g0504700 [Oryza sativa Japonica Group]
 sp|Q84PD8.1|SAP11_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 11; Short=OsSAP11 [Oryza sativa Japonica 
Group]
 gb|AAO72541.1| pathogenesis-related protein-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD08826.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD10163.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 gb|AAT11791.1| putative zinc finger transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF24095.1| Os08g0504700 [Oryza sativa Japonica Group]
 gb|EAZ07540.1| hypothetical protein OsI_29795 [Oryza sativa Indica Group]
 gb|EAZ43265.1| hypothetical protein OsJ_27862 [Oryza sativa Japonica Group]
Length=170

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKI  689
            VNRC  CRR+VGLTGFRCRCGEL+CG HRYSDRHDCS+DYK+A R+AIARENPVVRAAKI
Sbjct  108  VNRCHSCRRRVGLTGFRCRCGELYCGAHRYSDRHDCSFDYKSAARDAIARENPVVRAAKI  167

Query  690  FKL  698
             + 
Sbjct  168  VRF  170



>ref|XP_005148802.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Melopsittacus 
undulatus]
Length=180

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 86/167 (51%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-----------  386
            C   CG  GNP TN MC  C+        S+   +   P      E  P           
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAPSVSSITESLPVQCTEGSTQET  73

Query  387  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
            +ST   T+  +TVP+ ++L+ S     E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAADKTVPETEELQASVSGNAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_005521625.1| PREDICTED: AN1-type zinc finger protein 6 isoform X7 [Pseudopodoces 
humilis]
Length=180

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 93/167 (56%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKS---P  386
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S   P
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQEP  73

Query  387  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
            +ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEGLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>gb|EMT17725.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Aegilops tauschii]
Length=161

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 90/154 (58%), Gaps = 16/154 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  GN  T +MC KC+  T  A + + +      + +K A          +SP  
Sbjct  23   CINNCGFFGNRMTENMCSKCYRDTVKAKSMALL------VENKTAAAVA------SSPTP  70

Query  420  TVPDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  596
             V ++K    ++ K  ++   E +P P     NRC  CR+KVGLTGF+CRCG+ FC  HR
Sbjct  71   MVAEIKDEASASAKEGKRVAEEEAPKPPS---NRCLSCRKKVGLTGFKCRCGDTFCSMHR  127

Query  597  YSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            Y+D HDC +DYK AGRE IA++NPVV+A K+ + 
Sbjct  128  YADAHDCKFDYKQAGREQIAQQNPVVKADKVTRF  161



>dbj|BAJ94586.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99722.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=160

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 85/155 (55%), Gaps = 18/155 (12%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+  TN+MC KC+     A+T          I    AEK     F   S   
Sbjct  22   CVNNCGFFGSSMTNNMCSKCYRDFIKATT----------IAAPVAEKK---VFTVASSSN  68

Query  420  TVPDLKKLED--STDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
               +  K ++  +   +D +  +  P P     NRC  CR+KVGLTGF+CRCG  FC  H
Sbjct  69   VTLEQAKADEVGAVPLVDSQAAQEPPKPPS---NRCLSCRKKVGLTGFQCRCGGTFCSMH  125

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RY+D H+CS+DYK AGRE IA++NPVV   KI K+
Sbjct  126  RYADSHECSFDYKKAGREQIAKQNPVVIGEKINKI  160



>dbj|BAK01503.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 16/154 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  GN  T +MC KC+  T  A   +++      + +K A          +SP  
Sbjct  23   CVNNCGFFGNRMTENMCSKCYRDTAKAKRMATL------VENKTAAAVA------SSPTP  70

Query  420  TVPDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  596
             V ++K     + K  ++   E +P P     NRC  CR+KVGLTGF+CRCG+ FC  HR
Sbjct  71   LVAEMKDEASGSAKEGKQVAEEEAPKPPS---NRCLSCRKKVGLTGFKCRCGDTFCSMHR  127

Query  597  YSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            Y+D HDC +DYK AGRE IA++NPVV+A K+ + 
Sbjct  128  YADAHDCKFDYKQAGREQIAQQNPVVKADKVTRF  161



>ref|XP_010018692.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Nestor 
notabilis]
Length=180

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 86/173 (50%), Gaps = 26/173 (15%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-----------  386
            C   CG  GNP TN MC  C+        S+   +   P      E  P           
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAPSVSSITESLPVQCTEGSTQET  73

Query  387  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPA---------KREVNRCSGCRRK  539
            +ST   T+  +TVP+ + L+ S       +G + P P          K++ NRC  CR+K
Sbjct  74   QSTLESTAADKTVPETEDLQASV------SGNAEPTPEEQDKTLDKPKQKKNRCFMCRKK  127

Query  540  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            VGLTGF CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  128  VGLTGFECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_009376157.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376158.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376159.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376160.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379443.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379444.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379445.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379446.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=169

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 85/163 (52%), Gaps = 21/163 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+ AT +MC KC          +           K A  S  S   RTS   
Sbjct  18   CVNNCGFFGSAATMNMCSKCHKDMVLKQEQA-----------KLAASSFGSIVNRTSSIN  66

Query  420  TVPDLKKLEDSTDKIDEKTGESSPA----------PAKREVNRCSGCRRKVGLTGFRCRC  569
                +  ++     ++ KT  S P+          P   +  RC+ C ++VGLTGF CRC
Sbjct  67   ANEHVASVDVQPHPMEPKTLSSQPSFSFGSGSSGEPKPEDPKRCNTCNKRVGLTGFNCRC  126

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G LFC  HRYSD+HDCSYDY  AG++AIA+ NPVV+A K+ K+
Sbjct  127  GHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANPVVKAEKLGKI  169



>gb|ACM68454.1| stress-associated protein 4 [Solanum pennellii]
Length=161

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 90/159 (57%), Gaps = 14/159 (9%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G  AT +MC KC+         ++ AAS++     F   S  ++ +      
Sbjct  11   CVNNCGFFGTAATMNMCSKCYKDMIFKQEQANFAASSI---ESFVNGSSNASVKAVDVAV  67

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAP------AKREVNRCSGCRRKVGLTGFRCRCGELF  581
            TV      E   + +   T  ++P        AK   NRCS CRR+VGLTGF CRCG LF
Sbjct  68   TVQ-----EGPAESLVIPTQVAAPVESEQVEKAKEGPNRCSTCRRRVGLTGFNCRCGNLF  122

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            C  HRYSD+H+C YDY+ AG++AIA+ NPVV+A K+ K+
Sbjct  123  CSAHRYSDKHECPYDYRKAGQDAIAKANPVVKAEKLDKI  161



>ref|XP_009770813.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana sylvestris]
Length=172

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 92/155 (59%), Gaps = 2/155 (1%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ A  +MC KC+  T      + +AA+++      +  S +      S   
Sbjct  18   CINNCGFFGSAANMNMCSKCYKDTILKQEQAKLAATSIENLVNGSNASEKGPVVVDSVDM  77

Query  420  --TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
               V + K +   +       GE++    K   +RCS C++KVGLTGF+CRCG L+CG H
Sbjct  78   QPAVLETKSVVALSSPPSSSAGEAAELKTKVGPSRCSSCKKKVGLTGFKCRCGNLYCGSH  137

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RYSD+HDC +DY++AGR+AIA+ NPVV+A K+ K+
Sbjct  138  RYSDKHDCQFDYRSAGRDAIAKANPVVKAEKLDKI  172



>ref|XP_004229614.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Solanum lycopersicum]
Length=167

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 85/167 (51%), Gaps = 30/167 (18%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G  AT +MC KC+         +            FA  S  S F   S   
Sbjct  17   CVNNCGFFGTAATMNMCSKCYKDMIFKQEQA-----------NFAASSIES-FVNGSSNA  64

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAP--------------AKREVNRCSGCRRKVGLTGF  557
            +V    K  D    + E   ES   P              AK   NRCS CRR+VGLTGF
Sbjct  65   SV----KAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRRVGLTGF  120

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG LFC  HRYSD+H+C YDY+ AG++AIA+ NPVV+A K+ K+
Sbjct  121  NCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANPVVKAEKLDKI  167



>gb|ACM68441.1| stress-associated protein 4 [Solanum lycopersicum]
Length=161

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 85/167 (51%), Gaps = 30/167 (18%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G  AT +MC KC+         +            FA  S  S F   S   
Sbjct  11   CVNNCGFFGTAATMNMCSKCYKDMIFKQEQA-----------NFAASSIES-FVNGSSNA  58

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAP--------------AKREVNRCSGCRRKVGLTGF  557
            +V    K  D    + E   ES   P              AK   NRCS CRR+VGLTGF
Sbjct  59   SV----KAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRRVGLTGF  114

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG LFC  HRYSD+H+C YDY+ AG++AIA+ NPVV+A K+ K+
Sbjct  115  NCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANPVVKAEKLDKI  161



>ref|XP_009942070.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Opisthocomus 
hoazin]
Length=180

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-----------  386
            C   CG  GNP TN MC  C+        S+   +   P      E  P           
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAPSVSSITESLPVQCTEGSAQET  73

Query  387  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPA---PAKREVNRCSGCRRKVGLTGF  557
            +ST   T+  +TVP+ + L+ S  +  E T E         K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKLLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_006345467.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=167

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 82/167 (49%), Gaps = 30/167 (18%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G  AT +MC KC+         +            FA  S  S    +S   
Sbjct  17   CVNNCGFFGTAATMNMCSKCYKDMIFKQEQA-----------NFAASSIESFVNGSSSAS  65

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAP--------------AKREVNRCSGCRRKVGLTGF  557
                  K  D    + E   ES   P              AK   NRCS CRR+VGLTGF
Sbjct  66   V-----KAVDVAVTVQEGPAESLVIPTQVAAPVESVQVEKAKEGPNRCSTCRRRVGLTGF  120

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG LFC  HRYSD+H+C YDY  AG++AIA+ NPVV+A K+ K+
Sbjct  121  NCRCGNLFCSAHRYSDKHECPYDYHKAGQDAIAKANPVVKAEKLDKI  167



>ref|XP_006339126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum tuberosum]
Length=159

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 87/154 (56%), Gaps = 11/154 (7%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+P T + C KC+N                PI   F  + P  +  ++S   
Sbjct  16   CANNCGFFGSPTTQNFCSKCYNEVYIKGGQQK------PIDSLFPPQLPIPS--QSSSVL  67

Query  420  TVPDLKKLEDSTDKIDEKTGES-SPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  596
             +P+   +E+  + +      +  P PA+   NRCS CR+KVGL GF+CRCG  FCG HR
Sbjct  68   VLPEPAAVEEKPEVVIAAVTAAVQPMPAQS--NRCSACRKKVGLIGFKCRCGTTFCGTHR  125

Query  597  YSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            Y + H CS+D+K+ GREAIA+ NPVV+A K+ K+
Sbjct  126  YPEIHGCSFDFKSMGREAIAKANPVVKAEKLGKI  159



>ref|XP_010489793.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=152

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 81/126 (64%), Gaps = 17/126 (13%)
 Frame = +3

Query  246  NNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTV  425
            NNCGVT NPATN+MCQKCFNA+  ++T+S V            ++S RS   R+SP + V
Sbjct  34   NNCGVTANPATNNMCQKCFNASLVSATASVVV----DSGSSVLKRSARSVNLRSSPAKVV  89

Query  426  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSD  605
              ++  E    K D++            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSD
Sbjct  90   --IRPREIDAVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSD  136

Query  606  RHDCSY  623
            RHDC Y
Sbjct  137  RHDCIY  142



>ref|XP_009416009.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=147

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query  453  TDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK  632
            TDK  E   E    P  R  NRCS C RKVGLTGFRCRCG+LFCG HRYSD HDCS+DYK
Sbjct  68   TDK--ESKPEEESKPQVRFSNRCSTCGRKVGLTGFRCRCGDLFCGRHRYSDVHDCSFDYK  125

Query  633  AAGREAIARENPVVRAAKIFKL  698
            A GRE IA+ NPVV+AAKI K+
Sbjct  126  ALGREEIAKANPVVKAAKIIKI  147



>ref|XP_004957171.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Setaria italica]
Length=169

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKI  689
            VNRCS CR++VGLTGF CRCGELFCG HRYSDRH CSYDYK A R+AIARENPVVRAAKI
Sbjct  107  VNRCSSCRKRVGLTGFWCRCGELFCGAHRYSDRHGCSYDYKGAARDAIARENPVVRAAKI  166

Query  690  FKL  698
             + 
Sbjct  167  VRF  169



>ref|XP_012075269.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Jatropha curcas]
 gb|KDP35279.1| hypothetical protein JCGZ_09438 [Jatropha curcas]
Length=133

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 89/160 (56%), Gaps = 45/160 (28%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  GN  TN++C KC+                     KF  K P+ T        
Sbjct  12   CVNNCGFFGNAKTNNLCSKCY--------------------KKFLLKQPQQT--------  43

Query  420  TVPDLKKLEDSTDKI--DEKTGESS-----PAPAKREVNRCSGCRRKVGLTGFRCRCGEL  578
                  ++E +   +   E+TG +S     PA A    NRCS CR++VGLTGF CRCG+ 
Sbjct  44   ------QIESTIAPVAGGEQTGANSSENRPPAAA----NRCSFCRKRVGLTGFNCRCGQT  93

Query  579  FCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            FC  HRYSD+H+C +DYK+AG++AIA+ NP+V+A K+ K+
Sbjct  94   FCSLHRYSDKHNCVFDYKSAGQDAIAKANPIVKAEKMDKI  133



>ref|NP_001058985.1| Os07g0168800 [Oryza sativa Japonica Group]
 sp|Q7Y1W9.1|SAP9_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 9; Short=OsSAP9 [Oryza sativa Japonica 
Group]
 gb|AAP37480.1| putative A20/AN1-type zinc finger protein ZFP177 [Oryza sativa 
Japonica Group]
 dbj|BAD31780.1| putative zinc finger protein 216 [Oryza sativa Japonica Group]
 dbj|BAF20899.1| Os07g0168800 [Oryza sativa Japonica Group]
 gb|EAZ02907.1| hypothetical protein OsI_25046 [Oryza sativa Indica Group]
 gb|EAZ38825.1| hypothetical protein OsJ_23237 [Oryza sativa Japonica Group]
 dbj|BAH00672.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (57%), Gaps = 14/153 (9%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+  TN+MC KC+      +T ++      P+  K A     S+     P +
Sbjct  23   CVNNCGFFGSSMTNNMCSKCYRDFVKVTTMAA------PVVEKKAFTPASSSKTPLEPAK  76

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
              PD        DK      +++  P K   NRC  CR+KVGLTGF+CRCG  FC  HRY
Sbjct  77   --PDEVPAAAVEDK------QAAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHRY  128

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            ++ HDC++DYK AGR+ IA++NPVV A KI K+
Sbjct  129  TEAHDCTFDYKKAGRDQIAKQNPVVIAEKINKI  161



>ref|XP_010268591.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=163

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 83/153 (54%), Gaps = 13/153 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G PATN++C KC+       +             K A  S  +  +   P  
Sbjct  24   CSNNCGFFGTPATNNLCSKCYRDFFLKQS-------------KVAAASVVAERKVEEPIV  70

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
                   +         + G +S  P K   NRCS CR++VGLTGF+CRCG+ FC  HRY
Sbjct  71   EKAGQVGVGQEAKATLSEEGTTSGDPGKLPANRCSFCRKRVGLTGFKCRCGQTFCSLHRY  130

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            +D+H+C +DYK AG++AIA+ NPVV+A KI K+
Sbjct  131  TDKHNCLFDYKTAGQDAIAKANPVVKADKIEKI  163



>ref|XP_011080265.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011080266.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 89/168 (53%), Gaps = 28/168 (17%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+ A  +MC KC+         +           K A  S  +    +S G 
Sbjct  18   CVNNCGFFGSAANMNMCSKCYKDLILKQEQA-----------KLAASSIENIVNGSSSGN  66

Query  420  ----TVPDLKKLEDSTDKIDEKT-----------GESSPAPAKREVNRCSGCRRKVGLTG  554
                 V D   ++  TD ++ K             E++    K   NRCS C+++VGLTG
Sbjct  67   EQESVVADAAIMQ--TDLVEAKAISLPSINTSSFAEAAEPKTKEGPNRCSTCKKRVGLTG  124

Query  555  FRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            F+CRCG LFCG HRYSD+HDC +DY+ A R+AIA+ NPVV+A K+ ++
Sbjct  125  FKCRCGYLFCGSHRYSDKHDCPFDYRTAARDAIAKANPVVKAEKLDRI  172



>ref|XP_008935048.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Merops 
nubicus]
Length=180

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 91/167 (54%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV + T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVTSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG +FCG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVFCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_010139451.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Buceros 
rhinoceros silvestris]
Length=180

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SVA+ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVASITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG +FCG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVFCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>gb|EYU46282.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
 gb|EYU46283.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
Length=174

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 89/157 (57%), Gaps = 4/157 (3%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCF-NattaastsssvaastvPIPHKFAEKSPR---STFRRT  407
            CVNNCG  G+ A  +MC KC+ +       +   A+S   I +  +  +P    S     
Sbjct  18   CVNNCGFFGSAANMNMCSKCYKDLILKQEQAKFAASSIENIVNGSSSGTPTEQDSVIVAE  77

Query  408  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  587
            S     P ++    S   +   +    P  AK   ++CS C+++VGLTGF+CRCG  FCG
Sbjct  78   SANIPTPSVEAKSISLPSVINASTSDEPPRAKEGPSKCSSCKKRVGLTGFKCRCGSTFCG  137

Query  588  EHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             HRYSD+HDC +DY+ AGR+AIA+ NPVV+A K+ K+
Sbjct  138  SHRYSDKHDCPFDYRTAGRDAIAKANPVVKAEKLDKI  174



>ref|XP_009507913.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Phalacrocorax 
carbo]
Length=180

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaa----------stsssvaastvPIP-HKFAEKSP  386
            C   CG  GNP TN MC  C+                +TS S    ++P+P  + + +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVPCTEGSAQET  73

Query  387  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
            +ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>gb|AAQ84334.1| stress-associated protein 8 [Oryza sativa Indica Group]
Length=171

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 86/166 (52%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ AT +MC KC          +           K A  S  S       G+
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMIMKQEQA-----------KLAASSIDSIVNGGDSGK  65

Query  420  TVPDLKKLEDSTDKIDEKTGESSPA------------PAKREV-NRCSGCRRKVGLTGFR  560
                    E +  +++ KT  + PA            P  RE  NRCS CR++VGLTGF 
Sbjct  66   EPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFN  125

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG L+C  HRYSD+HDC +DY+ A R+AIA+ NPVV+A K+ K+
Sbjct  126  CRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI  171



>ref|NP_001058066.1| Os06g0612800 [Oryza sativa Japonica Group]
 sp|A2YEZ6.2|SAP8_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Indica Group]
 sp|A3BDI8.1|SAP8_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Japonica Group]
 dbj|BAD35521.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD35553.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAF19980.1| Os06g0612800 [Oryza sativa Japonica Group]
 gb|EAZ37627.1| hypothetical protein OsJ_21962 [Oryza sativa Japonica Group]
 dbj|BAG96476.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91568.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96788.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87267.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 86/166 (52%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ AT +MC KC          +           K A  S  S       G+
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMIMKQEQA-----------KLAASSIDSIVNGGDSGK  65

Query  420  TVPDLKKLEDSTDKIDEKTGESSPA------------PAKREV-NRCSGCRRKVGLTGFR  560
                    E +  +++ KT  + PA            P  RE  NRCS CR++VGLTGF 
Sbjct  66   EPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFN  125

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG L+C  HRYSD+HDC +DY+ A R+AIA+ NPVV+A K+ K+
Sbjct  126  CRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI  171



>ref|XP_010544224.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
 ref|XP_010544225.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
Length=170

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 93/159 (58%), Gaps = 12/159 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKC-----FNattaastsssvaastvPIPH-KFAEKSPRSTFR  401
            CVNNCG  G+PAT +MC KC     F     A  +S+VA S+  I   K     P S  +
Sbjct  18   CVNNCGFFGSPATMNMCSKCHKAMLFQEKQDAKLASAVAGSSSGIDTVKETVSGPSSDVQ  77

Query  402  RTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  581
              S G  +        S   I   T E+ P   K   +RCS C ++VGLTGF+CRCG LF
Sbjct  78   VISMGMKITSPPSSSASDPGI---TLETKP---KEGPSRCSTCNKRVGLTGFKCRCGNLF  131

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CG HRY+D+HDCS++Y  A +EAIA+ NPVV+AAK+ K+
Sbjct  132  CGSHRYADKHDCSFNYHEAAQEAIAKANPVVKAAKLDKI  170



>ref|XP_003574738.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11 [Brachypodium distachyon]
Length=171

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 60/74 (81%), Gaps = 4/74 (5%)
 Frame = +3

Query  489  PAPA----KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIA  656
            P PA    +  VNRC  CR++VGLTGFRCRCGE+FC  HRYSDRHDCSYDYK+A R+AIA
Sbjct  98   PGPAASASRSSVNRCRSCRKRVGLTGFRCRCGEMFCCAHRYSDRHDCSYDYKSAARDAIA  157

Query  657  RENPVVRAAKIFKL  698
            RENPVVRAAKI + 
Sbjct  158  RENPVVRAAKIVRF  171



>ref|XP_008461274.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Cucumis melo]
Length=172

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 91/176 (52%), Gaps = 44/176 (25%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK-FAEKSPRSTFRRTSPG  416
            C NNCG  G+ AT +MC KC                     HK F  K  ++    +S G
Sbjct  18   CANNCGFFGSAATMNMCSKC---------------------HKDFIMKQEQAKLAASSFG  56

Query  417  RTV---PD---LKKLEDSTDKIDEKTGESSPAP----------------AKREVNRCSGC  530
              V   P+    K +  S  K++ +  ESS  P                 K   NRCS C
Sbjct  57   NIVNCGPNDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNASSTVEKVKESPNRCSSC  116

Query  531  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            R++VGLTGF CRCG LFC  HRYSD+H+CS+DY+A GREAIA+ NPVV+A K+ K+
Sbjct  117  RKRVGLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANPVVKAEKLDKI  172



>ref|XP_009876598.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Apaloderma 
vittatum]
Length=180

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 91/167 (54%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPA---PAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E         K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAADKTVPETEDLQASVSENAESTPEEQDKLLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_002513466.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF48869.1| zinc finger protein, putative [Ricinus communis]
Length=172

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 86/156 (55%), Gaps = 4/156 (3%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ AT +MC KC          S + AS+       +  S            
Sbjct  18   CINNCGFFGSAATMNMCSKCHKDMLMKQEQSKLTASSAGSILGGSSSSSLEQLIAAGTVN  77

Query  420  TVPDL---KKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  590
              P++   K +      I E  GES  A  K   NRC+ C+++VGLTGF+CRCG LFC  
Sbjct  78   IQPNVEESKPIAVQPSYISE-LGESVEAKPKEGPNRCNACKKRVGLTGFKCRCGNLFCAS  136

Query  591  HRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            HRYSD+HDC +DY+ A REAIA+ NP+VRA K+ K+
Sbjct  137  HRYSDKHDCQFDYRNAAREAIAKANPIVRAEKLDKI  172



>ref|XP_007028890.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 4 [Theobroma cacao]
 gb|EOY09392.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 4 [Theobroma cacao]
Length=182

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 85/166 (51%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+ AT +MC KC  A                   + A  S  S    +S G 
Sbjct  28   CVNNCGFFGSAATMNMCSKCHKAMILKQEQV-----------QLAASSIGSIVNGSSSGN  76

Query  420  -TVPDLKKLEDSTDKIDE-KTGESSPA-----------PAKREVNRCSGCRRKVGLTGFR  560
               P L    D    I E K G + P+             K   NRC+ CR++VGLTGF 
Sbjct  77   GKEPTLAAALDVQSGIFESKNGSAEPSIDPSRMTFGGMKIKEGPNRCTTCRKRVGLTGFN  136

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG LFC  HRYSD+HDC +DY+ A R+AIA+ NPVVRA K+ K+
Sbjct  137  CRCGNLFCAAHRYSDKHDCPFDYRTAARDAIAKANPVVRAEKLDKI  182



>ref|XP_008490199.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Calypte 
anna]
Length=180

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSLTESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTALDKTVPETEDLQASVSESAEPTPEEQDKSLEKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_005419656.1| PREDICTED: AN1-type zinc finger protein 6 isoform X7 [Geospiza 
fortis]
 ref|XP_009088242.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Serinus 
canaria]
Length=180

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 93/167 (56%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ ++L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEELQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_008923640.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Manacus 
vitellinus]
Length=180

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 93/167 (56%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSTQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ ++L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEELQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_011659456.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Cucumis sativus]
 gb|KGN45145.1| hypothetical protein Csa_7G428820 [Cucumis sativus]
Length=172

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 91/176 (52%), Gaps = 44/176 (25%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK-FAEKSPRSTFRRTSPG  416
            C NNCG  G+ AT +MC KC                     HK F  K  ++    +S G
Sbjct  18   CANNCGFFGSAATMNMCSKC---------------------HKDFIMKQEQAKLAASSFG  56

Query  417  RTV---PD---LKKLEDSTDKIDEKTGESSPAP----------------AKREVNRCSGC  530
              V   P+    K +  S  K++ +  ESS  P                 K   NRCS C
Sbjct  57   NIVNCGPNDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNARSIVEKVKESPNRCSSC  116

Query  531  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            R++VGLTGF CRCG LFC  HRYSD+H+CS+DY+A GREAIA+ NPVV+A K+ K+
Sbjct  117  RKRVGLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANPVVKAEKLDKI  172



>gb|EMS47592.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Triticum urartu]
Length=267

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 89/154 (58%), Gaps = 16/154 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  GN  T +MC KC+  T  A   + +      + +K A          +SP  
Sbjct  129  CINNCGFFGNRMTENMCSKCYRDTVKAKKMALL------VENKTAAAVA------SSPTP  176

Query  420  TVPDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  596
             V ++K    ++ K  ++   E +P P     NRC  CR+KVGLTGF+CRCG+ FC  HR
Sbjct  177  MVAEIKDEASASAKEGKQVAEEEAPKPPS---NRCLSCRKKVGLTGFKCRCGDTFCSMHR  233

Query  597  YSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            Y+D HDC +DYK AGRE IA++NPVV+A K+ + 
Sbjct  234  YADAHDCKFDYKQAGREQIAQQNPVVKADKVTRF  267



>ref|XP_010157333.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Eurypyga 
helias]
Length=180

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQEA  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAADKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_007028887.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 ref|XP_007028888.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 ref|XP_007028889.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 gb|EOY09389.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 gb|EOY09390.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 gb|EOY09391.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
Length=172

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 85/166 (51%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+ AT +MC KC  A                   + A  S  S    +S G 
Sbjct  18   CVNNCGFFGSAATMNMCSKCHKAMILKQEQV-----------QLAASSIGSIVNGSSSGN  66

Query  420  T-VPDLKKLEDSTDKIDE-KTGESSPA-----------PAKREVNRCSGCRRKVGLTGFR  560
               P L    D    I E K G + P+             K   NRC+ CR++VGLTGF 
Sbjct  67   GKEPTLAAALDVQSGIFESKNGSAEPSIDPSRMTFGGMKIKEGPNRCTTCRKRVGLTGFN  126

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG LFC  HRYSD+HDC +DY+ A R+AIA+ NPVVRA K+ K+
Sbjct  127  CRCGNLFCAAHRYSDKHDCPFDYRTAARDAIAKANPVVRAEKLDKI  172



>ref|XP_010912823.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Elaeis guineensis]
 ref|XP_010912824.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Elaeis guineensis]
 ref|XP_010912825.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Elaeis guineensis]
Length=157

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  480  ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIAR  659
            E  P    R  NRCS CR++VGLTGFRCRCG+LFCG HRYSD H+CS+DYKAAGRE IA+
Sbjct  85   EEEPQSPVRFSNRCSTCRKRVGLTGFRCRCGDLFCGRHRYSDTHNCSFDYKAAGREEIAK  144

Query  660  ENPVVRAAKIFKL  698
             NPVVRAAKI K+
Sbjct  145  ANPVVRAAKIIKI  157



>ref|XP_010174709.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Caprimulgus 
carolinensis]
Length=180

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 88/167 (53%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssv----aastvPIPHKF-------AEKSP  386
            C   CG  GNP TN MC  C+        S+      A S   IP          + +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSIPESLPVQCTEGSTQET  73

Query  387  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
            +ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAADKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_011093525.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Sesamum indicum]
Length=168

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 91/163 (56%), Gaps = 21/163 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP--  413
            CVNNCG  G  AT +MC KC+         +           K A  S +S    +S   
Sbjct  17   CVNNCGFFGTAATMNMCSKCYKDLVMKQEQA-----------KLAASSIQSIVNGSSSIE  65

Query  414  GRTVPDLKKLEDSTDKIDEKTGE-SSPAPAKR---EVN----RCSGCRRKVGLTGFRCRC  569
            G  V  +K+ + ++ ++   T + SS +PA     EV     RC  CR++VGLTGF CRC
Sbjct  66   GTNVAVVKEAQAASSEVTVATIQISSASPASETSEEVKDGPKRCGACRKRVGLTGFICRC  125

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G ++C  HRYSD+H+C +DY+  G+EAIA+ NP+V+A K+ K+
Sbjct  126  GSIYCAVHRYSDKHNCPFDYRTVGQEAIAKANPIVKAEKLDKI  168



>gb|AFK43974.1| unknown [Lotus japonicus]
Length=172

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 82/166 (49%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPG-  416
            CVNNCG  G  AT +MC KC+                     K A  S  +     S G 
Sbjct  18   CVNNCGFFGRAATMNMCSKCYKDMLLKQEQ-----------DKLAATSVENIVNSCSNGN  66

Query  417  ------------RTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFR  560
                        R  P   K   +    D  +GES    AK   +RC  CR++VGLTGF 
Sbjct  67   GKQAITADAVNVRVEPVEVKAVTAQISADSSSGESLEVKAKTGPSRCGTCRKRVGLTGFS  126

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            C CG +FC  HRYSD+HDC +DY+A G+EAIA+ NPV++A K+ K+
Sbjct  127  CNCGNVFCAMHRYSDKHDCPFDYRAVGQEAIAKANPVIKADKLDKI  172



>ref|XP_009584789.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Fulmarus 
glacialis]
 ref|XP_009634160.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Egretta 
garzetta]
 ref|XP_009805410.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Gavia stellata]
 ref|XP_009884403.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Charadrius 
vociferus]
Length=180

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_011093524.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Sesamum indicum]
Length=173

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 91/163 (56%), Gaps = 21/163 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP--  413
            CVNNCG  G  AT +MC KC+         +           K A  S +S    +S   
Sbjct  22   CVNNCGFFGTAATMNMCSKCYKDLVMKQEQA-----------KLAASSIQSIVNGSSSIE  70

Query  414  GRTVPDLKKLEDSTDKIDEKTGE-SSPAPAKR---EVN----RCSGCRRKVGLTGFRCRC  569
            G  V  +K+ + ++ ++   T + SS +PA     EV     RC  CR++VGLTGF CRC
Sbjct  71   GTNVAVVKEAQAASSEVTVATIQISSASPASETSEEVKDGPKRCGACRKRVGLTGFICRC  130

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G ++C  HRYSD+H+C +DY+  G+EAIA+ NP+V+A K+ K+
Sbjct  131  GSIYCAVHRYSDKHNCPFDYRTVGQEAIAKANPIVKAEKLDKI  173



>ref|XP_008791733.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Phoenix dactylifera]
Length=159

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +3

Query  471  KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREA  650
            K  E S +P  R  NRCS CR++VGLTGFRCRCG+LFCG HRYSD H+CS+DYKAAGRE 
Sbjct  85   KPEEESQSPV-RFCNRCSTCRKRVGLTGFRCRCGDLFCGRHRYSDTHNCSFDYKAAGREE  143

Query  651  IARENPVVRAAKIFKL  698
            IA+ NPVVRAAKI K+
Sbjct  144  IAKANPVVRAAKIIKI  159



>ref|XP_009385134.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=156

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  495  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVV  674
            P  R V+RCS CR++VGLTGFRCRCG+LFC  HRYSD HDCS+DYKAAGRE IA+ NP++
Sbjct  89   PPVRLVSRCSSCRKRVGLTGFRCRCGDLFCASHRYSDTHDCSFDYKAAGREQIAKANPLI  148

Query  675  RAAKIFKL  698
            RAAK+ K+
Sbjct  149  RAAKVIKI  156



>ref|XP_010195894.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Colius 
striatus]
Length=180

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_005436662.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Falco cherrug]
 ref|XP_009482428.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Pelecanus 
crispus]
 ref|XP_009468362.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Nipponia 
nippon]
 ref|XP_009945661.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Leptosomus 
discolor]
 ref|XP_010076998.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Pterocles 
gutturalis]
 ref|XP_010123598.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Chlamydotis 
macqueenii]
Length=180

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSTQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_010302402.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Balearica 
regulorum gibbericeps]
Length=180

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +T+P+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTIPETQDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_008812241.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Phoenix dactylifera]
Length=157

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 81/153 (53%), Gaps = 9/153 (6%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+PAT ++C KC+         ++ A           EKS  +T     P  
Sbjct  14   CANNCGFFGSPATLNLCSKCYRDFRLKEDQAASAMIA-------VEKSLSAT--AAVPPS  64

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
                L   E     + E+         +R  NRC  CR++VGLTGFRCRCG  +CG HRY
Sbjct  65   PAVALVAAEPVVGTLAEQAAPPLQQQQERRSNRCGACRKRVGLTGFRCRCGATYCGAHRY  124

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             + H CS+DY A GREAIAR NPVV+A K+ ++
Sbjct  125  PELHGCSFDYMAVGREAIARANPVVKADKLHRI  157



>ref|XP_008384532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384534.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384535.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=169

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 83/163 (51%), Gaps = 21/163 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+ AT +MC KC                      K A  S  S   RTS   
Sbjct  18   CVNNCGFFGSAATMNMCSKCHKDMVLKQEQX-----------KLAASSFGSIVNRTSSIN  66

Query  420  TVPDLKKLEDSTDKIDEKTGESSPA----------PAKREVNRCSGCRRKVGLTGFRCRC  569
                +  ++     ++ KT  S P+          P      RC+ C ++VGLTGF CRC
Sbjct  67   ANEPVASVDVQPHPMEPKTLSSQPSFSFGSGSSGEPKPEGPKRCNTCNKRVGLTGFNCRC  126

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G LFC  HRYSD+HDCSYDY  AG++AIA+ NPVV+A K+ K+
Sbjct  127  GHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANPVVKADKLGKI  169



>ref|XP_010228642.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X3 [Brachypodium distachyon]
Length=155

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 89/153 (58%), Gaps = 16/153 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+  T +MC KC+  T    T ++VA   V +       S  S         
Sbjct  19   CINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKVAVA-----SSSTSLVAEIEDEV  73

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
            +VP    ++D    ++E+    +P P     NRC  CR+KVGLTGFRCRCG+ FC  HRY
Sbjct  74   SVP----VKDGKQAVEEE----APKPPS---NRCLSCRKKVGLTGFRCRCGDTFCSMHRY  122

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            +D H C++DYK AGRE IA++NP+V+A K+ K+
Sbjct  123  ADAHKCTFDYKQAGREQIAKQNPLVKADKVTKI  155



>ref|XP_010228638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Brachypodium distachyon]
Length=163

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 89/153 (58%), Gaps = 16/153 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+  T +MC KC+  T    T ++VA   V +       S  S         
Sbjct  27   CINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKVAVA-----SSSTSLVAEIEDEV  81

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
            +VP    ++D    ++E+    +P P     NRC  CR+KVGLTGFRCRCG+ FC  HRY
Sbjct  82   SVP----VKDGKQAVEEE----APKPPS---NRCLSCRKKVGLTGFRCRCGDTFCSMHRY  130

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            +D H C++DYK AGRE IA++NP+V+A K+ K+
Sbjct  131  ADAHKCTFDYKQAGREQIAKQNPLVKADKVTKI  163



>gb|EPS60974.1| hypothetical protein M569_13826 [Genlisea aurea]
Length=150

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 83/155 (54%), Gaps = 22/155 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  GNPA  ++C KC+                        EKS  S     +   
Sbjct  16   CVNNCGFLGNPAKQNLCSKCYTVLCL-------------------EKSGDSPIFTPALSF  56

Query  420  TVPDLKKLEDSTDKIDEK--TGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
            ++        S  +IDEK  T  S   P+ R   RCS CR+KVGL GF CRCG  FCG H
Sbjct  57   SLEKSTAESVSPTQIDEKSATATSHALPSSRG-GRCSACRKKVGLFGFTCRCGASFCGTH  115

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RY ++H CS+D+KAAGR+AIA+ NPVV+  K+ K+
Sbjct  116  RYPEKHGCSFDFKAAGRDAIAKANPVVKGEKLRKI  150



>gb|EEC76316.1| hypothetical protein OsI_13859 [Oryza sativa Indica Group]
Length=205

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 86/155 (55%), Gaps = 20/155 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+  T +MC KC+  T  A T ++             EK P ++   T    
Sbjct  69   CVNNCGFFGSRMTENMCSKCYRDTVKAKTVAT-----------VVEKKPLASLSSTPLVA  117

Query  420  TVPD--LKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
             V D     + D    ++E T    P P     NRC  CR+KVGLTGF+CRCG  FC  H
Sbjct  118  EVTDGGSGSVADGKQVMEEDT----PKPPS---NRCLSCRKKVGLTGFKCRCGGTFCSMH  170

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RY+D H C++DYK AGRE IA++NP+V+A KI K+
Sbjct  171  RYADSHKCTFDYKQAGREQIAKQNPLVKADKITKI  205



>ref|XP_010286312.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Phaethon 
lepturus]
Length=180

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 91/167 (54%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSTQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPA---KREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E         K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKTLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|NP_001106266.1| LOC100127541 [Zea mays]
 gb|ABS83246.1| AN15 [Zea mays]
 tpg|DAA62024.1| TPA: AN15 [Zea mays]
Length=163

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +3

Query  492  APAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPV  671
            A A+   NRCS CR++VGLTGFRCRCG+LFCG HRYSDRH C YDY+ A R+AIARENPV
Sbjct  95   ASARTSANRCSSCRKRVGLTGFRCRCGDLFCGAHRYSDRHGCRYDYRGAARDAIARENPV  154

Query  672  VRAAKIFKL  698
            VRAAKI + 
Sbjct  155  VRAAKIVRF  163



>ref|XP_009976938.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Tauraco 
erythrolophus]
Length=180

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 91/167 (54%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsss--------vaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+        S+         V++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATPVSSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_004249448.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum lycopersicum]
Length=159

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 84/158 (53%), Gaps = 19/158 (12%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+P T + C KC+N                PI   F    P S      P  
Sbjct  16   CANNCGFFGSPTTQNFCSKCYNEVYIKGGQQK------PIDSLF----PPSQL----PIP  61

Query  420  TVPDLKKLEDSTDKIDE-----KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  584
            +   +  L++ST   +E          +  P   + NRCS CR+KVGLTGF+CRCG  FC
Sbjct  62   STSSILVLQESTAAEEEPEVVTAAVTVAVQPISAQPNRCSACRKKVGLTGFKCRCGTTFC  121

Query  585  GEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G HRY + H CS+D+K+ GREAIA+ NPVV+A K+ K+
Sbjct  122  GTHRYPEIHGCSFDFKSIGREAIAKANPVVKAEKLGKI  159



>ref|XP_006487967.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3-like [Citrus sinensis]
Length=156

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 84/159 (53%), Gaps = 21/159 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+P T ++C KCF      +  SS               S +    +T    
Sbjct  13   CVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSS---------------SAKHALNQTLISS  57

Query  420  TVPDLKKLED-STDKIDEKTGESSPAPAKREV-----NRCSGCRRKVGLTGFRCRCGELF  581
            +  DL   E  +TD       E  PA     V     NRC  CRR+VGLTGF+CRCG +F
Sbjct  58   SSVDLSLRERPATDVEVAAEAEKPPAEVAAPVQSTAANRCMTCRRRVGLTGFKCRCGSVF  117

Query  582  CGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CG HRY ++H CS+D+K  G+E IAR NPVV+A K+ K+
Sbjct  118  CGTHRYPEQHACSFDFKEMGKEQIARANPVVKAEKLQKI  156



>ref|XP_010031824.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X2 [Eucalyptus grandis]
 ref|XP_010031825.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X2 [Eucalyptus grandis]
 gb|KCW51205.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51206.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51207.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51208.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51209.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
Length=171

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 88/162 (54%), Gaps = 17/162 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRS---------  392
            C+NNCG  G+PAT +MC KC          + +AAS++      +  +  S         
Sbjct  18   CINNCGFFGSPATMNMCSKCHKDMLLKQEQAKLAASSIAAAENGSSSTTASEPVFAASVD  77

Query  393  TFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCG  572
            T   T   +T+P     +  T    EK  E           RCS C ++VGLTGF CRCG
Sbjct  78   TQLNTVEPKTIPKQPACDSVTVATVEKPKEGP--------TRCSSCNKRVGLTGFSCRCG  129

Query  573  ELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             +FCG HRYSD+HDC +DY++AGR AIA+ NPV++A K+ K+
Sbjct  130  NIFCGTHRYSDKHDCPFDYRSAGRNAIAKANPVIKAEKLDKI  171



>ref|XP_004513637.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Cicer arietinum]
Length=166

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 85/153 (56%), Gaps = 5/153 (3%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G  AT +MC KC+              +T  + +  +  S  +  +  +   
Sbjct  19   CVNNCGFFGRAATMNMCSKCY--KDTMLKQEQDKLATASVENIVSGSSTYNEKQVVTDNA  76

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
                +  +E S D     +GE+     K   +RC+ CR++VGLTGF C+CG LFC  HRY
Sbjct  77   VDGKVGNVEISGD---SSSGENLETKVKTGPSRCAACRKRVGLTGFTCKCGNLFCAMHRY  133

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SD+HDC +DY++ GR+AIA+ NPV++A K+ K 
Sbjct  134  SDKHDCPFDYQSVGRDAIAKSNPVIKADKLNKF  166



>gb|EPS64266.1| hypothetical protein M569_10515, partial [Genlisea aurea]
Length=141

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 68/93 (73%), Gaps = 11/93 (12%)
 Frame = +3

Query  426  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRY  599
            PDL+ L      +++  G   P   + E  RCSG  CR++VGL GFRCRCG+LFC EHRY
Sbjct  58   PDLESL------VEKHAGSKRP---REEATRCSGSGCRKRVGLIGFRCRCGDLFCSEHRY  108

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SDRHDC+YDYK AGREAI++ENPV++A K+ K+
Sbjct  109  SDRHDCNYDYKKAGREAISKENPVIKACKLVKI  141



>ref|XP_002466323.1| hypothetical protein SORBIDRAFT_01g005640 [Sorghum bicolor]
 gb|EER93321.1| hypothetical protein SORBIDRAFT_01g005640 [Sorghum bicolor]
Length=180

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 87/169 (51%), Gaps = 28/169 (17%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNat--------------taastsssvaastvPIPHKFAE  377
            C N CG  GN AT  MC KC+                     T+++ A S  P P   AE
Sbjct  24   CANGCGYFGNAATGGMCSKCYRKHAAAGATATSTSTTTADKKTTTAQAVSETPAP---AE  80

Query  378  KSPR--STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  551
            K  +       +SPG  V +       +         + P P K+  NRCS CR+KVGL 
Sbjct  81   KKAKIACAVASSSPGGGVDNAGAARAPS---------TEPQPVKQTANRCSACRKKVGLL  131

Query  552  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GFRC CGE FCG HRY+++H C YDYK+AGRE IA+ NPVV A KI K+
Sbjct  132  GFRCCCGETFCGAHRYAEKHACGYDYKSAGRERIAKNNPVVVADKIAKI  180



>gb|ACT53874.1| zinc finger protein [Saccharum officinarum]
 gb|ADM33793.1| SAP1 [Saccharum officinarum]
Length=171

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 84/166 (51%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP--  413
            C+NNCG  G+ AT +MC KC          +           K A  S  S         
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMIMKQEQA-----------KLAASSIDSIVNGNDAVM  65

Query  414  -----GRTVPDLKKLE------DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFR  560
                 G TV  + ++E        TD      G +  +  K   NRCS CR++VGLTGF 
Sbjct  66   EPVVSGNTVVAVAQVELQTMNVQPTDVAGPSEGAAVISKGKVGPNRCSTCRKRVGLTGFN  125

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG L+C  HRYSD+HDC +DY+ A R+AIA+ NPVV+A K+ K+
Sbjct  126  CRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANPVVKADKLDKI  171



>ref|XP_004513638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Cicer arietinum]
Length=160

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 85/153 (56%), Gaps = 5/153 (3%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G  AT +MC KC+              +T  + +  +  S  +  +  +   
Sbjct  13   CVNNCGFFGRAATMNMCSKCY--KDTMLKQEQDKLATASVENIVSGSSTYNEKQVVTDNA  70

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
                +  +E S D     +GE+     K   +RC+ CR++VGLTGF C+CG LFC  HRY
Sbjct  71   VDGKVGNVEISGD---SSSGENLETKVKTGPSRCAACRKRVGLTGFTCKCGNLFCAMHRY  127

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SD+HDC +DY++ GR+AIA+ NPV++A K+ K 
Sbjct  128  SDKHDCPFDYQSVGRDAIAKSNPVIKADKLNKF  160



>ref|XP_008804197.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Phoenix dactylifera]
 ref|XP_008804198.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Phoenix dactylifera]
Length=151

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +3

Query  471  KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREA  650
            K  E + +P  R  NRCS CR++VGLTGFRCRCG+LFCG HRYSD HDCS+DYK AGRE 
Sbjct  77   KPDEEAQSPV-RFSNRCSTCRKRVGLTGFRCRCGDLFCGRHRYSDTHDCSFDYKTAGREE  135

Query  651  IARENPVVRAAKIFKL  698
            IA+ NP+VRAAKI K+
Sbjct  136  IAKANPLVRAAKIIKI  151



>ref|XP_009701714.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Cariama 
cristata]
Length=180

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSTQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKT---GESSPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ + L+ S  +  E T    + S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPDEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>gb|ABK21003.1| unknown [Picea sitchensis]
 gb|ACN40831.1| unknown [Picea sitchensis]
Length=180

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 89/176 (51%), Gaps = 42/176 (24%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+PAT S+C KC+                          SP+S+F +    +
Sbjct  24   CANNCGFFGSPATMSLCSKCYREFVLL-------------------NSPKSSFDKPQQQQ  64

Query  420  TV-------PDL--KKLEDSTDKIDEKTGESSPAPAKRE--------------VNRCSGC  530
                     PD+  +++      +D      S A  + E               NRC  C
Sbjct  65   IQGEVSIPRPDVGDEEIRSKYLAVDGSGPSCSTAAHQLEPQQQQNPPPPPPRQTNRCFSC  124

Query  531  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            R++VGLTGFRCRCG++FC  HRYSD+H+C+YDYK AGREAIA+ NP+V+A KI + 
Sbjct  125  RKRVGLTGFRCRCGDMFCALHRYSDKHNCTYDYKTAGREAIAKANPLVKADKILRF  180



>ref|XP_008638302.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Corvus 
brachyrhynchos]
Length=180

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 92/167 (55%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T+  +TVP+ ++L+ S  +  E   E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEELQASVSENAEPAPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_010189201.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Mesitornis 
unicolor]
Length=180

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 91/167 (54%), Gaps = 14/167 (8%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  389
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  390  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  557
             ST   T   +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTPVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  558  RCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             CRCG ++CG HRYSD H CSY+YKA   E I +ENPVV   KI K+
Sbjct  134  ECRCGNVYCGMHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI  180



>ref|XP_009393780.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=146

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  465  DEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGR  644
            DE   +    P  R   RCS CR+KVGLTGFRCRCG+LFCG HRYSD HDCS+DYKA GR
Sbjct  69   DEVKPDEESKPPVRYSKRCSTCRKKVGLTGFRCRCGDLFCGRHRYSDSHDCSFDYKAFGR  128

Query  645  EAIARENPVVRAAKIFKL  698
            E IA+ NPVVR +KI K+
Sbjct  129  EQIAKANPVVRPSKIIKI  146



>ref|XP_010031823.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X1 [Eucalyptus grandis]
Length=196

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 88/162 (54%), Gaps = 17/162 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRS---------  392
            C+NNCG  G+PAT +MC KC          + +AAS++      +  +  S         
Sbjct  43   CINNCGFFGSPATMNMCSKCHKDMLLKQEQAKLAASSIAAAENGSSSTTASEPVFAASVD  102

Query  393  TFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCG  572
            T   T   +T+P     +  T    EK  E           RCS C ++VGLTGF CRCG
Sbjct  103  TQLNTVEPKTIPKQPACDSVTVATVEKPKEGP--------TRCSSCNKRVGLTGFSCRCG  154

Query  573  ELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             +FCG HRYSD+HDC +DY++AGR AIA+ NPV++A K+ K+
Sbjct  155  NIFCGTHRYSDKHDCPFDYRSAGRNAIAKANPVIKAEKLDKI  196



>ref|XP_010531421.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=161

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 89/153 (58%), Gaps = 15/153 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G P TN++C KC+       + +    + V    K  +++         P  
Sbjct  24   CANNCGFFGGPNTNNLCSKCYREFLLNQSKAIDDNTVVVGKEKGIDQTTGKKPENNEP--  81

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
                L   E  T +I E  GE+S  P     NRCS CR++VGLTGF+CRCG  FC +HRY
Sbjct  82   ----LGYRE--TGRIWE--GENSEKP-----NRCSLCRKRVGLTGFKCRCGHTFCSQHRY  128

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            SD+H+C +DYK+AG++AIA+ NPVV+A K+ K+
Sbjct  129  SDKHNCVFDYKSAGQDAIAKANPVVKADKVDKI  161



>ref|XP_009416000.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=147

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query  453  TDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK  632
            TDK  E   E    P  + +N CS C RKVGLTGFRCRCG+LFCG HRYSD HDCS+DYK
Sbjct  68   TDK--ESKPEEESKPQVKFINGCSTCGRKVGLTGFRCRCGDLFCGRHRYSDTHDCSFDYK  125

Query  633  AAGREAIARENPVVRAAKIFKL  698
            A GRE IA+ NPVV+AAKI K+
Sbjct  126  ALGREEIAKANPVVKAAKIIKI  147



>ref|XP_009411960.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411961.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Musa acuminata subsp. malaccensis]
Length=151

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 84/154 (55%), Gaps = 15/154 (10%)
 Frame = +3

Query  237  PCVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPG  416
            PC NNC   G+PAT ++C KC+         ++ A   V I                SP 
Sbjct  13   PCANNCSFFGSPATLNLCSKCYRDFRLKEEQAASAKLAVEI--------------SLSPP  58

Query  417  RTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  596
             +         +     EK  E++  PA R   RC  CR++VGLTGFRCRCG  +CG+HR
Sbjct  59   PSSAATVSSSTAPSSPSEKPSEAAAEPAPRPT-RCKSCRKRVGLTGFRCRCGSTYCGQHR  117

Query  597  YSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            Y +RH C++DYKAAGREAIA  NPVV+A K+ ++
Sbjct  118  YPERHACAFDYKAAGREAIALANPVVKADKLRRI  151



>ref|XP_002282913.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 [Vitis vinifera]
 ref|XP_010654069.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 [Vitis vinifera]
Length=161

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 90/153 (59%), Gaps = 7/153 (5%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+PAT ++C KC+         +S A S V    K    +  ST   + P  
Sbjct  16   CANNCGFFGSPATLNLCSKCYRDLRLKEEQASSAKSAV---EKSLSAASSSTAPLSPPAL  72

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
            T+P+      +   +      + P+P+  + NRCS CR++VGLTGFRCRCG  FCG HRY
Sbjct  73   TLPEAA----NEITVPAAVTAAVPSPSATQPNRCSTCRKRVGLTGFRCRCGITFCGVHRY  128

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             ++H C++D+K  G+EAI++ NPVV+A K+ K+
Sbjct  129  PEQHGCTFDFKTLGKEAISKANPVVKAEKLHKI  161



>gb|AAX14637.1| zinc finger protein [Zea mays]
 gb|ABS83244.1| AN13 [Zea mays]
 gb|ACG36018.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG48526.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|AFW87476.1| zinc finger protein1 isoform 1 [Zea mays]
 gb|AFW87477.1| zinc finger protein1 isoform 2 [Zea mays]
 gb|AFW87478.1| zinc finger protein1 isoform 3 [Zea mays]
Length=174

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 88/161 (55%), Gaps = 11/161 (7%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ AT +MC KC          + +AAS++         S        +   
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMITKQDQAKLAASSI---DSIVNGSDAVMEPVVAGSN  73

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREV--------NRCSGCRRKVGLTGFRCRCGE  575
            TV  + ++E  T  + +    + P+     +        NRCS CR++VGLTGF CRCG 
Sbjct  74   TVVAVAQVELQTMNVQQPADVAGPSEGVAAISKGGKVGPNRCSACRKRVGLTGFNCRCGN  133

Query  576  LFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            L+C  HRYSD+HDC +DY+ A R+AIA+ NPVV+A K+ K+
Sbjct  134  LYCALHRYSDKHDCKFDYRTAARDAIAKANPVVKADKLDKI  174



>ref|NP_001266661.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
 gb|ACG38807.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
Length=167

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKI  689
            V RC  CR++VGLTGFRCRCG+LFCG HRYSDRHDC +DY+AAGR+AIAR+NPVVRAAKI
Sbjct  105  VRRCQTCRKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNPVVRAAKI  164

Query  690  FKL  698
             + 
Sbjct  165  VRF  167



>gb|ACG26325.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG28071.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
Length=171

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 87/166 (52%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ AT +MC KC          +           + A  S  S       G+
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMITKQEQA-----------QLAASSIDSIVNGGDGGK  65

Query  420  TVPDLKKLEDSTDKIDEKT--------GESSPAP-----AKREVNRCSGCRRKVGLTGFR  560
                   +  +  ++++KT         E+S A      AK   +RC+ CR++VGLTGF 
Sbjct  66   GPVIAASVNAAVPQVEQKTIVVQPMLVAETSEAAAVIPKAKEGPDRCAACRKRVGLTGFS  125

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG ++C  HRYSD+HDC +DY+ A R+AIA+ NPVVRA K+ K+
Sbjct  126  CRCGNMYCSVHRYSDKHDCQFDYRTAARDAIAKANPVVRAEKLDKI  171



>ref|XP_011839092.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Mandrillus 
leucophaeus]
Length=181

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 94/169 (56%), Gaps = 17/169 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast---------sssvaastvPIPHKFAEKS---  383
            C   CG  GNP TN MC  C+                 ++SV++ +  +P +  + S   
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPG  73

Query  384  PRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  551
             +ST   TS  + VP+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   AQSTLDSTSVDKAVPETEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  552  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GF CRCG ++CG HRYSD H+CSY+YKA   E I +ENPVV   KI K+
Sbjct  133  GFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI  181



>gb|ABK26062.1| unknown [Picea sitchensis]
Length=180

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 88/176 (50%), Gaps = 42/176 (24%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C NNCG  G+PAT S+C KC+                          SP+S+F +    +
Sbjct  24   CANNCGFFGSPATMSLCSKCYREFVLL-------------------NSPKSSFDKPQQQQ  64

Query  420  TV-------PDL--KKLEDSTDKIDEKTGESSPAPAKRE--------------VNRCSGC  530
                     PD+  +++      +D      S A  + E               NRC  C
Sbjct  65   IQGEVSIPRPDVGDEEIRSKYLAVDGSGPSCSTAAHQLEPQQQQNPPPPPPRQTNRCFSC  124

Query  531  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            R++VGLTGFRCRCG++FC  HRYSD+H C+YDYK AGREAIA+ NP+V+A KI + 
Sbjct  125  RKRVGLTGFRCRCGDMFCALHRYSDKHKCTYDYKTAGREAIAKANPLVKADKILRF  180



>gb|EEE60081.1| hypothetical protein OsJ_12913 [Oryza sativa Japonica Group]
Length=205

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 85/155 (55%), Gaps = 20/155 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+  T +MC KC+  T  A T ++             EK P ++   T    
Sbjct  69   CVNNCGFFGSRMTENMCSKCYRDTVKAKTVAT-----------VVEKKPLASLSSTPLVT  117

Query  420  TVPD--LKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  593
             V D     + D    ++E T    P P     NRC  CR+KVGLTGF+CRCG  FC  H
Sbjct  118  EVTDGGSGSVADGKQVMEEDT----PKPPS---NRCLSCRKKVGLTGFKCRCGGTFCSMH  170

Query  594  RYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            RY+D H C++DYK  GRE IA++NP+V+A KI K+
Sbjct  171  RYADSHKCTFDYKQVGREQIAKQNPLVKADKITKI  205



>ref|XP_002306229.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE86740.2| zinc finger family protein [Populus trichocarpa]
Length=166

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 91/163 (56%), Gaps = 20/163 (12%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+ AT ++C KC+     +           P+ H+    S  S    +S   
Sbjct  14   CVNNCGFYGSQATENLCSKCYRDLHQSQ----------PLNHQLLNPSSSSAASVSSFAS  63

Query  420  TVPDLKKLEDST---------DKIDE-KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  569
               D+ K+  +          DK DE K GE +    +++ +RC  CRR+VGLTGF+CRC
Sbjct  64   PAVDVLKVNTNQKAPVVVVGDDKKDEVKAGEPAVVKQQQQPSRCLTCRRRVGLTGFKCRC  123

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G +FCG HRY ++HDC +D+K+ G++ IA+ NPVV+  K+ K+
Sbjct  124  GMVFCGTHRYPEQHDCEFDFKSLGKQQIAKANPVVKGEKLQKI  166



>ref|NP_001106260.1| LOC100127534 [Zea mays]
 ref|XP_008676419.1| PREDICTED: LOC100127534 isoform X1 [Zea mays]
 ref|XP_008659059.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger A20 and AN1 domain-containing 
stress-associated protein 8-like [Zea mays]
 gb|ABS83245.1| AN14 [Zea mays]
 gb|ACL52408.1| unknown [Zea mays]
 gb|ACL54722.1| unknown [Zea mays]
 gb|ACL54773.1| unknown [Zea mays]
 gb|AFW66190.1| AN14 [Zea mays]
Length=171

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 84/166 (51%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ AT +MC KC          +           + A  S  S       G+
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMIMKQEQA-----------QLAASSIDSIVNGGDNGK  65

Query  420  TVPDLKKLEDSTDKIDEKTGESSP-------------APAKREVNRCSGCRRKVGLTGFR  560
                   +  +  +++EKT    P             A AK   NRC+ CR++VGLTGF 
Sbjct  66   GPAIAATVGVAVPQVEEKTIAVQPMHVAETSEAAAVIAKAKEGPNRCATCRKRVGLTGFN  125

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG  +C  HRYSD+HDC +DY+ A R+AIA+ NPVV+A K+ K+
Sbjct  126  CRCGNTYCSMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI  171



>gb|KEH16280.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=177

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 85/163 (52%), Gaps = 21/163 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G  AT +MC KC+  T                  K A  S  +     S  +
Sbjct  26   CVNNCGFFGRAATMNMCSKCYKDTQLMQE-----------QEKLAAASVENLVSGGSMKQ  74

Query  420  TVPD------LKKLEDSTDKI----DEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  569
             V D      ++ +E  T       D  + E+     K   +RC+ CR++VGLTGF C+C
Sbjct  75   VVTDGAVNVQIENVEVKTVSAEISGDSSSSENLETKVKTGPSRCATCRKRVGLTGFTCKC  134

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G LFC  HRYSD+HDC +DY++ GR+AIA+ NPV++A K+ K 
Sbjct  135  GNLFCAMHRYSDKHDCPFDYQSVGRDAIAKSNPVIKADKLDKF  177



>ref|XP_004421951.1| PREDICTED: AN1-type zinc finger protein 6 isoform 7 [Ceratotherium 
simum simum]
Length=181

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 94/169 (56%), Gaps = 17/169 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaast---------sssvaastvPIPHKFAEKS---  383
            C   CG  GNP TN MC  C+                 ++SV++ +  +P +  + S   
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPE  73

Query  384  PRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  551
             +ST   TS  + +P+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   AQSTLDSTSVDKAIPETEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  552  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            GF CRCG ++CG HRYSD H+CSY+YKA   E I +ENPVV   KI K+
Sbjct  133  GFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI  181



>ref|XP_006657485.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X1 [Oryza brachyantha]
 ref|XP_006657486.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X2 [Oryza brachyantha]
Length=160

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 84/153 (55%), Gaps = 15/153 (10%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G+  TN+MC KC+      +T         P+  K    +  S+     P +
Sbjct  23   CVNNCGFFGSSMTNNMCSKCYRDFIKVTTMV-------PVVDKKVFTAASSSKTPLEPAK  75

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
              PD        DK      + +  P K   NRC  CR+KVGLTGF+CRCG  FC  HRY
Sbjct  76   --PDEVPAAAVEDK------QEAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHRY  127

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            ++ H+C++DYK AGR+ IA++NPVV A KI K+
Sbjct  128  TEAHNCTFDYKKAGRDQIAKQNPVVIAEKINKI  160



>ref|NP_001106263.1| AN110 [Zea mays]
 gb|ABS83249.1| AN110 [Zea mays]
Length=174

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKI  689
            V RC  CR++VGLTGFRCRCG+LFCG HRYSDRHDC +DY+AAGR+AIAR+NPVVRAAKI
Sbjct  112  VRRCQTCRKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNPVVRAAKI  171

Query  690  FKL  698
             + 
Sbjct  172  VRF  174



>gb|KEH16279.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=169

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 85/163 (52%), Gaps = 21/163 (13%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG  G  AT +MC KC+  T                  K A  S  +     S  +
Sbjct  18   CVNNCGFFGRAATMNMCSKCYKDTQLMQE-----------QEKLAAASVENLVSGGSMKQ  66

Query  420  TVPD------LKKLEDSTDKI----DEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  569
             V D      ++ +E  T       D  + E+     K   +RC+ CR++VGLTGF C+C
Sbjct  67   VVTDGAVNVQIENVEVKTVSAEISGDSSSSENLETKVKTGPSRCATCRKRVGLTGFTCKC  126

Query  570  GELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            G LFC  HRYSD+HDC +DY++ GR+AIA+ NPV++A K+ K 
Sbjct  127  GNLFCAMHRYSDKHDCPFDYQSVGRDAIAKSNPVIKADKLDKF  169



>dbj|BAG50058.1| transcription factor C2H2 [Lotus japonicus]
Length=165

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 84/153 (55%), Gaps = 3/153 (2%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            CVNNCG +G+PAT  +C KC+          +   ST+      +    +     +SP  
Sbjct  16   CVNNCGFSGSPATMDLCSKCYRDIRLKEQQEASTKSTIETALSSSSSVAKPPSSTSSPSP  75

Query  420  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRY  599
             V      +  T  I    G   P     + NRC+ CR++VGLTGF+CRC   FCG HRY
Sbjct  76   AVDLAPPAKAETASISLTAG---PILQAAQPNRCATCRKRVGLTGFKCRCEVTFCGAHRY  132

Query  600  SDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
             ++H CS+D+K  GREAIARENPVVRA K+ ++
Sbjct  133  PEKHACSFDFKTVGREAIARENPVVRAEKLRRI  165



>ref|XP_004250869.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
 gb|ACM68439.1| stress-associated protein 2 [Solanum lycopersicum]
Length=170

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 85/168 (51%), Gaps = 30/168 (18%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ A  +MC KC+                  I  +  EK   S+      G 
Sbjct  18   CINNCGFFGSAANMNMCSKCYKDV---------------ILKQEQEKLAASSIENFVNGS  62

Query  420  TVPDLKKLEDSTD---------------KIDEKTGESSPAPAKREVNRCSGCRRKVGLTG  554
            T      +  S D                    +GE++   AK   +RCS C++KVGLTG
Sbjct  63   TSQKGPVIVGSVDVQPALLESKSVVLSSPPSSSSGEAAELMAKEGPSRCSTCKKKVGLTG  122

Query  555  FRCRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            F+CRCG  +CG HRYSD+HDC +DY++A R AIA+ NPVV+A K+ K+
Sbjct  123  FKCRCGNFYCGSHRYSDKHDCQFDYRSAARNAIAKANPVVKAEKLDKI  170



>ref|NP_001130325.1| LOC100191419 [Zea mays]
 ref|XP_008680964.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 ref|XP_008680965.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 gb|ACF78509.1| unknown [Zea mays]
 gb|ACF81174.1| unknown [Zea mays]
 gb|ACN33638.1| unknown [Zea mays]
 gb|AFW70762.1| zinc finger A20 and AN1 domain-containing protein isoform 1 [Zea 
mays]
 gb|AFW70763.1| zinc finger A20 and AN1 domain-containing protein isoform 2 [Zea 
mays]
 gb|AFW70764.1| zinc finger A20 and AN1 domain-containing protein isoform 3 [Zea 
mays]
 gb|AFW70765.1| zinc finger A20 and AN1 domain-containing protein isoform 4 [Zea 
mays]
Length=171

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 87/166 (52%), Gaps = 24/166 (14%)
 Frame = +3

Query  240  CVNNCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  419
            C+NNCG  G+ AT +MC KC          +           + A  S  S       G+
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMITKQEQA-----------QLAASSIDSIVNGGDGGK  65

Query  420  TVPDLKKLEDSTDKIDEKT--------GESSPAPA-----KREVNRCSGCRRKVGLTGFR  560
                   +  +  ++++KT         E+S A A     K   +RC+ CR++VGLTGF 
Sbjct  66   GPVIAASVNVAVPQVEQKTIVVQPMLVAETSEAAAVIPKAKEGPDRCAACRKRVGLTGFS  125

Query  561  CRCGELFCGEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKIFKL  698
            CRCG ++C  HRYSD+HDC +DY+ A R+AIA+ NPVVRA K+ K+
Sbjct  126  CRCGNMYCSVHRYSDKHDCQFDYRTAARDAIAKANPVVRAEKLDKI  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2420966944598