BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5783

Length=765
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796391.1|  PREDICTED: cyclin-A1-4                             200   5e-57   Nicotiana sylvestris
emb|CAA63542.1|  cyclin A-like protein                                  199   2e-56   Nicotiana tabacum [American tobacco]
dbj|BAA09366.1|  A-type cyclin                                          199   2e-56   Nicotiana tabacum [American tobacco]
ref|NP_001233762.1|  cyclin A1                                          198   4e-56   Solanum lycopersicum
ref|XP_010312445.1|  PREDICTED: cyclin A1 isoform X1                    198   5e-56   
ref|XP_009593178.1|  PREDICTED: cyclin-A1-4 isoform X2                  197   5e-56   Nicotiana tomentosiformis
ref|XP_009593177.1|  PREDICTED: cyclin-A1-4 isoform X1                  197   6e-56   Nicotiana tomentosiformis
ref|XP_006351136.1|  PREDICTED: cyclin-A1-3-like isoform X1             194   1e-54   Solanum tuberosum [potatoes]
ref|XP_006351137.1|  PREDICTED: cyclin-A1-3-like isoform X2             194   1e-54   Solanum tuberosum [potatoes]
ref|XP_002284567.1|  PREDICTED: cyclin-A1-1-like                        191   2e-53   Vitis vinifera
gb|AEV43294.1|  cyclin A1                                               179   5e-53   Nicotiana benthamiana
emb|CBI18982.3|  unnamed protein product                                191   6e-53   Vitis vinifera
dbj|BAE06271.1|  cyclin A                                               188   3e-52   Scutellaria baicalensis [Baikal skullcap]
emb|CDP10969.1|  unnamed protein product                                187   1e-51   Coffea canephora [robusta coffee]
ref|XP_006386358.1|  hypothetical protein POPTR_0002s08020g             186   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006351138.1|  PREDICTED: cyclin-A1-3-like isoform X3             186   1e-51   Solanum tuberosum [potatoes]
ref|XP_011102309.1|  PREDICTED: cyclin-A1-1                             186   2e-51   Sesamum indicum [beniseed]
ref|XP_011027473.1|  PREDICTED: cyclin-A1-1-like                        184   1e-50   Populus euphratica
ref|XP_011027470.1|  PREDICTED: cyclin-A1-1-like                        184   1e-50   Populus euphratica
gb|EYU32511.1|  hypothetical protein MIMGU_mgv1a005475mg                183   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_002520329.1|  cyclin A, putative                                 182   5e-50   
ref|XP_002306649.1|  cyclin family protein                              180   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011003420.1|  PREDICTED: cyclin-A1-1-like                        178   1e-48   Populus euphratica
ref|XP_010063417.1|  PREDICTED: cyclin-A1-1                             178   2e-48   
ref|XP_007019157.1|  Cyclin A1,1 isoform 1                              177   2e-48   
gb|KHN35496.1|  Cyclin-A1-1                                             172   9e-48   Glycine soja [wild soybean]
gb|KJB59298.1|  hypothetical protein B456_009G248300                    175   1e-47   Gossypium raimondii
ref|XP_008219598.1|  PREDICTED: cyclin-A1-1-like                        174   4e-47   Prunus mume [ume]
ref|XP_012078272.1|  PREDICTED: cyclin-A1-1                             173   8e-47   Jatropha curcas
gb|KHG05847.1|  Cyclin-A1-1 -like protein                               173   8e-47   Gossypium arboreum [tree cotton]
ref|NP_001237800.1|  mitotic cyclin a2-type                             173   1e-46   Glycine max [soybeans]
ref|XP_010530202.1|  PREDICTED: cyclin-A1-1                             172   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_009387253.1|  PREDICTED: cyclin-A1-4-like                        172   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009343979.1|  PREDICTED: cyclin-A1-1-like                        171   5e-46   Pyrus x bretschneideri [bai li]
ref|XP_008219599.1|  PREDICTED: cyclin-A1-4-like                        172   5e-46   Prunus mume [ume]
ref|XP_006472826.1|  PREDICTED: cyclin-A1-1-like                        171   1e-45   Citrus sinensis [apfelsine]
ref|XP_007225619.1|  hypothetical protein PRUPE_ppa004701mg             170   1e-45   Prunus persica
ref|XP_007223288.1|  hypothetical protein PRUPE_ppa005557mg             169   1e-45   
ref|XP_008806262.1|  PREDICTED: cyclin-A1-4 isoform X2                  168   2e-45   Phoenix dactylifera
ref|XP_003526649.1|  PREDICTED: cyclin-A1-1-like                        168   5e-45   Glycine max [soybeans]
ref|XP_010925928.1|  PREDICTED: cyclin-A1-4                             168   5e-45   Elaeis guineensis
gb|KDO80523.1|  hypothetical protein CISIN_1g017988mg                   166   5e-45   Citrus sinensis [apfelsine]
ref|XP_009341345.1|  PREDICTED: cyclin-A1-4-like                        169   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_008806186.1|  PREDICTED: cyclin-A1-4 isoform X1                  168   7e-45   Phoenix dactylifera
gb|AFK46051.1|  unknown                                                 168   1e-44   Lotus japonicus
ref|XP_007137455.1|  hypothetical protein PHAVU_009G128200g             167   2e-44   Phaseolus vulgaris [French bean]
ref|XP_010095430.1|  hypothetical protein L484_013387                   166   3e-44   Morus notabilis
gb|KJB80670.1|  hypothetical protein B456_013G109600                    164   4e-44   Gossypium raimondii
ref|XP_006434258.1|  hypothetical protein CICLE_v10000927mg             166   5e-44   Citrus clementina [clementine]
ref|XP_004149427.1|  PREDICTED: cyclin-A1-1                             166   5e-44   Cucumis sativus [cucumbers]
ref|XP_004290902.1|  PREDICTED: cyclin-A1-1                             166   6e-44   Fragaria vesca subsp. vesca
ref|XP_010915931.1|  PREDICTED: cyclin-A1-4-like isoform X1             166   7e-44   Elaeis guineensis
gb|KHG05394.1|  CYCA1-1: Cyclin-A1-1                                    159   7e-44   Gossypium arboreum [tree cotton]
ref|XP_009399851.1|  PREDICTED: cyclin-A1-4-like                        165   8e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008466750.1|  PREDICTED: cyclin-A1-1                             165   1e-43   Cucumis melo [Oriental melon]
gb|KEH35323.1|  carboxy-terminal domain cyclin                          165   1e-43   Medicago truncatula
gb|KJB80669.1|  hypothetical protein B456_013G109600                    165   1e-43   Gossypium raimondii
ref|XP_008783212.1|  PREDICTED: cyclin-A1-4-like                        165   2e-43   Phoenix dactylifera
ref|XP_010684698.1|  PREDICTED: cyclin-A1-4-like                        164   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009343978.1|  PREDICTED: cyclin-A1-1-like                        163   5e-43   Pyrus x bretschneideri [bai li]
emb|CBI18983.3|  unnamed protein product                                159   8e-43   Vitis vinifera
ref|XP_008338670.1|  PREDICTED: cyclin-A1-4                             162   1e-42   
ref|XP_010915932.1|  PREDICTED: cyclin-A1-4-like isoform X2             162   2e-42   
ref|XP_007019153.1|  Cyclin A1,1, putative                              161   2e-42   
ref|XP_010664179.1|  PREDICTED: cyclin-A1-1-like                        159   4e-42   
gb|KHG23907.1|  Cyclin-A1-1 -like protein                               160   6e-42   Gossypium arboreum [tree cotton]
ref|XP_009126172.1|  PREDICTED: cyclin-A1-1-like                        158   2e-41   Brassica rapa
dbj|BAC56853.1|  cyclin A1                                              158   3e-41   Silene latifolia
ref|XP_010260855.1|  PREDICTED: cyclin-A1-4                             158   4e-41   Nelumbo nucifera [Indian lotus]
gb|KJB64518.1|  hypothetical protein B456_010G052900                    158   4e-41   Gossypium raimondii
emb|CDX85466.1|  BnaA02g03470D                                          156   7e-41   
gb|KFK24211.1|  hypothetical protein AALP_AAs42301U000600               156   7e-41   Arabis alpina [alpine rockcress]
ref|XP_010532201.1|  PREDICTED: cyclin-A1-1-like isoform X2             156   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010532200.1|  PREDICTED: cyclin-A1-1-like isoform X1             156   2e-40   Tarenaya hassleriana [spider flower]
emb|CDY02719.1|  BnaC02g07160D                                          155   2e-40   
ref|XP_006393746.1|  hypothetical protein EUTSA_v10011442mg             154   7e-40   Eutrema salsugineum [saltwater cress]
ref|XP_006307397.1|  hypothetical protein CARUB_v10009020mg             154   8e-40   Capsella rubella
ref|NP_175077.1|  cyclin-A1-1                                           153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893979.1|  CYCA1_1                                            152   2e-39   Arabidopsis lyrata subsp. lyrata
gb|KHN05188.1|  Cyclin-A1-1                                             153   3e-39   Glycine soja [wild soybean]
ref|NP_001241939.1|  uncharacterized protein LOC100776207               152   4e-39   Glycine max [soybeans]
ref|XP_010095429.1|  hypothetical protein L484_013386                   152   4e-39   Morus notabilis
ref|XP_002455447.1|  hypothetical protein SORBIDRAFT_03g010940          152   5e-39   Sorghum bicolor [broomcorn]
gb|ADA70359.1|  mitotic cyclin A1-like protein                          151   8e-39   Persea americana
ref|XP_002457051.1|  hypothetical protein SORBIDRAFT_03g000520          151   1e-38   
ref|XP_004967382.1|  PREDICTED: cyclin-A1-1-like                        150   2e-38   Setaria italica
gb|EEC70247.1|  hypothetical protein OsI_01036                          145   2e-38   Oryza sativa Indica Group [Indian rice]
gb|KHN38997.1|  Cyclin-A1-1                                             150   4e-38   Glycine soja [wild soybean]
ref|XP_003545652.1|  PREDICTED: cyclin-A1-1-like                        149   6e-38   Glycine max [soybeans]
emb|CDY25649.1|  BnaC05g25280D                                          148   6e-38   Brassica napus [oilseed rape]
gb|ABG21984.1|  Cyclin, N-terminal domain containing protein, exp...    146   7e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010500134.1|  PREDICTED: cyclin-A1-1-like                        149   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010461434.1|  PREDICTED: cyclin-A1-1-like                        148   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004289008.1|  PREDICTED: cyclin-A1-1-like                        145   1e-37   Fragaria vesca subsp. vesca
ref|XP_006472825.1|  PREDICTED: cyclin-A1-1-like isoform X2             148   1e-37   Citrus sinensis [apfelsine]
ref|XP_006472824.1|  PREDICTED: cyclin-A1-1-like isoform X1             148   1e-37   
ref|XP_006859067.1|  PREDICTED: cyclin-A1-4                             148   2e-37   Amborella trichopoda
gb|EEC70248.1|  hypothetical protein OsI_01039                          147   2e-37   Oryza sativa Indica Group [Indian rice]
sp|Q0INT0.2|CCA13_ORYSJ  RecName: Full=Cyclin-A1-3; AltName: Full...    147   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454880.1|  hypothetical protein SORBIDRAFT_03g000690          147   3e-37   Sorghum bicolor [broomcorn]
ref|XP_008352624.1|  PREDICTED: cyclin-A1-1-like                        147   3e-37   
ref|XP_008656316.1|  PREDICTED: cyclin-A1-4-like                        140   8e-37   
ref|XP_009145051.1|  PREDICTED: cyclin-A1-1                             145   1e-36   Brassica rapa
ref|XP_003630475.1|  Cyclin A-like protein                              145   2e-36   
ref|NP_001042512.1|  Os01g0233500                                       144   3e-36   
gb|AAA51660.1|  cyclin                                                  143   5e-36   Brassica napus [oilseed rape]
ref|NP_001288521.1|  uncharacterized protein LOC103649996               144   7e-36   Zea mays [maize]
dbj|BAJ94732.1|  predicted protein                                      144   7e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIL50247.1|  Ttam-3D                                                 143   7e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AIL50245.1|  Ttam-3A                                                 143   8e-36   Triticum turgidum [cone wheat]
ref|XP_006643958.1|  PREDICTED: cyclin-A1-1-like                        143   9e-36   
ref|XP_006645684.1|  PREDICTED: cyclin-A1-1-like                        142   2e-35   
emb|CDM82517.1|  unnamed protein product                                142   2e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007019154.1|  Cyclin A1,1, putative isoform 1                    140   3e-35   
ref|XP_010521286.1|  PREDICTED: cyclin-A1-2 isoform X2                  141   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_004292715.1|  PREDICTED: cyclin-A1-4-like                        141   4e-35   Fragaria vesca subsp. vesca
ref|XP_006654172.1|  PREDICTED: cyclin-A1-4-like                        139   5e-35   Oryza brachyantha
ref|XP_004960667.1|  PREDICTED: cyclin-A1-3-like                        140   6e-35   Setaria italica
ref|NP_001054990.1|  Os05g0237100                                       134   1e-34   
gb|AAA20237.1|  cyclin IIZm                                             139   2e-34   Zea mays [maize]
gb|EEC78817.1|  hypothetical protein OsI_19095                          134   3e-34   Oryza sativa Indica Group [Indian rice]
gb|ACF80031.1|  unknown                                                 137   9e-34   Zea mays [maize]
dbj|BAD81374.1|  putative type A-like cyclin                            137   9e-34   Oryza sativa Japonica Group [Japonica rice]
gb|ACR33952.1|  unknown                                                 137   9e-34   Zea mays [maize]
sp|Q0JPA4.2|CCA12_ORYSJ  RecName: Full=Cyclin-A1-2; AltName: Full...    137   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007161469.1|  hypothetical protein PHAVU_001G071600g             137   1e-33   Phaseolus vulgaris [French bean]
ref|NP_001176910.1|  Os12g0298950                                       135   1e-33   
gb|AAN87004.1|  cyclin A                                                131   2e-33   Populus alba [abele]
ref|NP_001105387.1|  cyclin2                                            135   4e-33   
sp|Q0DJR9.2|CCA14_ORYSJ  RecName: Full=Cyclin-A1-4; AltName: Full...    133   6e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566404.1|  PREDICTED: cyclin-A1-4-like                        134   1e-32   Brachypodium distachyon [annual false brome]
gb|EEE62924.1|  hypothetical protein OsJ_17729                          133   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006390095.1|  hypothetical protein EUTSA_v10018521mg             132   4e-32   Eutrema salsugineum [saltwater cress]
ref|XP_003566077.1|  PREDICTED: cyclin-A1-1-like                        132   4e-32   Brachypodium distachyon [annual false brome]
gb|EMS46237.1|  Cyclin-A1-1                                             132   4e-32   Triticum urartu
ref|NP_177863.2|  cyclin-A1-2                                           131   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502519.1|  PREDICTED: cyclin-A1-1-like                        131   1e-31   
gb|KEH35322.1|  carboxy-terminal domain cyclin                          130   2e-31   Medicago truncatula
ref|XP_002889141.1|  CYCA1_2                                            129   4e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_003566081.1|  PREDICTED: cyclin-A1-1-like                        129   5e-31   Brachypodium distachyon [annual false brome]
ref|XP_009106401.1|  PREDICTED: cyclin-A1-2                             128   9e-31   Brassica rapa
emb|CDX87520.1|  BnaA07g33530D                                          128   1e-30   
ref|XP_008653791.1|  PREDICTED: cyclin-A1-1-like                        120   2e-30   
ref|XP_010521285.1|  PREDICTED: cyclin-A1-2 isoform X1                  127   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_006302208.1|  hypothetical protein CARUB_v10020219mg             127   3e-30   
ref|XP_010428818.1|  PREDICTED: cyclin-A1-2-like                        125   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004962645.1|  PREDICTED: cyclin-A1-1-like isoform X1             126   8e-30   Setaria italica
ref|XP_004962646.1|  PREDICTED: cyclin-A1-1-like isoform X2             126   8e-30   
ref|XP_010429845.1|  PREDICTED: cyclin-A1-2-like                        125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010471932.1|  PREDICTED: cyclin-A1-2-like                        125   2e-29   Camelina sativa [gold-of-pleasure]
gb|KFK38207.1|  hypothetical protein AALP_AA3G082800                    124   3e-29   Arabis alpina [alpine rockcress]
ref|XP_010416680.1|  PREDICTED: cyclin-A1-2-like                        124   3e-29   Camelina sativa [gold-of-pleasure]
emb|CDX88368.1|  BnaC06g38120D                                          123   3e-29   
ref|XP_006434257.1|  hypothetical protein CICLE_v10003984mg             124   5e-29   
gb|KFK42133.1|  hypothetical protein AALP_AA2G215400                    123   7e-29   Arabis alpina [alpine rockcress]
gb|KDO80524.1|  hypothetical protein CISIN_1g043577mg                   122   1e-28   Citrus sinensis [apfelsine]
ref|XP_011629119.1|  PREDICTED: cyclin-A3-1                             122   1e-28   Amborella trichopoda
gb|ERM96686.1|  hypothetical protein AMTR_s00001p00272790               119   7e-28   Amborella trichopoda
ref|XP_001778367.1|  predicted protein                                  117   1e-27   
ref|XP_001766438.1|  predicted protein                                  117   2e-27   
ref|XP_001786071.1|  predicted protein                                  116   5e-27   
ref|XP_010277154.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...    117   6e-27   Nelumbo nucifera [Indian lotus]
ref|XP_002972287.1|  hypothetical protein SELMODRAFT_412894             117   7e-27   Selaginella moellendorffii
dbj|BAA11560.1|  cyclin                                                 116   3e-26   Adiantum capillus-veneris [maidenhair fern]
ref|XP_010271477.1|  PREDICTED: putative cyclin-A3-1 isoform X1         115   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_007019146.1|  Cyclin A1,1, putative                              110   3e-26   
ref|XP_002984199.1|  hypothetical protein SELMODRAFT_423455             114   5e-26   Selaginella moellendorffii
ref|XP_001764427.1|  predicted protein                                  111   2e-25   
ref|XP_001772176.1|  predicted protein                                  112   2e-25   
dbj|BAA20410.1|  A-type cyclin                                          111   6e-25   Catharanthus roseus [chatas]
ref|XP_010271484.1|  PREDICTED: putative cyclin-A3-1 isoform X2         111   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_001764550.1|  predicted protein                                  108   9e-25   
ref|XP_010688280.1|  PREDICTED: putative cyclin-A3-1                    110   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006374858.1|  cyclin A3.1 family protein                         109   3e-24   Populus trichocarpa [western balsam poplar]
gb|EEE54182.1|  hypothetical protein OsJ_01005                          110   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011029106.1|  PREDICTED: putative cyclin-A3-1                    109   4e-24   Populus euphratica
ref|XP_001766360.1|  predicted protein                                  109   9e-24   
ref|XP_007019155.1|  Cyclin A1,1, putative isoform 2                    108   9e-24   
ref|XP_008452613.1|  PREDICTED: putative cyclin-A3-1                    106   4e-23   
ref|XP_004141395.1|  PREDICTED: putative cyclin-A3-1                    106   5e-23   Cucumis sativus [cucumbers]
ref|XP_010936556.1|  PREDICTED: cyclin-A3-1-like                        106   5e-23   Elaeis guineensis
gb|KGN55246.1|  hypothetical protein Csa_4G642270                       105   5e-23   Cucumis sativus [cucumbers]
ref|XP_008787130.1|  PREDICTED: cyclin-A3-1-like                        105   6e-23   Phoenix dactylifera
ref|XP_010059872.1|  PREDICTED: putative cyclin-A3-1                    105   7e-23   Eucalyptus grandis [rose gum]
ref|XP_002974260.1|  hypothetical protein SELMODRAFT_442428             104   2e-22   Selaginella moellendorffii
ref|XP_002985630.1|  hypothetical protein SELMODRAFT_234858             104   2e-22   Selaginella moellendorffii
ref|XP_002285074.2|  PREDICTED: putative cyclin-A3-1                    104   2e-22   Vitis vinifera
ref|XP_010906637.1|  PREDICTED: cyclin-A3-1-like                        104   2e-22   Elaeis guineensis
gb|KFK44637.1|  hypothetical protein AALP_AA1G284800                    103   3e-22   Arabis alpina [alpine rockcress]
gb|KFK44638.1|  hypothetical protein AALP_AA1G284800                    103   3e-22   Arabis alpina [alpine rockcress]
dbj|BAK05525.1|  predicted protein                                      103   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003630468.1|  Cyclin A                                           105   5e-22   
emb|CAC27333.1|  putative A-like cyclin                                 103   5e-22   Picea abies
ref|XP_010442082.1|  PREDICTED: putative cyclin-A3-1                    102   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008455012.1|  PREDICTED: cyclin-A3-1-like isoform X2             102   7e-22   Cucumis melo [Oriental melon]
ref|XP_008455011.1|  PREDICTED: cyclin-A3-1-like isoform X1             102   7e-22   Cucumis melo [Oriental melon]
emb|CDP01248.1|  unnamed protein product                                102   7e-22   Coffea canephora [robusta coffee]
ref|XP_011017147.1|  PREDICTED: putative cyclin-A3-1                    102   7e-22   Populus euphratica
ref|XP_004290941.1|  PREDICTED: putative cyclin-A3-1                    102   8e-22   Fragaria vesca subsp. vesca
ref|XP_007018576.1|  Cyclin A3,1                                        102   8e-22   
gb|EPS73971.1|  hypothetical protein M569_00786                         102   9e-22   Genlisea aurea
ref|XP_010494276.1|  PREDICTED: putative cyclin-A3-1 isoform X2         102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011015741.1|  PREDICTED: putative cyclin-A3-1                    102   1e-21   Populus euphratica
ref|XP_002301157.1|  cyclin A3.1 family protein                         102   1e-21   
ref|XP_011069760.1|  PREDICTED: putative cyclin-A3-1                    102   1e-21   Sesamum indicum [beniseed]
ref|XP_002466828.1|  hypothetical protein SORBIDRAFT_01g014850          102   1e-21   Sorghum bicolor [broomcorn]
ref|XP_003550316.1|  PREDICTED: putative cyclin-A3-1-like isoform X1    102   1e-21   Glycine max [soybeans]
ref|XP_006280684.1|  hypothetical protein CARUB_v10026648mg             102   1e-21   Capsella rubella
ref|XP_002510134.1|  cyclin A, putative                                 102   1e-21   Ricinus communis
ref|XP_006433587.1|  hypothetical protein CICLE_v10001544mg             102   1e-21   Citrus clementina [clementine]
ref|XP_008780924.1|  PREDICTED: cyclin-A3-1-like                        102   1e-21   Phoenix dactylifera
gb|KHN21404.1|  Cyclin-A3-4                                             100   2e-21   Glycine soja [wild soybean]
ref|NP_001233768.1|  cyclin A2                                          102   2e-21   
gb|AEX07598.1|  cyclin A3-1                                             100   2e-21   Brassica juncea [brown mustard]
ref|XP_002865455.1|  CYCA3_1                                            100   2e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_010322316.1|  PREDICTED: cyclin A2 isoform X1                    102   3e-21   Solanum lycopersicum
gb|KHG09323.1|  Cyclin-A3-2 -like protein                               100   3e-21   Gossypium arboreum [tree cotton]
emb|CDY22369.1|  BnaA06g36910D                                          100   3e-21   Brassica napus [oilseed rape]
ref|NP_001146465.1|  cyclin superfamily protein, putative               100   4e-21   Zea mays [maize]
gb|KJB58584.1|  hypothetical protein B456_009G216800                    100   4e-21   Gossypium raimondii
gb|EEE54185.1|  hypothetical protein OsJ_01008                          101   4e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009101815.1|  PREDICTED: putative cyclin-A3-1                    100   4e-21   Brassica rapa
ref|XP_006601271.1|  PREDICTED: putative cyclin-A3-1-like isoform X2    100   4e-21   Glycine max [soybeans]
ref|XP_003544479.1|  PREDICTED: putative cyclin-A3-1-like isoform X1    100   5e-21   Glycine max [soybeans]
ref|XP_012068270.1|  PREDICTED: putative cyclin-A3-1                    100   5e-21   Jatropha curcas
ref|XP_004963009.1|  PREDICTED: cyclin-A3-2-like isoform X1             100   6e-21   
emb|CAA83460.1|  cyclin 3a                                              100   6e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAT73638.1|  unknown protein, contains cyclins regulate cyclin...    100   6e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160890.1|  hypothetical protein PHAVU_001G025600g           99.8    6e-21   Phaseolus vulgaris [French bean]
ref|NP_001042509.2|  Os01g0233100                                       102   7e-21   
ref|NP_199122.1|  cyclin A3-1                                         99.8    7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008674080.1|  PREDICTED: cyclin-A3-2-like                        100   7e-21   
gb|KJB53898.1|  hypothetical protein B456_009G011300                    100   7e-21   Gossypium raimondii
ref|XP_008367648.1|  PREDICTED: putative cyclin-A3-1 isoform X1       99.8    7e-21   
ref|XP_008367649.1|  PREDICTED: putative cyclin-A3-1 isoform X2       99.8    7e-21   
ref|XP_002972285.1|  hypothetical protein SELMODRAFT_412891             100   8e-21   Selaginella moellendorffii
ref|XP_010540385.1|  PREDICTED: putative cyclin-A3-1 isoform X2       99.8    9e-21   Tarenaya hassleriana [spider flower]
tpg|DAA54692.1|  TPA: cyclin superfamily protein, putative              100   9e-21   
ref|XP_011100040.1|  PREDICTED: putative cyclin-A3-1                  99.8    9e-21   Sesamum indicum [beniseed]
ref|XP_010540384.1|  PREDICTED: putative cyclin-A3-1 isoform X1       99.4    9e-21   Tarenaya hassleriana [spider flower]
ref|XP_009404125.1|  PREDICTED: cyclin-A3-1-like                      99.4    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004290942.1|  PREDICTED: cyclin-A3-2-like                      99.4    1e-20   Fragaria vesca subsp. vesca
gb|KJB53897.1|  hypothetical protein B456_009G011300                    100   1e-20   Gossypium raimondii
gb|KJB35078.1|  hypothetical protein B456_006G100200                    100   1e-20   Gossypium raimondii
ref|XP_009794344.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  99.0    1e-20   Nicotiana sylvestris
ref|XP_006287744.1|  hypothetical protein CARUB_v10000955mg           99.8    1e-20   Capsella rubella
emb|CDY62408.1|  BnaCnng40230D                                        97.1    1e-20   Brassica napus [oilseed rape]
ref|XP_006472254.1|  PREDICTED: cyclin-A3-4-like                      99.0    2e-20   Citrus sinensis [apfelsine]
ref|XP_010539515.1|  PREDICTED: cyclin-A2-4-like                      99.8    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_007227627.1|  hypothetical protein PRUPE_ppa024921mg           98.6    2e-20   Prunus persica
ref|XP_006403300.1|  hypothetical protein EUTSA_v10003238mg           98.6    2e-20   Eutrema salsugineum [saltwater cress]
gb|KJB63916.1|  hypothetical protein B456_010G024100                  98.6    2e-20   Gossypium raimondii
ref|XP_007013748.1|  Mitotic-like cyclin 3B from                      99.8    2e-20   
ref|XP_011627009.1|  PREDICTED: cyclin-A2-4                           99.8    3e-20   
ref|XP_006305073.1|  hypothetical protein CARUB_v10009441mg           97.8    3e-20   Capsella rubella
ref|XP_004499016.1|  PREDICTED: putative cyclin-A3-1-like isoform X1  97.8    4e-20   Cicer arietinum [garbanzo]
ref|XP_010494275.1|  PREDICTED: putative cyclin-A3-1 isoform X1       97.8    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009603340.1|  PREDICTED: putative cyclin-A3-1                  97.4    4e-20   Nicotiana tomentosiformis
ref|XP_004486710.1|  PREDICTED: cyclin-A2-4-like isoform X1           98.2    4e-20   Cicer arietinum [garbanzo]
gb|KHF99283.1|  Cyclin-A3-2 -like protein                             97.4    4e-20   Gossypium arboreum [tree cotton]
ref|XP_002891340.1|  CYCA3_4                                          97.4    4e-20   
ref|XP_004486712.1|  PREDICTED: cyclin-A2-4-like isoform X3           98.2    4e-20   Cicer arietinum [garbanzo]
gb|AFK37644.1|  unknown                                               98.6    5e-20   Lotus japonicus
ref|XP_004238117.1|  PREDICTED: putative cyclin-A3-1                  97.4    5e-20   Solanum lycopersicum
ref|XP_006476192.1|  PREDICTED: cyclin-A2-1-like                      98.6    5e-20   Citrus sinensis [apfelsine]
emb|CDX79389.1|  BnaC06g19140D                                        97.8    5e-20   
ref|XP_003578446.1|  PREDICTED: cyclin-A3-2-like                      97.4    5e-20   Brachypodium distachyon [annual false brome]
ref|XP_009351160.1|  PREDICTED: cyclin-A3-1-like                      97.1    6e-20   
ref|XP_011658884.1|  PREDICTED: putative cyclin-A3-1 isoform X1       97.1    6e-20   Cucumis sativus [cucumbers]
ref|XP_004137091.1|  PREDICTED: putative cyclin-A3-1 isoform X2       97.1    7e-20   Cucumis sativus [cucumbers]
ref|XP_010500242.1|  PREDICTED: cyclin-A3-4 isoform X1                97.1    7e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010500243.1|  PREDICTED: cyclin-A3-4 isoform X2                97.1    7e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009360192.1|  PREDICTED: putative cyclin-A3-1                  96.7    7e-20   Pyrus x bretschneideri [bai li]
ref|NP_175156.1|  cyclin-A3-4                                         96.7    7e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111667.1|  PREDICTED: cyclin-A2-1                           97.4    7e-20   Brassica rapa
ref|XP_008367786.1|  PREDICTED: putative cyclin-A3-1                  93.2    8e-20   
ref|XP_011087041.1|  PREDICTED: cyclin-A2-2-like                      98.2    8e-20   Sesamum indicum [beniseed]
emb|CBI20929.3|  unnamed protein product                              97.1    8e-20   Vitis vinifera
ref|NP_973983.1|  cyclin-A3-4                                         96.7    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479122.1|  PREDICTED: cyclin-A3-4-like isoform X2           96.7    8e-20   
ref|XP_010061706.1|  PREDICTED: putative cyclin-A3-1 isoform X1       96.7    8e-20   
ref|XP_006362078.1|  PREDICTED: cyclin-A3-2-like                      96.7    8e-20   
ref|XP_010419687.1|  PREDICTED: cyclin-A2-2-like                      97.4    9e-20   
ref|XP_010479121.1|  PREDICTED: cyclin-A3-4-like isoform X1           96.7    9e-20   
ref|NP_197920.2|  cyclin a2;1                                         97.4    9e-20   
ref|XP_010549256.1|  PREDICTED: putative cyclin-A3-1 isoform X1       96.7    1e-19   
emb|CAB77269.1|  cyclin A3.1                                          96.3    1e-19   
ref|XP_010549257.1|  PREDICTED: putative cyclin-A3-1 isoform X2       96.3    1e-19   
ref|XP_006578041.1|  PREDICTED: putative cyclin-A3-1-like             96.3    1e-19   
ref|XP_002442399.1|  hypothetical protein SORBIDRAFT_08g019410        97.1    1e-19   
sp|Q39071.3|CCA21_ARATH  RecName: Full=Cyclin-A2-1; AltName: Full...  97.1    1e-19   
gb|AAC98445.1|  cyclin 3a                                             97.1    1e-19   
ref|XP_002874258.1|  CYCA2_1                                          97.1    1e-19   
ref|XP_006353656.1|  PREDICTED: cyclin-A2-1-like                      97.4    1e-19   
ref|XP_010932850.1|  PREDICTED: cyclin-A2-1-like                      97.4    1e-19   
ref|XP_010109038.1|  hypothetical protein L484_007372                 97.1    1e-19   
ref|XP_008377992.1|  PREDICTED: cyclin-A3-2-like                      95.9    1e-19   
gb|AFK65510.1|  cyclin A                                              95.9    1e-19   
ref|XP_010454867.1|  PREDICTED: cyclin-A2-1-like                      96.7    1e-19   
ref|XP_010254232.1|  PREDICTED: cyclin-A2-4-like                      97.4    2e-19   
ref|XP_008220286.1|  PREDICTED: putative cyclin-A3-1                  95.9    2e-19   
ref|XP_006486965.1|  PREDICTED: putative cyclin-A3-1-like             95.9    2e-19   
emb|CDO97240.1|  unnamed protein product                              95.9    2e-19   
ref|XP_010461520.1|  PREDICTED: cyclin-A3-4-like isoform X2           95.9    2e-19   
ref|XP_010461519.1|  PREDICTED: cyclin-A3-4-like isoform X1           95.9    2e-19   
emb|CDX67944.1|  BnaA07g19840D                                        96.3    2e-19   
ref|XP_010917639.1|  PREDICTED: cyclin-A2-1-like                      97.1    2e-19   
gb|KHN04461.1|  Putative cyclin-A3-1                                  95.5    2e-19   
ref|XP_007160891.1|  hypothetical protein PHAVU_001G025700g           95.5    2e-19   
gb|KGN43871.1|  hypothetical protein Csa_7G071600                     96.3    2e-19   
ref|XP_010648552.1|  PREDICTED: cyclin-A2-2-like                      96.7    2e-19   
ref|XP_006342652.1|  PREDICTED: putative cyclin-A3-1-like             95.1    2e-19   
emb|CDY19803.1|  BnaA09g04560D                                        98.2    2e-19   
ref|XP_009354145.1|  PREDICTED: putative cyclin-A3-1 isoform X2       95.1    2e-19   
emb|CDY38664.1|  BnaC02g23150D                                        96.3    2e-19   
ref|XP_009104457.1|  PREDICTED: cyclin-A2-4-like                      95.9    3e-19   
gb|AES68059.2|  carboxy-terminal domain cyclin                        95.9    3e-19   
ref|NP_568248.2|  cyclin-A2-2                                         95.9    3e-19   
ref|XP_009346867.1|  PREDICTED: cyclin-A3-1-like isoform X1           95.1    3e-19   
ref|XP_006393612.1|  hypothetical protein EUTSA_v10011575mg           95.1    3e-19   
ref|XP_010061967.1|  PREDICTED: cyclin-A2-3 isoform X1                96.3    3e-19   
ref|XP_006393613.1|  hypothetical protein EUTSA_v10011575mg           95.1    3e-19   
ref|XP_010491850.1|  PREDICTED: cyclin-A2-2                           95.9    3e-19   
ref|XP_006422880.1|  hypothetical protein CICLE_v10028641mg           95.1    3e-19   
ref|XP_010061968.1|  PREDICTED: cyclin-A2-3 isoform X2                96.3    3e-19   
gb|KCW69015.1|  hypothetical protein EUGRSUZ_F02573                   96.3    3e-19   
ref|XP_010556425.1|  PREDICTED: putative cyclin-A3-1                  95.1    3e-19   
gb|ERN15619.1|  hypothetical protein AMTR_s00048p00184670             96.7    3e-19   
ref|XP_006469769.1|  PREDICTED: cyclin-A2-3-like                      94.4    4e-19   
ref|XP_006287786.1|  hypothetical protein CARUB_v10000996mg           95.5    4e-19   
ref|XP_006450559.1|  hypothetical protein CICLE_v10008128mg           95.9    4e-19   
emb|CDY06752.1|  BnaA10g05310D                                        94.0    4e-19   
ref|XP_001772175.1|  predicted protein                                94.0    4e-19   
ref|XP_008347610.1|  PREDICTED: putative cyclin-A3-1 isoform X2       94.4    4e-19   
ref|XP_004982444.1|  PREDICTED: cyclin-A3-1-like                      94.7    5e-19   
ref|XP_008680494.1|  PREDICTED: cyclin-A1-2-like                      90.5    5e-19   
ref|XP_008360979.1|  PREDICTED: putative cyclin-A3-1                  94.4    5e-19   
gb|AAA90946.1|  cyclin 3c                                             93.2    5e-19   
ref|XP_009627918.1|  PREDICTED: putative cyclin-A3-1                  94.4    5e-19   
ref|XP_009123514.1|  PREDICTED: cyclin-A3-4-like isoform X1           94.4    5e-19   
emb|CDX97090.1|  BnaC09g45350D                                        95.1    5e-19   
ref|XP_009123515.1|  PREDICTED: cyclin-A3-4-like isoform X2           94.4    5e-19   
ref|XP_010421392.1|  PREDICTED: cyclin-A2-1                           95.1    5e-19   
ref|XP_010453174.1|  PREDICTED: cyclin-A2-2-like                      95.1    5e-19   
ref|XP_008804857.1|  PREDICTED: cyclin-A2-1-like                      95.5    6e-19   
ref|NP_001288902.1|  cyclin-A3-4-like                                 94.4    6e-19   
ref|XP_008373079.1|  PREDICTED: cyclin-A3-1-like isoform X1           94.0    6e-19   
ref|XP_012078626.1|  PREDICTED: cyclin-A2-2-like                      95.5    6e-19   
ref|XP_009124588.1|  PREDICTED: cyclin-A3-4-like isoform X2           94.4    6e-19   
gb|EYU36354.1|  hypothetical protein MIMGU_mgv1a008278mg              94.4    6e-19   
ref|XP_009124590.1|  PREDICTED: cyclin-A3-4-like isoform X4           94.4    6e-19   
ref|XP_010049038.1|  PREDICTED: cyclin-A2-1-like isoform X4           95.5    6e-19   
ref|XP_001772222.1|  predicted protein                                93.2    6e-19   
ref|XP_009354143.1|  PREDICTED: putative cyclin-A3-1                  94.0    7e-19   
ref|XP_009124587.1|  PREDICTED: cyclin-A3-4-like isoform X1           94.4    7e-19   
ref|NP_001147088.1|  cyclin-A2                                        95.5    7e-19   
ref|XP_010049037.1|  PREDICTED: cyclin-A2-1-like isoform X3           95.5    7e-19   
ref|XP_002873505.1|  hypothetical protein ARALYDRAFT_350326           94.7    7e-19   
ref|XP_003589118.1|  Cyclin-A3-4                                      94.4    7e-19   
ref|XP_010049034.1|  PREDICTED: cyclin-A2-1-like isoform X1           95.5    8e-19   
ref|XP_010049036.1|  PREDICTED: cyclin-A2-1-like isoform X2           95.1    9e-19   
ref|XP_007135712.1|  hypothetical protein PHAVU_010G151900g           95.1    9e-19   
gb|ACG42494.1|  cyclin-A2                                             94.7    1e-18   
gb|AES59369.2|  carboxy-terminal domain cyclin                        93.2    1e-18   
ref|XP_003597807.1|  Cyclin A2                                        92.0    1e-18   
ref|XP_009128429.1|  PREDICTED: cyclin-A2-4-like                      94.4    1e-18   
ref|XP_008643574.1|  PREDICTED: cyclin-A2 isoform X1                  94.7    1e-18   
emb|CAA83277.1|  cyclin 3b                                            94.0    1e-18   
ref|XP_004501282.1|  PREDICTED: cyclin-A2-1-like isoform X1           94.7    1e-18   
ref|XP_006416893.1|  hypothetical protein EUTSA_v10007623mg           94.4    1e-18   
ref|XP_006342651.1|  PREDICTED: putative cyclin-A3-1-like             93.2    1e-18   
emb|CDY17091.1|  BnaC06g00240D                                        92.8    1e-18   
ref|XP_008444589.1|  PREDICTED: cyclin-A3-2-like                      93.2    1e-18   
gb|KHG05835.1|  Cyclin-A2-2 -like protein                             93.2    1e-18   
ref|XP_007042567.1|  Cyclin A, putative                               93.2    1e-18   
ref|XP_010520744.1|  PREDICTED: putative cyclin-A3-1 isoform X2       93.2    2e-18   
ref|XP_008220357.1|  PREDICTED: putative cyclin-A3-1                  92.8    2e-18   
ref|XP_010654713.1|  PREDICTED: cyclin-A2-4 isoform X2                94.4    2e-18   
ref|XP_002280592.1|  PREDICTED: cyclin-A2-3 isoform X1                94.4    2e-18   
ref|NP_001147065.1|  cyclin-A2                                        93.6    2e-18   
ref|XP_006399631.1|  hypothetical protein EUTSA_v10013593mg           93.6    2e-18   
ref|XP_010537945.1|  PREDICTED: cyclin-A2-4-like isoform X1           94.0    2e-18   
ref|XP_006577871.1|  PREDICTED: mitotic cyclin a2-type isoform X1     94.4    2e-18   
emb|CDY41784.1|  BnaC02g13720D                                        92.4    2e-18   
emb|CDY47595.1|  BnaC08g04650D                                        92.8    2e-18   
emb|CDX69768.1|  BnaA10g21170D                                        93.6    2e-18   
ref|XP_004292743.1|  PREDICTED: cyclin-A3-2-like                      92.4    2e-18   
ref|XP_006596120.1|  PREDICTED: cyclin-A2-2-like isoform X1           93.6    2e-18   
ref|XP_009758618.1|  PREDICTED: cyclin-A2-2-like isoform X2           94.0    2e-18   
dbj|BAA09367.1|  A-type cyclin                                        94.0    2e-18   
ref|XP_010532135.1|  PREDICTED: cyclin-A2-4-like isoform X1           94.0    2e-18   
ref|XP_006465433.1|  PREDICTED: cyclin-A2-4-like                      94.0    2e-18   
ref|XP_009595773.1|  PREDICTED: cyclin-A2-2-like isoform X1           94.0    2e-18   
ref|XP_010532139.1|  PREDICTED: cyclin-A2-4-like isoform X2           93.6    2e-18   
ref|XP_006427108.1|  hypothetical protein CICLE_v10025498mg           93.6    3e-18   
ref|XP_003526434.1|  PREDICTED: cyclin-A2-2-like                      93.6    3e-18   
ref|XP_003636827.1|  Cyclin A-like protein                            91.7    3e-18   
ref|XP_010249891.1|  PREDICTED: cyclin-A2-4-like                      93.6    3e-18   
ref|XP_009758609.1|  PREDICTED: cyclin-A2-2-like isoform X1           94.0    3e-18   
ref|XP_004142880.1|  PREDICTED: putative cyclin-A3-1                  92.0    3e-18   
emb|CDY17037.1|  BnaA08g04010D                                        92.0    3e-18   
emb|CDY37592.1|  BnaA02g19780D                                        93.2    3e-18   
ref|XP_004252748.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  92.0    3e-18   
gb|AAG29191.1|AC078898_1  mitotic cyclin a2-type, putative            93.2    3e-18   
emb|CDY66770.1|  BnaCnng52280D                                        92.0    3e-18   
ref|XP_010061704.1|  PREDICTED: putative cyclin-A3-1 isoform X1       92.0    3e-18   
ref|XP_010061705.1|  PREDICTED: putative cyclin-A3-1 isoform X2       92.0    4e-18   
ref|XP_006307500.1|  hypothetical protein CARUB_v10009125mg           92.8    4e-18   
ref|XP_010417716.1|  PREDICTED: cyclin-A2-4                           93.2    4e-18   
ref|XP_009770807.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  92.0    4e-18   
ref|XP_009121968.1|  PREDICTED: cyclin-A2-2                           92.8    4e-18   
ref|XP_010497247.1|  PREDICTED: cyclin-A2-3 isoform X1                92.8    4e-18   
ref|XP_006583135.1|  PREDICTED: cyclin-A2-4-like                      92.8    4e-18   
ref|XP_004499017.1|  PREDICTED: putative cyclin-A3-1-like isoform X2  91.7    4e-18   
ref|NP_001237783.1|  mitotic cyclin a2-type                           92.8    5e-18   
ref|XP_010497255.1|  PREDICTED: cyclin-A2-3 isoform X2                92.8    5e-18   
gb|EEC69327.1|  hypothetical protein OsI_38429                        92.8    5e-18   
gb|KHG12484.1|  CYCA2-4: Cyclin-A2-4                                  93.2    5e-18   
gb|KHG12485.1|  CYCA2-4: Cyclin-A2-4                                  92.8    5e-18   
ref|XP_006393614.1|  hypothetical protein EUTSA_v10011590mg           91.7    5e-18   
ref|NP_173010.1|  cyclin-A2-3                                         92.4    5e-18   
gb|KCW81497.1|  hypothetical protein EUGRSUZ_C02858                   92.8    5e-18   
ref|NP_001066828.1|  Os12g0502300                                     92.8    5e-18   
ref|XP_006342653.1|  PREDICTED: cyclin-A3-2-like                      91.3    5e-18   
gb|KJB70503.1|  hypothetical protein B456_011G078400                  92.8    6e-18   
ref|XP_002984197.1|  hypothetical protein SELMODRAFT_423452           92.4    6e-18   
ref|XP_008794066.1|  PREDICTED: cyclin-A2-1-like isoform X3           92.8    6e-18   
ref|XP_008673556.1|  PREDICTED: cyclin-A2 isoform X1                  92.0    6e-18   
ref|XP_010110307.1|  hypothetical protein L484_019461                 92.4    7e-18   
ref|XP_009354144.1|  PREDICTED: putative cyclin-A3-1 isoform X1       90.9    7e-18   
gb|EEE53262.1|  hypothetical protein OsJ_36196                        92.8    7e-18   
ref|XP_006305132.1|  hypothetical protein CARUB_v10009501mg           91.3    7e-18   
ref|XP_007224323.1|  hypothetical protein PRUPE_ppa020376mg           90.9    7e-18   
ref|XP_011019732.1|  PREDICTED: cyclin-A2-2                           92.4    7e-18   
emb|CDY06757.1|  BnaA10g05360D                                        90.9    7e-18   
ref|XP_009619323.1|  PREDICTED: cyclin-A2-2-like                      92.4    8e-18   
ref|XP_006585603.1|  PREDICTED: cyclin-A2-4-like isoform X1           92.0    8e-18   
gb|KFK31753.1|  hypothetical protein AALP_AA6G154900                  90.5    9e-18   
emb|CDX87305.1|  BnaA07g35680D                                        92.0    9e-18   
gb|AEV43293.1|  cyclin A2                                             89.4    9e-18   
ref|XP_009798808.1|  PREDICTED: cyclin-A2-2-like                      92.0    9e-18   
ref|XP_010670757.1|  PREDICTED: cyclin-A2-2 isoform X1                92.0    9e-18   
ref|XP_010670758.1|  PREDICTED: cyclin-A2-2 isoform X2                92.0    9e-18   
ref|XP_006379173.1|  hypothetical protein POPTR_0009s09610g           89.0    1e-17   
ref|XP_010476648.1|  PREDICTED: cyclin-A2-3-like                      91.7    1e-17   
ref|XP_010493797.1|  PREDICTED: cyclin-A2-1-like                      91.3    1e-17   
ref|XP_004136337.1|  PREDICTED: cyclin-A2-2 isoform X1                91.7    1e-17   
ref|XP_002891338.1|  CYCA3_3                                          90.1    1e-17   
ref|XP_010647951.1|  PREDICTED: cyclin-A3-4-like                      90.1    1e-17   
gb|KFK31754.1|  hypothetical protein AALP_AA6G154900                  90.5    1e-17   
ref|XP_009600841.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  90.5    1e-17   
ref|XP_011074386.1|  PREDICTED: putative cyclin-A3-1                  90.5    1e-17   
ref|XP_008347609.1|  PREDICTED: putative cyclin-A3-1 isoform X1       90.1    1e-17   
ref|XP_009777214.1|  PREDICTED: putative cyclin-A3-1                  90.1    1e-17   
ref|XP_004292087.1|  PREDICTED: putative cyclin-A3-1                  90.1    1e-17   
ref|XP_009402480.1|  PREDICTED: cyclin-A2-1-like isoform X2           91.7    1e-17   
ref|XP_012073286.1|  PREDICTED: cyclin-A2-3-like isoform X2           90.5    2e-17   
ref|XP_009402464.1|  PREDICTED: cyclin-A2-1-like isoform X1           91.7    2e-17   
ref|XP_004252747.1|  PREDICTED: putative cyclin-A3-1                  90.1    2e-17   
ref|XP_004501541.1|  PREDICTED: putative cyclin-A3-1-like isoform X1  89.7    2e-17   
ref|XP_009791870.1|  PREDICTED: cyclin-A2-1 isoform X3                89.7    2e-17   
ref|NP_564499.3|  cyclin-dependent protein kinase 3;2                 90.1    2e-17   
ref|XP_004501542.1|  PREDICTED: putative cyclin-A3-1-like isoform X2  89.7    2e-17   
ref|XP_009393060.1|  PREDICTED: cyclin-A2-1-like                      91.7    2e-17   
ref|XP_002891337.1|  CYCA3_2                                          89.7    2e-17   
gb|EYU22092.1|  hypothetical protein MIMGU_mgv1a022268mg              89.4    2e-17   
ref|NP_178153.1|  cyclin-A2-4                                         90.9    2e-17   
emb|CAB96665.1|  cyclin 3b                                            90.5    2e-17   
ref|XP_011081890.1|  PREDICTED: cyclin-A2-2-like isoform X3           89.0    2e-17   
ref|XP_009617571.1|  PREDICTED: cyclin-A2-4                           90.5    2e-17   
ref|XP_009362083.1|  PREDICTED: cyclin-A2-4-like                      90.9    2e-17   
ref|XP_011001434.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  89.4    2e-17   
ref|XP_006371725.1|  hypothetical protein POPTR_0018s01140g           89.7    2e-17   
gb|KFK44639.1|  hypothetical protein AALP_AA1G284900                  89.7    2e-17   
ref|XP_006342724.1|  PREDICTED: cyclin-A3-2-like                      89.4    2e-17   
ref|XP_009123450.1|  PREDICTED: cyclin-A3-2                           89.4    3e-17   
emb|CDX81722.1|  BnaC08g38790D                                        89.7    3e-17   
ref|NP_001151751.1|  cyclin-A2                                        90.9    3e-17   
ref|XP_011001425.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  89.4    3e-17   
gb|ACG41795.1|  cyclin-A2                                             89.4    3e-17   
ref|XP_011001416.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  89.7    3e-17   
ref|XP_010479118.1|  PREDICTED: cyclin-A3-2-like                      89.4    3e-17   
ref|XP_006664043.1|  PREDICTED: cyclin-A2-1-like                      90.5    3e-17   
ref|XP_004252819.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  89.4    3e-17   
ref|XP_010461514.1|  PREDICTED: cyclin-A3-2                           89.4    3e-17   
ref|XP_010500240.1|  PREDICTED: cyclin-A3-2-like                      89.4    3e-17   
ref|XP_004966412.1|  PREDICTED: cyclin-A2-1-like                      90.5    3e-17   
ref|XP_007136725.1|  hypothetical protein PHAVU_009G069000g           89.0    3e-17   
gb|KHN04463.1|  Putative cyclin-A3-1                                  89.0    3e-17   
ref|XP_003523987.1|  PREDICTED: putative cyclin-A3-1-like             89.0    4e-17   
ref|XP_008377759.1|  PREDICTED: cyclin-A2-3-like                      87.4    4e-17   
gb|KJB47332.1|  hypothetical protein B456_008G021600                  87.8    4e-17   
ref|XP_003550156.1|  PREDICTED: cyclin-A2-2-like isoform X1           89.7    4e-17   
emb|CDX92090.1|  BnaA05g23170D                                        88.6    5e-17   
ref|XP_010228999.1|  PREDICTED: cyclin-A3-2-like isoform X2           87.8    5e-17   
ref|XP_007024029.1|  Cyclin a2,3                                      90.1    5e-17   
ref|XP_010105467.1|  Putative cyclin-A3-1                             89.0    5e-17   
ref|XP_009106758.1|  PREDICTED: cyclin-A2-4-like isoform X2           89.7    5e-17   
ref|XP_009124592.1|  PREDICTED: cyclin-A3-2-like                      88.6    5e-17   
ref|XP_002516616.1|  cyclin A, putative                               90.1    5e-17   



>ref|XP_009796391.1| PREDICTED: cyclin-A1-4 [Nicotiana sylvestris]
 emb|CAA63543.1| cyclin A-like protein [Nicotiana tabacum]
Length=482

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+MLCY+PS++AASAIFLA+
Sbjct  345  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAASAIFLAK  404

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSKKPWNSTLRHYTLYQPSDLRDCVMALH+LCCN+++SSLPAIREKYSQHKYKFVA
Sbjct  405  YILLPSKKPWNSTLRHYTLYQPSDLRDCVMALHSLCCNNNNSSLPAIREKYSQHKYKFVA  464

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP +IP EFFQ++S
Sbjct  465  KKYCPPTIPVEFFQNIS  481



>emb|CAA63542.1| cyclin A-like protein [Nicotiana tabacum]
Length=483

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+MLCY+PS++AASAIFLA+
Sbjct  346  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAASAIFLAK  405

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSKKPWNSTLRHYTLYQPSDLRDCV+ALH+LCCN+++SSLPAIREKYSQHKYKFVA
Sbjct  406  YILLPSKKPWNSTLRHYTLYQPSDLRDCVVALHSLCCNNNNSSLPAIREKYSQHKYKFVA  465

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP +IP EFFQ++S
Sbjct  466  KKYCPPTIPVEFFQNIS  482



>dbj|BAA09366.1| A-type cyclin [Nicotiana tabacum]
Length=483

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+MLCY+PS++AASAIFLA+
Sbjct  346  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAASAIFLAK  405

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSKKPWNSTLRHYTLYQPSDLRDCV+ALH+LCCN+++SSLPAIREKYSQHKYKFVA
Sbjct  406  YILLPSKKPWNSTLRHYTLYQPSDLRDCVVALHSLCCNNNNSSLPAIREKYSQHKYKFVA  465

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP +IP EFFQ++S
Sbjct  466  KKYCPPTIPVEFFQNIS  482



>ref|NP_001233762.1| cyclin A1 [Solanum lycopersicum]
 emb|CAB46641.1| cyclin A1 [Solanum lycopersicum]
Length=490

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+MLCY+PSL+AASAIFLA+
Sbjct  353  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLCYAPSLIAASAIFLAK  412

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS KPWNSTLRHYTLYQPSDLRDCV+ALH+LCCN+++SSLPA+REKYSQHKYKFVA
Sbjct  413  YILLPSVKPWNSTLRHYTLYQPSDLRDCVLALHSLCCNNNNSSLPAVREKYSQHKYKFVA  472

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP ++P EFFQ++SS
Sbjct  473  KKYCPPTVPVEFFQNISS  490



>ref|XP_010312445.1| PREDICTED: cyclin A1 isoform X1 [Solanum lycopersicum]
Length=489

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+MLCY+PSL+AASAIFLA+
Sbjct  352  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLCYAPSLIAASAIFLAK  411

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS KPWNSTLRHYTLYQPSDLRDCV+ALH+LCCN+++SSLPA+REKYSQHKYKFVA
Sbjct  412  YILLPSVKPWNSTLRHYTLYQPSDLRDCVLALHSLCCNNNNSSLPAVREKYSQHKYKFVA  471

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP ++P EFFQ++SS
Sbjct  472  KKYCPPTVPVEFFQNISS  489



>ref|XP_009593178.1| PREDICTED: cyclin-A1-4 isoform X2 [Nicotiana tomentosiformis]
Length=483

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+MLCY+PS++A SAIFLA+
Sbjct  346  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAGSAIFLAK  405

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSKKPWNSTLRHYTLYQPSDLRDCV+ALH+LCCN+++SSLPAIREKYSQHKYKFVA
Sbjct  406  YILLPSKKPWNSTLRHYTLYQPSDLRDCVVALHSLCCNNNNSSLPAIREKYSQHKYKFVA  465

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP +IP EFFQ++S
Sbjct  466  KKYCPPTIPVEFFQNIS  482



>ref|XP_009593177.1| PREDICTED: cyclin-A1-4 isoform X1 [Nicotiana tomentosiformis]
Length=484

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+MLCY+PS++A SAIFLA+
Sbjct  347  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAGSAIFLAK  406

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSKKPWNSTLRHYTLYQPSDLRDCV+ALH+LCCN+++SSLPAIREKYSQHKYKFVA
Sbjct  407  YILLPSKKPWNSTLRHYTLYQPSDLRDCVVALHSLCCNNNNSSLPAIREKYSQHKYKFVA  466

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP +IP EFFQ++S
Sbjct  467  KKYCPPTIPVEFFQNIS  483



>ref|XP_006351136.1| PREDICTED: cyclin-A1-3-like isoform X1 [Solanum tuberosum]
Length=488

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+ML Y+PSL+AASAIFLA+
Sbjct  351  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLSYAPSLIAASAIFLAK  410

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS KPWNSTLRHYTLYQPSDL+DCVMALH+LCCN+++SSLPA+REKYSQHKYKFVA
Sbjct  411  YILLPSVKPWNSTLRHYTLYQPSDLQDCVMALHSLCCNNNNSSLPAVREKYSQHKYKFVA  470

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP ++P EFFQ++SS
Sbjct  471  KKYCPPTVPVEFFQNISS  488



>ref|XP_006351137.1| PREDICTED: cyclin-A1-3-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+ML Y+PSL+AASAIFLA+
Sbjct  350  APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLSYAPSLIAASAIFLAK  409

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS KPWNSTLRHYTLYQPSDL+DCVMALH+LCCN+++SSLPA+REKYSQHKYKFVA
Sbjct  410  YILLPSVKPWNSTLRHYTLYQPSDLQDCVMALHSLCCNNNNSSLPAVREKYSQHKYKFVA  469

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP ++P EFFQ++SS
Sbjct  470  KKYCPPTVPVEFFQNISS  487



>ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=495

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLE LA+Y+AELSLL Y MLCY+PSL+AASAIFLA 
Sbjct  358  APTAKCFLRRFVRAAQGMNEVPSLQLECLANYIAELSLLEYSMLCYAPSLIAASAIFLAN  417

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSK+PWNSTLRHYTLYQPSDL DCV ALH LCCN+H+SSLPAIREKYSQHKYKFVA
Sbjct  418  YILLPSKRPWNSTLRHYTLYQPSDLCDCVKALHRLCCNNHNSSLPAIREKYSQHKYKFVA  477

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIPSE F ++S+
Sbjct  478  KKYCPPSIPSELFHNLSN  495



>gb|AEV43294.1| cyclin A1 [Nicotiana benthamiana]
Length=127

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLEHLASY+AELSLL Y+MLCY+PS++AASAIFLA+
Sbjct  1    APTAKCFLRRFVRAAQGLNEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAASAIFLAK  60

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSKKPWNSTLRHYTLYQPSDLRDCVMALH+LCCN+++SSLPAIREKYSQHKYKFVA
Sbjct  61   FILLPSKKPWNSTLRHYTLYQPSDLRDCVMALHSLCCNNNNSSLPAIREKYSQHKYKFVA  120

Query  379  KKICP  365
            KK CP
Sbjct  121  KKYCP  125



>emb|CBI18982.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  SLQLE LA+Y+AELSLL Y MLCY+PSL+AASAIFLA 
Sbjct  413  APTAKCFLRRFVRAAQGMNEVPSLQLECLANYIAELSLLEYSMLCYAPSLIAASAIFLAN  472

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSK+PWNSTLRHYTLYQPSDL DCV ALH LCCN+H+SSLPAIREKYSQHKYKFVA
Sbjct  473  YILLPSKRPWNSTLRHYTLYQPSDLCDCVKALHRLCCNNHNSSLPAIREKYSQHKYKFVA  532

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIPSE F ++S+
Sbjct  533  KKYCPPSIPSELFHNLSN  550



>dbj|BAE06271.1| cyclin A [Scutellaria baicalensis]
Length=496

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE   LQ E LA+Y+ ELSLL Y MLC++PSL+AA++IFLAR
Sbjct  359  APTAKCFLRRFVRAAQGVNETPLLQFECLANYITELSLLEYSMLCFAPSLIAAASIFLAR  418

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSK+PWN TLRHYTLYQP DLRDCV+ALH  CCNSH+SSLPAIREKYSQHKYKFVA
Sbjct  419  FILLPSKRPWNHTLRHYTLYQPYDLRDCVLALHGFCCNSHNSSLPAIREKYSQHKYKFVA  478

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIP E+F +VSS
Sbjct  479  KKYCPLSIPPEYFHNVSS  496



>emb|CDP10969.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 115/134 (86%), Gaps = 2/134 (1%)
 Frame = -3

Query  721  LLRRFVRATQGF--NEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLT  548
             LRRFVRA QG   +EA SLQLE LA+Y+AELSLL Y MLCY+PSL+AAS IFLA+Y L 
Sbjct  371  FLRRFVRAAQGLVVHEAQSLQLECLANYIAELSLLEYSMLCYAPSLIAASTIFLAKYILV  430

Query  547  PSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKIC  368
            P+K+PWNSTLRHYTLYQPSDL DCV ALH+LC  SH+SSLPAIREKYSQHKYKFVAKK C
Sbjct  431  PAKRPWNSTLRHYTLYQPSDLHDCVKALHSLCSGSHNSSLPAIREKYSQHKYKFVAKKYC  490

Query  367  PTSIPSEFFQDVSS  326
            P SIP EFFQ+VSS
Sbjct  491  PPSIPPEFFQNVSS  504



>ref|XP_006386358.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
 gb|ERP64155.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
Length=499

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+AELSLL Y MLCY+PSLVAASAIFLA+
Sbjct  362  APTAKCFLRRFVRAAQGINEVPSMQLECLANYIAELSLLEYSMLCYAPSLVAASAIFLAK  421

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSK+PWNSTL+HYTLY+P DL DCV  LH LCC +H+S+LPAIREKYSQHKYKFVA
Sbjct  422  YILLPSKRPWNSTLQHYTLYEPVDLSDCVKDLHRLCCGNHNSTLPAIREKYSQHKYKFVA  481

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIP EFFQ++ S
Sbjct  482  KKYCPPSIPGEFFQNLGS  499



>ref|XP_006351138.1| PREDICTED: cyclin-A1-3-like isoform X3 [Solanum tuberosum]
Length=483

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 116/138 (84%), Gaps = 5/138 (4%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE   L     ASY+AELSLL Y+ML Y+PSL+AASAIFLA+
Sbjct  351  APTAKCFLRRFVRAAQGLNELEHL-----ASYIAELSLLEYNMLSYAPSLIAASAIFLAK  405

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS KPWNSTLRHYTLYQPSDL+DCVMALH+LCCN+++SSLPA+REKYSQHKYKFVA
Sbjct  406  YILLPSVKPWNSTLRHYTLYQPSDLQDCVMALHSLCCNNNNSSLPAVREKYSQHKYKFVA  465

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP ++P EFFQ++SS
Sbjct  466  KKYCPPTVPVEFFQNISS  483



>ref|XP_011102309.1| PREDICTED: cyclin-A1-1 [Sesamum indicum]
Length=495

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG NEA  LQLE +A+Y+AELSLL Y MLC++PSL+AAS+IFLA++ L PS
Sbjct  364  FLRRFVRAAQGVNEAPLLQLECMANYIAELSLLEYSMLCFAPSLIAASSIFLAKFILVPS  423

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K+PWNSTL+HYTLYQ  DLR+CV+ALH LCCNSH+SSLPAIREKYSQHKYKFVAKK CP 
Sbjct  424  KRPWNSTLQHYTLYQSRDLRNCVLALHGLCCNSHNSSLPAIREKYSQHKYKFVAKKYCPP  483

Query  361  SIPSEFFQDVSS  326
            S+P E+F D SS
Sbjct  484  SVPPEYFHDESS  495



>ref|XP_011027473.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027474.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+AELSLL Y MLCY+PSLVAASAIFLA+
Sbjct  362  APTAKCFLRRFVRAAQGINEVPSMQLECLANYIAELSLLEYSMLCYAPSLVAASAIFLAK  421

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+K+PWNSTL+HYTLY+P DL DCV  LH LCC +H+S+LPAIREKYSQHKYKFVA
Sbjct  422  YILLPTKRPWNSTLQHYTLYEPVDLSDCVKDLHRLCCGNHNSTLPAIREKYSQHKYKFVA  481

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP SIP EFFQ++ 
Sbjct  482  KKYCPPSIPGEFFQNLG  498



>ref|XP_011027470.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027471.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+AELSLL Y MLCY+PSLVAASAIFLA+
Sbjct  362  APTAKCFLRRFVRAAQGINEVPSMQLECLANYIAELSLLEYSMLCYAPSLVAASAIFLAK  421

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+K+PWNSTL+HYTLY+P DL DCV  LH LCC +H+S+LPAIREKYSQHKYKFVA
Sbjct  422  YILLPTKRPWNSTLQHYTLYEPVDLSDCVKDLHRLCCGNHNSTLPAIREKYSQHKYKFVA  481

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP SIP EFFQ++ 
Sbjct  482  KKYCPPSIPGEFFQNLG  498



>gb|EYU32511.1| hypothetical protein MIMGU_mgv1a005475mg [Erythranthe guttata]
Length=482

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  QG NEA  LQLE LA+Y+AELSLL Y+MLC++PSL+AAS+IFLA+
Sbjct  345  APTAKCFLRRFVRVAQGANEAPLLQLECLANYIAELSLLEYNMLCFAPSLIAASSIFLAK  404

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PS +PW+STLRHYTLYQP DLRDCV+ALH LCCNS  S+LPA+REKYSQHKYKFVA
Sbjct  405  FILAPSNRPWDSTLRHYTLYQPYDLRDCVVALHGLCCNSQSSNLPAVREKYSQHKYKFVA  464

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIP+E+F +VSS
Sbjct  465  KKYCPQSIPAEYFYNVSS  482



>ref|XP_002520329.1| cyclin A, putative [Ricinus communis]
 gb|EEF42115.1| cyclin A, putative [Ricinus communis]
Length=498

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+ ELSLL Y ML Y PSL+AASAIFLA+
Sbjct  361  APTAKCFLRRFVRAAQGVNEVPSMQLECLANYITELSLLEYTMLGYVPSLIAASAIFLAK  420

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS++PWNSTL+HYTLYQPSDL DCV  LH LCCN H+S+LPAIREKYSQHKYKFVA
Sbjct  421  YILLPSRRPWNSTLKHYTLYQPSDLSDCVKDLHRLCCNGHNSTLPAIREKYSQHKYKFVA  480

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIP EFF D
Sbjct  481  KKYCPPSIPQEFFHD  495



>ref|XP_002306649.1| cyclin family protein [Populus trichocarpa]
 gb|EEE93645.1| cyclin family protein [Populus trichocarpa]
Length=493

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+AELSLL Y MLCY+PSLVAASAIFLA+
Sbjct  356  APTAKCFLRRFVRAAQGINEVPSMQLECLANYIAELSLLEYTMLCYAPSLVAASAIFLAK  415

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSK+PWNSTL+HYTLY+P DL  CV  L+ LCC SH+S+LPAIREKYSQHKYKFVA
Sbjct  416  YILLPSKRPWNSTLQHYTLYEPVDLCHCVKDLYRLCCGSHNSTLPAIREKYSQHKYKFVA  475

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP SIP EFFQ++S
Sbjct  476  KKYCPPSIPEEFFQNLS  492



>ref|XP_011003420.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=493

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+AELSLL Y MLCY+PSLVAASAIFLA+
Sbjct  356  APTAKCFLRRFVRAAQGINEVPSMQLECLANYIAELSLLEYTMLCYAPSLVAASAIFLAK  415

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSK+PWNSTL+HYTLY+P +L  CV  L+ LCC SH+S+LPAIREKYSQHKYKFVA
Sbjct  416  YILLPSKRPWNSTLQHYTLYEPVELCHCVKDLYRLCCGSHNSTLPAIREKYSQHKYKFVA  475

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP SIP EFFQ++S
Sbjct  476  KKYCPPSIPEEFFQNLS  492



>ref|XP_010063417.1| PREDICTED: cyclin-A1-1 [Eucalyptus grandis]
 gb|KCW70645.1| hypothetical protein EUGRSUZ_F03815 [Eucalyptus grandis]
Length=498

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG NE  SLQLE +A+Y+AELSLL YDMLCY+PSLVAASAIFLA++ +TPS
Sbjct  367  FLRRFVRAAQGVNEVPSLQLECMANYIAELSLLEYDMLCYAPSLVAASAIFLAKFVITPS  426

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K+PW+ TL+HYTLYQPSDL +CV  LH LC N+H S+LPAIREKYSQHKYK+VAKK CP 
Sbjct  427  KRPWDPTLQHYTLYQPSDLGNCVKDLHRLCFNNHGSTLPAIREKYSQHKYKYVAKKYCPP  486

Query  361  SIPSEFFQDV  332
            SIP EFF ++
Sbjct  487  SIPPEFFHNL  496



>ref|XP_007019157.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
 gb|EOY16382.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
Length=493

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG NE  S+QLE +A+Y+AELSLL Y MLCY+PSL+AASAIFLA++ L PS
Sbjct  365  FLRRFVRAAQGVNEVPSMQLECMANYIAELSLLEYTMLCYAPSLIAASAIFLAKFILLPS  424

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K+PWNSTL+HYTLY+PSDL DCV  LH LCCN+ +S+LPAIREKY+QHKYK VAKK CP 
Sbjct  425  KRPWNSTLQHYTLYKPSDLCDCVKDLHRLCCNNQNSTLPAIREKYNQHKYKCVAKKYCPP  484

Query  361  SIPSEFFQD  335
            SIPSEFFQ+
Sbjct  485  SIPSEFFQN  493



>gb|KHN35496.1| Cyclin-A1-1 [Glycine soja]
Length=348

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG +E  SLQLE L +Y+AELSL+ Y ML Y+PSLVAASAIFLA++ L PS
Sbjct  220  FLRRFVRAAQGVDEVPSLQLECLTNYIAELSLMEYSMLGYAPSLVAASAIFLAKFILFPS  279

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            KKPWNSTL+HYTLYQPSDL  CV  LH LCCNS +S+LPAIREKYSQHKYK+VAKK CP 
Sbjct  280  KKPWNSTLQHYTLYQPSDLCVCVKDLHRLCCNSPNSNLPAIREKYSQHKYKYVAKKYCPP  339

Query  361  SIPSEFFQD  335
            SIP EFFQ+
Sbjct  340  SIPPEFFQN  348



>gb|KJB59298.1| hypothetical protein B456_009G248300 [Gossypium raimondii]
Length=489

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE +A+Y+AELSLL Y+MLCY PSL+AASAIFLA+
Sbjct  355  APTAKCFLRRFVRAAQGINEVPSMQLECMANYIAELSLLEYNMLCYPPSLIAASAIFLAK  414

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSKKPWNSTL+HYTLY+PSDL +CV  LH LCCN+++S+LPAIREKYSQHKYK VA
Sbjct  415  FILLPSKKPWNSTLQHYTLYKPSDLFECVKDLHRLCCNNNNSTLPAIREKYSQHKYKCVA  474

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIPS+FF +
Sbjct  475  KKYCPPSIPSDFFHN  489



>ref|XP_008219598.1| PREDICTED: cyclin-A1-1-like [Prunus mume]
Length=496

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+ LE LA+YLAELSLL Y MLCY+PSLVAASAIFLA 
Sbjct  363  APTTKCFLRRFVRAAQGANEGISMHLECLANYLAELSLLEYSMLCYAPSLVAASAIFLAN  422

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSK+PWN+TL+HYTLYQPSDLRDCV  LH LCCNS  SSLPAIREKYSQHKYK VA
Sbjct  423  FILLPSKRPWNATLQHYTLYQPSDLRDCVKELHRLCCNSQSSSLPAIREKYSQHKYKHVA  482

Query  379  KKICPTSIPSEF  344
            KK CP +IPSE+
Sbjct  483  KKYCPPTIPSEY  494



>ref|XP_012078272.1| PREDICTED: cyclin-A1-1 [Jatropha curcas]
 gb|KDP32823.1| hypothetical protein JCGZ_12115 [Jatropha curcas]
Length=494

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA+QG NE  S+ LE LA+Y+AELSLL Y+ML Y+PSL+AASAIFLA+
Sbjct  358  APTAKCFLRRFVRASQGANEVPSMHLECLANYIAELSLLEYNMLSYAPSLIAASAIFLAK  417

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS++PWNSTL+HYTLYQPSDL +CV  LH LCC SH+S+LPAIREKYSQHKYKFVA
Sbjct  418  YILLPSRRPWNSTLQHYTLYQPSDLCECVKELHCLCCGSHNSTLPAIREKYSQHKYKFVA  477

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP SIP E+F + S
Sbjct  478  KKYCPPSIPQEYFNNQS  494



>gb|KHG05847.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=489

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE +A+Y+AELSLL Y MLCY PSL+AASAIFLA+
Sbjct  355  APTAKCFLRRFVRAAQGINEVPSMQLECMANYIAELSLLEYSMLCYPPSLIAASAIFLAK  414

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            +   PSKKPWNSTL+HYTLY+PSDL +CV  LH LCCN+++S+LPAIREKYSQHKYK VA
Sbjct  415  FIFLPSKKPWNSTLQHYTLYKPSDLFECVKELHRLCCNNNNSTLPAIREKYSQHKYKCVA  474

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIPS+FF +
Sbjct  475  KKYCPPSIPSDFFHN  489



>ref|NP_001237800.1| mitotic cyclin a2-type [Glycine max]
 dbj|BAA09466.1| mitotic cyclin a2-type [Glycine max]
Length=484

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG +E  SLQLE L +Y+AELSL+ Y ML Y+PSLVAASAIFLA++ L PS
Sbjct  356  FLRRFVRAAQGVDEVPSLQLECLTNYIAELSLMEYSMLGYAPSLVAASAIFLAKFILFPS  415

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            KKPWNSTL+HYTLYQPSDL  CV  LH LCCNS +S+LPAIREKYSQHKYK+VAKK CP 
Sbjct  416  KKPWNSTLQHYTLYQPSDLCVCVKDLHRLCCNSPNSNLPAIREKYSQHKYKYVAKKYCPP  475

Query  361  SIPSEFFQD  335
            SIP EFFQ+
Sbjct  476  SIPPEFFQN  484



>ref|XP_010530202.1| PREDICTED: cyclin-A1-1 [Tarenaya hassleriana]
Length=493

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA  G  EA S+QLE LA+Y+AELSLL Y ML +SPSL+AASAIFLA+Y L P+
Sbjct  363  FLRRFVRAAHGITEAPSMQLECLANYIAELSLLEYSMLSHSPSLIAASAIFLAKYILDPT  422

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
             +PWNSTL+HYTLY+PS+LR CV  LH LCCN+H S+LPA+REKYSQHKYKFVAKK CP 
Sbjct  423  TRPWNSTLKHYTLYEPSELRKCVKGLHGLCCNAHTSTLPAVREKYSQHKYKFVAKKFCPP  482

Query  361  SIPSEFFQD  335
             IPSEFF +
Sbjct  483  IIPSEFFHN  491



>ref|XP_009387253.1| PREDICTED: cyclin-A1-4-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF+RA QG +E  +LQLE LASY+AE+SLL Y +LCY+PSL+AASAIFLAR+ L P+
Sbjct  362  FLRRFIRAAQGSDEVPALQLEFLASYVAEISLLEYSLLCYAPSLIAASAIFLARFILQPA  421

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K+PWN+TL HYTLY+PSDL DCV ALH L C S  ++LPAIREKYSQHKYKFVAKK CP 
Sbjct  422  KRPWNATLDHYTLYKPSDLSDCVKALHRLFCTSSGNNLPAIREKYSQHKYKFVAKKYCPA  481

Query  361  SIPSEFFQD  335
            SIP+E+FQD
Sbjct  482  SIPAEYFQD  490



>ref|XP_009343979.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=498

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG NE +S+QLE LA+Y+AELSLL Y MLCY+PSL+AASAIFLA 
Sbjct  365  APTTKCFLRRFLRAAQGANEVTSMQLECLANYIAELSLLEYSMLCYAPSLIAASAIFLAN  424

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PSK+PWN+TL HYTLYQPSDLRDC+ ALH LCC+S  SSLPAIREKYSQHKYK+VA
Sbjct  425  YILLPSKRPWNATLHHYTLYQPSDLRDCINALHRLCCDSQTSSLPAIREKYSQHKYKYVA  484

Query  379  KKICPTSIPSEF  344
            K  CP +IPS++
Sbjct  485  KMHCPPTIPSKY  496



>ref|XP_008219599.1| PREDICTED: cyclin-A1-4-like [Prunus mume]
Length=514

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF    Q   EA SLQL+ LA Y+AELSLL Y MLCY+PSL+AASA FLA+
Sbjct  377  APTTMCFLRRFCFVAQQTGEAPSLQLQCLAFYIAELSLLEYSMLCYAPSLIAASAAFLAK  436

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L+PSKKPWNSTLRHYTLYQ +DL DCV ALH LCCN   S LPA+REKY QHKYKFVA
Sbjct  437  YILSPSKKPWNSTLRHYTLYQAADLFDCVKALHRLCCNGCSSDLPAVREKYCQHKYKFVA  496

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIP+EFFQD++S
Sbjct  497  KKYCPPSIPTEFFQDLNS  514



>ref|XP_006472826.1| PREDICTED: cyclin-A1-1-like [Citrus sinensis]
Length=503

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+ ELSLL Y MLC++PSL+AASAIFLA+
Sbjct  367  APTAKCFLRRFVRAAQGINEVPSMQLECLANYVTELSLLDYSMLCHAPSLIAASAIFLAK  426

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+K+PWNSTL+HYTLYQPSDL +CV  LH LCCNS  S+LPAIREKYS HKYK VA
Sbjct  427  YILLPAKRPWNSTLQHYTLYQPSDLMECVKDLHRLCCNSQSSTLPAIREKYSLHKYKCVA  486

Query  379  KKICPTSIPSEFF  341
            KK CP SIP EFF
Sbjct  487  KKYCPPSIPPEFF  499



>ref|XP_007225619.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
 gb|EMJ26818.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
Length=495

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+ LE LA+YLAELSLL Y ML Y+PSLVAASAIFLA 
Sbjct  362  APTTKCFLRRFVRAAQGANEGISMHLECLANYLAELSLLEYSMLGYAPSLVAASAIFLAN  421

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSK+PWN+TL+HYTLYQPSDLRDCV  LH LCCNS  SSLPAIREKYSQHKYK VA
Sbjct  422  FILLPSKRPWNATLQHYTLYQPSDLRDCVKDLHRLCCNSQSSSLPAIREKYSQHKYKHVA  481

Query  379  KKICPTSIPSEF  344
            KK CP +IPSE+
Sbjct  482  KKYCPPTIPSEY  493



>ref|XP_007223288.1| hypothetical protein PRUPE_ppa005557mg [Prunus persica]
 gb|EMJ24487.1| hypothetical protein PRUPE_ppa005557mg [Prunus persica]
Length=454

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF    Q  +E  SLQL+ LA Y+AELSLL Y MLCY+PSL+AASA FLA+
Sbjct  317  APTTMCFLRRFCFVAQQTSEVPSLQLQCLAFYIAELSLLEYSMLCYAPSLIAASAAFLAK  376

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L+PSKKPWNSTLRHYTLYQ +DL DCV ALH LCCN   S LPA+REKY QHKYKFVA
Sbjct  377  YILSPSKKPWNSTLRHYTLYQAADLFDCVKALHRLCCNGCSSDLPAVREKYCQHKYKFVA  436

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIP+EFFQD+++
Sbjct  437  KKYCPPSIPTEFFQDLNN  454



>ref|XP_008806262.1| PREDICTED: cyclin-A1-4 isoform X2 [Phoenix dactylifera]
Length=425

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
             P +   LRRFVRA QG +E   LQLE LA+Y+AELSLL Y+MLCYSPSL+AASAIFLA+
Sbjct  288  GPTAKCFLRRFVRAAQGCDEVPLLQLEFLANYVAELSLLEYNMLCYSPSLIAASAIFLAK  347

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P KKPWN+TL HYTLY+PS+L DCV ALH L  +S  SSLPAIREKYSQHKYKFVA
Sbjct  348  FILQPMKKPWNATLGHYTLYKPSELCDCVKALHQLFHSSPGSSLPAIREKYSQHKYKFVA  407

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIPSEFFQD
Sbjct  408  KKYCPPSIPSEFFQD  422



>ref|XP_003526649.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=480

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG +E  SLQLE L +Y+AELSL+ Y ML Y+PSL+AASAIFLA++ L PS
Sbjct  352  FLRRFVRAAQGVDEVPSLQLECLTNYIAELSLMEYSMLGYAPSLIAASAIFLAKFILFPS  411

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            KKPW STL+HYTLY+PSDL  CV  LH LCCNS +S+LPAIREKYSQHKYK+VAKK CP 
Sbjct  412  KKPWTSTLQHYTLYKPSDLCVCVRDLHRLCCNSPNSNLPAIREKYSQHKYKYVAKKYCPP  471

Query  361  SIPSEFFQD  335
            SIP EFFQ+
Sbjct  472  SIPPEFFQN  480



>ref|XP_010925928.1| PREDICTED: cyclin-A1-4 [Elaeis guineensis]
Length=491

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG  E   LQLE LA+Y+AELSLL Y+MLCYSPSL+AASAIFLA+
Sbjct  354  APTAKCFLRRFVRAAQGCEEVPLLQLEFLANYVAELSLLEYNMLCYSPSLIAASAIFLAK  413

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P KKPWN+TL HYTLY+PS+L DCV  LH L  NS  SSLPA+REKYSQHKYKFVA
Sbjct  414  FILQPMKKPWNATLGHYTLYKPSELLDCVKVLHRLFRNSAGSSLPAVREKYSQHKYKFVA  473

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIPSEFF+D
Sbjct  474  KKYCPPSIPSEFFED  488



>gb|KDO80523.1| hypothetical protein CISIN_1g017988mg [Citrus sinensis]
Length=362

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+ ELSLL Y MLC++PSL+AASAIFLA+
Sbjct  226  APTAKCFLRRFVRAAQGINEVPSMQLECLANYVTELSLLDYSMLCHAPSLIAASAIFLAK  285

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+K+PWNSTL+HYTLYQPSDL +CV  LH L CNS  S+LPAIREKYS HKYK VA
Sbjct  286  YILLPAKRPWNSTLQHYTLYQPSDLMECVKDLHRLYCNSQSSTLPAIREKYSLHKYKCVA  345

Query  379  KKICPTSIPSEFF  341
            KK CP SIP EFF
Sbjct  346  KKYCPPSIPPEFF  358



>ref|XP_009341345.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341346.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341352.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341353.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
Length=521

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            SP +   LRRF  ATQ  +E  S     LASY+AELSL+ Y MLCY+PSL+AASA FLA+
Sbjct  384  SPTAMCFLRRFCFATQKTSEVPSEHFWCLASYIAELSLVEYSMLCYAPSLIAASAAFLAK  443

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L+P KKPWNSTLRHYTLYQ SDLRDCV ALH+LCCN   S+LPA+REKYSQHKYKFVA
Sbjct  444  YILSPLKKPWNSTLRHYTLYQASDLRDCVKALHHLCCNGCGSNLPAVREKYSQHKYKFVA  503

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP SIP E FQD S
Sbjct  504  KKYCPLSIPPELFQDFS  520



>ref|XP_008806186.1| PREDICTED: cyclin-A1-4 isoform X1 [Phoenix dactylifera]
Length=493

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
             P +   LRRFVRA QG +E   LQLE LA+Y+AELSLL Y+MLCYSPSL+AASAIFLA+
Sbjct  356  GPTAKCFLRRFVRAAQGCDEVPLLQLEFLANYVAELSLLEYNMLCYSPSLIAASAIFLAK  415

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P KKPWN+TL HYTLY+PS+L DCV ALH L  +S  SSLPAIREKYSQHKYKFVA
Sbjct  416  FILQPMKKPWNATLGHYTLYKPSELCDCVKALHQLFHSSPGSSLPAIREKYSQHKYKFVA  475

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIPSEFFQD
Sbjct  476  KKYCPPSIPSEFFQD  490



>gb|AFK46051.1| unknown [Lotus japonicus]
Length=507

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG  E  SLQLE L +Y+AELSL+ Y MLCY+PSLVAASAIFLA++ L PS
Sbjct  379  FLRRFVRAAQGVEEVLSLQLESLTNYIAELSLMEYSMLCYAPSLVAASAIFLAKFILFPS  438

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
             KPW+STL+HYTLYQPSDL  CV  LH L CNS +S+LPAI+EKYSQHKYK+VAKK CP 
Sbjct  439  IKPWSSTLQHYTLYQPSDLCVCVKELHRLFCNSPNSNLPAIKEKYSQHKYKYVAKKYCPP  498

Query  361  SIPSEFFQD  335
            SIPSEFFQ+
Sbjct  499  SIPSEFFQN  507



>ref|XP_007137455.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
 gb|ESW09449.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
Length=488

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG +E  SLQLE L +Y+AELSLL Y MLCY+PSL+AASAIFLAR+ L PS
Sbjct  360  FLRRFVRAAQGVDEVPSLQLECLTNYIAELSLLEYSMLCYAPSLIAASAIFLARFILFPS  419

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
             KPWNSTL+HYTLYQPSDL  CV  LH LC NS +++LPAI+EKYSQHKYK+VAKK CP 
Sbjct  420  TKPWNSTLQHYTLYQPSDLCVCVKELHRLCGNSPNTNLPAIKEKYSQHKYKYVAKKYCPP  479

Query  361  SIPSEFF  341
            SIP EFF
Sbjct  480  SIPQEFF  486



>ref|XP_010095430.1| hypothetical protein L484_013387 [Morus notabilis]
 gb|EXB60122.1| hypothetical protein L484_013387 [Morus notabilis]
Length=495

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+YLAELSLL Y MLCY+PSL+AASAIFLA 
Sbjct  361  APTTKCFLRRFVRAAQGINEVPSMQLECLANYLAELSLLEYSMLCYAPSLIAASAIFLAN  420

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSK+PWNSTL+HYTLY+P+DL  CV  LH LC N+H+SSLPAIREKYSQHKYK+VA
Sbjct  421  FILLPSKRPWNSTLQHYTLYRPADLCKCVKDLHRLCSNNHNSSLPAIREKYSQHKYKYVA  480

Query  379  KKICPTSIPSEFFQD  335
            KK  P  IP EFF +
Sbjct  481  KKYVPPMIPPEFFHN  495



>gb|KJB80670.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=416

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE   +QLE +A+Y+ ELSLL Y MLC++PSL+AASAIFLA+
Sbjct  283  APTAKCFLRRFVRAAQGINEVPLMQLECMANYITELSLLEYSMLCHAPSLIAASAIFLAK  342

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSKKPWNSTL+HYTLY+PSDL DCV  LH LCCN ++S+LPAIREKY+QHKYK VA
Sbjct  343  FILLPSKKPWNSTLQHYTLYKPSDLCDCVKDLHRLCCN-NNSTLPAIREKYNQHKYKCVA  401

Query  379  KKICPTSIPSEFFQD  335
            KK  P SIPSEFFQ+
Sbjct  402  KKNWPPSIPSEFFQN  416



>ref|XP_006434258.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
 gb|ESR47498.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
Length=503

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE  S+QLE LA+Y+ ELSLL Y MLC++PSL+AASAIFLA+
Sbjct  367  APTAKCFLRRFVRAAQGINEVPSMQLECLANYVTELSLLDYSMLCHAPSLIAASAIFLAK  426

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+K+PWNSTL+HYTLYQPSDL +CV  LH L CNS  S+LPAIREKYS HKYK VA
Sbjct  427  YILLPAKRPWNSTLQHYTLYQPSDLMECVKDLHRLYCNSQSSTLPAIREKYSLHKYKCVA  486

Query  379  KKICPTSIPSEFF  341
            KK CP SIP EFF
Sbjct  487  KKYCPPSIPPEFF  499



>ref|XP_004149427.1| PREDICTED: cyclin-A1-1 [Cucumis sativus]
 gb|KGN47698.1| hypothetical protein Csa_6G382370 [Cucumis sativus]
Length=506

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 6/135 (4%)
 Frame = -3

Query  721  LLRRFVRATQG-----FNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
             LRRFVRA QG      +E  S+QLE L+++LAELSLL Y MLCY+PSLVAASAIFLA++
Sbjct  369  FLRRFVRAAQGATDQSTDEVPSMQLECLSNFLAELSLLEYSMLCYAPSLVAASAIFLAKF  428

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCC-NSHHSSLPAIREKYSQHKYKFVA  380
             L P+K+PWNSTL+HYT YQPSDL DCV  LH LCC N+H+SSLPAIREKYSQHKYK VA
Sbjct  429  ILLPTKRPWNSTLQHYTHYQPSDLVDCVKDLHGLCCNNTHNSSLPAIREKYSQHKYKHVA  488

Query  379  KKICPTSIPSEFFQD  335
            KK CP +IP EFFQ+
Sbjct  489  KKYCPPTIPPEFFQN  503



>ref|XP_004290902.1| PREDICTED: cyclin-A1-1 [Fragaria vesca subsp. vesca]
Length=500

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG NE  S+QLE LA+YLAELSLL Y ML Y+PSLVAASAIFLA Y   PS
Sbjct  373  FLRRFVRAAQGVNELPSMQLECLANYLAELSLLDYSMLSYAPSLVAASAIFLANYITLPS  432

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K+PWN+TL+HYTLYQPSDLR+CV  LH LCC++ +SSLPAIREKYSQHKYK+VAK  CP 
Sbjct  433  KRPWNATLQHYTLYQPSDLRECVKDLHRLCCDNQNSSLPAIREKYSQHKYKYVAKMYCPP  492

Query  361  SIPSEF  344
            +IP E+
Sbjct  493  TIPKEY  498



>ref|XP_010915931.1| PREDICTED: cyclin-A1-4-like isoform X1 [Elaeis guineensis]
Length=534

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG +E   LQLE LA+Y+AELSLL Y+MLCYSPSL+AASAIFLA+
Sbjct  397  APTAKCFLRRFVRAAQGCDEVPLLQLEFLANYVAELSLLEYNMLCYSPSLIAASAIFLAK  456

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K+PWN+TL HYTLY+PS+L DC  ALH L  NS  SSLPA+REKYSQHK+KFVA
Sbjct  457  FILQPTKRPWNATLVHYTLYKPSELYDCAKALHRLFLNSSGSSLPAVREKYSQHKFKFVA  516

Query  379  KKICPTSIPSEFFQ  338
            KK CP SIPSEFFQ
Sbjct  517  KKNCPPSIPSEFFQ  530



>gb|KHG05394.1| CYCA1-1: Cyclin-A1-1 [Gossypium arboreum]
Length=245

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LR+FV A +  N+   LQ E LA+Y+AELSLL Y ML Y+PSL+AASA FLAR+
Sbjct  111  PTTKFFLRQFVCAAETINQVQLLQFECLANYIAELSLLEYTMLHYAPSLIAASAAFLARF  170

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
             L+PS+KPW+S L HYTLYQPSD+ +CV ALH+LC N   ++LPAIREKYSQHKYKFVAK
Sbjct  171  ILSPSRKPWDSMLGHYTLYQPSDIGNCVKALHHLCRNGGGANLPAIREKYSQHKYKFVAK  230

Query  376  KICPTSIPSEFFQDV  332
            K CP SIP EFFQDV
Sbjct  231  KYCPASIPEEFFQDV  245



>ref|XP_009399851.1| PREDICTED: cyclin-A1-4-like [Musa acuminata subsp. malaccensis]
Length=495

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P S   LRRF+RA QG +E  +LQLE LA Y+AELSLL Y++LCY+PS++AASAIFLA 
Sbjct  358  APTSKCFLRRFIRAAQGSDEVPALQLEFLACYIAELSLLEYNLLCYAPSIIAASAIFLAN  417

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P+K+PWN+TL HYTLY+PSDL DCV  LH L C S  ++LPAIREKYSQHKYKFVA
Sbjct  418  FIMQPTKRPWNATLGHYTLYKPSDLSDCVKELHRLFCTSAGNNLPAIREKYSQHKYKFVA  477

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIP ++FQD
Sbjct  478  KKYCPASIPLDYFQD  492



>ref|XP_008466750.1| PREDICTED: cyclin-A1-1 [Cucumis melo]
Length=507

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 110/136 (81%), Gaps = 7/136 (5%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASS------LQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
             LRRFVRA QG  + SS      +QLE L+++LAELSLL Y MLCY+PSLVAASAIFLA+
Sbjct  369  FLRRFVRAAQGATDESSTYEVPSMQLECLSNFLAELSLLEYSMLCYAPSLVAASAIFLAK  428

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCC-NSHHSSLPAIREKYSQHKYKFV  383
            + L P+K+PWNSTL+HYT YQPSDL DCV  LH LCC N+H+SSLPAIREKYSQHKYK V
Sbjct  429  FILLPTKRPWNSTLQHYTHYQPSDLVDCVKDLHGLCCNNTHNSSLPAIREKYSQHKYKHV  488

Query  382  AKKICPTSIPSEFFQD  335
            AKK CP +IP EFFQ+
Sbjct  489  AKKYCPPTIPPEFFQN  504



>gb|KEH35323.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=505

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG +E  SLQLE L +++AELSLL Y MLCY+PSL+AAS+IFLA+Y L P+
Sbjct  377  FLRRFVRAAQGIDEVPSLQLECLTNFIAELSLLEYSMLCYAPSLIAASSIFLAKYMLFPA  436

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
             KPWN TL+HYT YQPSDL  CV  LH LCCNS +S+LPAI+EKY+QHKYK+VA K CP 
Sbjct  437  MKPWNPTLQHYTQYQPSDLCACVKDLHRLCCNSPNSNLPAIKEKYNQHKYKYVANKYCPP  496

Query  361  SIPSEFFQD  335
            SIP EFFQ+
Sbjct  497  SIPQEFFQN  505



>gb|KJB80669.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=493

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG NE   +QLE +A+Y+ ELSLL Y MLC++PSL+AASAIFLA+
Sbjct  360  APTAKCFLRRFVRAAQGINEVPLMQLECMANYITELSLLEYSMLCHAPSLIAASAIFLAK  419

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSKKPWNSTL+HYTLY+PSDL DCV  LH LCCN ++S+LPAIREKY+QHKYK VA
Sbjct  420  FILLPSKKPWNSTLQHYTLYKPSDLCDCVKDLHRLCCN-NNSTLPAIREKYNQHKYKCVA  478

Query  379  KKICPTSIPSEFFQD  335
            KK  P SIPSEFFQ+
Sbjct  479  KKNWPPSIPSEFFQN  493



>ref|XP_008783212.1| PREDICTED: cyclin-A1-4-like [Phoenix dactylifera]
Length=534

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG +E   LQLE LA+Y+AELSLL Y+MLCYSPSL+AASAIFLA+
Sbjct  397  APTAKCFLRRFVRAAQGCDEVPLLQLEFLANYVAELSLLEYNMLCYSPSLIAASAIFLAK  456

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P K+PWN+TL HYTLY+PS+L DC  ALH L  NS  SSLPAIREKYSQHK+KFVA
Sbjct  457  FILQPMKRPWNATLVHYTLYKPSELSDCAKALHRLFLNSFGSSLPAIREKYSQHKFKFVA  516

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIPSE F+D
Sbjct  517  KKNCPPSIPSELFRD  531



>ref|XP_010684698.1| PREDICTED: cyclin-A1-4-like [Beta vulgaris subsp. vulgaris]
Length=504

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q  +E  S+QLE L++Y+AELSLL Y ML Y+PSL AASA+FLA+
Sbjct  367  APTTKCFLRRFIRAAQVMSEVPSMQLECLSNYVAELSLLDYSMLQYAPSLTAASAVFLAK  426

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PS+KPWNSTL HYTLY+P DL DCV ALH LC +SH S+LPAIREKYSQHKYKFVA
Sbjct  427  FILCPSQKPWNSTLLHYTLYEPCDLHDCVKALHQLCLSSHSSTLPAIREKYSQHKYKFVA  486

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP +IPSE+F   SS
Sbjct  487  KKCCPPTIPSEYFHSTSS  504



>ref|XP_009343978.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=515

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF  A Q  +E  S     L SY+ ELSLL Y MLCY+PSL+AASA FLA+
Sbjct  378  APTALCFLRRFCFAAQKTSEVPSEHFWCLTSYITELSLLEYSMLCYAPSLIAASAAFLAK  437

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L+P KKPWNSTLRHYTLYQ SDL DCV  LH LCCN   S+LPAIREKY QHKYKFVA
Sbjct  438  YILSPVKKPWNSTLRHYTLYQASDLFDCVKVLHQLCCNGCGSNLPAIREKYCQHKYKFVA  497

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIP EFFQD+S+
Sbjct  498  KKYCPPSIPPEFFQDLSN  515



>emb|CBI18983.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LR+F+ A QG N+  SLQLE LASYL ELSLL Y+MLCY+PSL+AASA FLAR+
Sbjct  207  PTTKCFLRQFIHAAQGNNKDPSLQLECLASYLTELSLLEYNMLCYAPSLIAASATFLARF  266

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
             L  ++KPWNS L HYT Y PS L DCV ALH+LCCN+H S LPAI+EKYSQHKYKFVAK
Sbjct  267  ILFSAEKPWNSMLGHYTHYLPSHLHDCVKALHHLCCNNHGSGLPAIKEKYSQHKYKFVAK  326

Query  376  KICPTSIPSEFFQDVSS  326
            K CP  +P EFF+D S 
Sbjct  327  KYCPPCVPPEFFEDPSD  343



>ref|XP_008338670.1| PREDICTED: cyclin-A1-4 [Malus domestica]
Length=522

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF  A Q  ++  S     LASY+ ELSLL Y MLCY+PSL+AASA FLA+
Sbjct  385  APTALCFLRRFCFAAQKTSKVPSEHFRCLASYITELSLLEYSMLCYAPSLIAASAAFLAK  444

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L+P KKPWNSTLRHYTLYQ SDL DCV ALH LCCN   S+LPA+REKY QHKYKFVA
Sbjct  445  YILSPLKKPWNSTLRHYTLYQASDLFDCVKALHQLCCNGCGSNLPAVREKYCQHKYKFVA  504

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIP EFFQD+S+
Sbjct  505  KKYCPPSIPPEFFQDLSN  522



>ref|XP_010915932.1| PREDICTED: cyclin-A1-4-like isoform X2 [Elaeis guineensis]
Length=533

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  712  RFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKP  533
            RFVRA QG +E   LQLE LA+Y+AELSLL Y+MLCYSPSL+AASAIFLA++ L P+K+P
Sbjct  405  RFVRAAQGCDEVPLLQLEFLANYVAELSLLEYNMLCYSPSLIAASAIFLAKFILQPTKRP  464

Query  532  WNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIP  353
            WN+TL HYTLY+PS+L DC  ALH L  NS  SSLPA+REKYSQHK+KFVAKK CP SIP
Sbjct  465  WNATLVHYTLYKPSELYDCAKALHRLFLNSSGSSLPAVREKYSQHKFKFVAKKNCPPSIP  524

Query  352  SEFFQ  338
            SEFFQ
Sbjct  525  SEFFQ  529



>ref|XP_007019153.1| Cyclin A1,1, putative [Theobroma cacao]
 gb|EOY16378.1| Cyclin A1,1, putative [Theobroma cacao]
Length=499

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LR FV A Q  N+  S+Q E LA+Y+ ELSLL Y ML Y+PSL+AASA FLA++
Sbjct  363  PTAKFFLRHFVHAAQMINQVQSMQFECLANYIMELSLLEYTMLHYAPSLIAASAAFLAKF  422

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
             L+P+KKPW+S L HYT YQPSD+RDCV +LH+LC N   ++LPAIREKYSQHKYKFVAK
Sbjct  423  ILSPTKKPWDSILEHYTPYQPSDMRDCVKSLHHLCRNGGRANLPAIREKYSQHKYKFVAK  482

Query  376  KICPTSIPSEFFQDVS  329
            K CP SIP EFFQD+S
Sbjct  483  KYCPASIPQEFFQDLS  498



>ref|XP_010664179.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=424

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LR+F+ A QG N+  SLQLE LASYL ELSLL Y+MLCY+PSL+AASA FLAR+
Sbjct  288  PTTKCFLRQFIHAAQGNNKDPSLQLECLASYLTELSLLEYNMLCYAPSLIAASATFLARF  347

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
             L  ++KPWNS L HYT Y PS L DCV ALH+LCCN+H S LPAI+EKYSQHKYKFVAK
Sbjct  348  ILFSAEKPWNSMLGHYTHYLPSHLHDCVKALHHLCCNNHGSGLPAIKEKYSQHKYKFVAK  407

Query  376  KICPTSIPSEFFQDVS  329
            K CP  +P EFF+D S
Sbjct  408  KYCPPCVPPEFFEDPS  423



>gb|KHG23907.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=493

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG  E   +QLE +A+Y+ ELSLL Y MLC+ PSL+AASAIFLA+
Sbjct  360  APTAKCFLRRFVRAAQGIIEVPLMQLECMANYITELSLLEYSMLCHPPSLIAASAIFLAK  419

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSKKPWNSTL+HYTLY+PSDL DCV  LH LCCN ++S+LPAIREKY+QHKYK VA
Sbjct  420  FILLPSKKPWNSTLQHYTLYKPSDLCDCVKDLHRLCCN-NNSTLPAIREKYNQHKYKCVA  478

Query  379  KKICPTSIPSEFFQD  335
            KK  P SIPSEFFQ+
Sbjct  479  KKNWPPSIPSEFFQN  493



>ref|XP_009126172.1| PREDICTED: cyclin-A1-1-like [Brassica rapa]
Length=426

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF RA QG +EA  +QLE +ASY+AELSLL Y ML +SPSLVAASAIFLA+YTL P+
Sbjct  295  FLRRFSRAAQGVHEAPCMQLECMASYIAELSLLEYTMLSHSPSLVAASAIFLAKYTLDPT  354

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            ++PWNSTLRHYT Y+  +LR CVM L  LC N+H S+LPA+R+KYSQHKYKFVAKK CP+
Sbjct  355  RRPWNSTLRHYTQYEAMELRGCVMDLQRLCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPS  414

Query  361  SIPSEFFQD  335
             IP +FF++
Sbjct  415  IIPPDFFKN  423



>dbj|BAC56853.1| cyclin A1 [Silene latifolia]
Length=487

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA Q  NE  + QLE LA+Y+AELSLL Y ML Y+PSL+AAS++FLA+
Sbjct  351  APTTKNFLRRFVRAAQVMNEVPAFQLECLANYVAELSLLEYSMLKYAPSLIAASSVFLAK  410

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y LT S +PWN+TLRHYTLY+ SDL +CV ALH LC NSH SSLPAIREKYS HKYK VA
Sbjct  411  YMLT-SSRPWNATLRHYTLYEASDLEECVKALHQLCLNSHISSLPAIREKYSHHKYKSVA  469

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP+SIP+E+FQ+ S
Sbjct  470  KKHCPSSIPAEYFQNSS  486



>ref|XP_010260855.1| PREDICTED: cyclin-A1-4 [Nelumbo nucifera]
Length=497

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  QG +E   L LE +A+YLAELSLL Y +LCY+PS++AASAIFLA+
Sbjct  359  APTAKCFLRRFVRVAQGSSELPLLHLECMANYLAELSLLEYSVLCYAPSMIAASAIFLAK  418

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L+P K+PWN+TL HYT Y+PS+L +CV  LH L CNS ++SLPAIREKYSQHKYKFVA
Sbjct  419  FILSPLKRPWNATLGHYTQYKPSELCECVKMLHRLFCNSFNTSLPAIREKYSQHKYKFVA  478

Query  379  KKICPTSIPSEFFQDVSS  326
            KK CP SIP E+F D+SS
Sbjct  479  KKYCPPSIPVEYFHDISS  496



>gb|KJB64518.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
 gb|KJB64520.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
Length=482

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LR+FV A +  N+   LQ E LA+Y+AELSLL Y ML Y+PSL+AASA FLAR+
Sbjct  348  PTTKFFLRQFVCAAEMINQVQLLQFECLANYIAELSLLEYTMLHYAPSLIAASAAFLARF  407

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
             L+PS+KPW+S L HYTLYQPSD  +CV ALH+LC N   ++LPAIREKYSQHKYKFVAK
Sbjct  408  ILSPSRKPWDSMLGHYTLYQPSDFGNCVKALHHLCRNGGGANLPAIREKYSQHKYKFVAK  467

Query  376  KICPTSIPSEFFQDV  332
            K CP SIP EFFQDV
Sbjct  468  KYCPASIPEEFFQDV  482



>emb|CDX85466.1| BnaA02g03470D [Brassica napus]
Length=422

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF RA QG +EA  +QLE +ASY+AELSLL Y ML + PSLVAASAIFLA+YTL P+
Sbjct  291  FLRRFSRAAQGVHEAPCMQLECMASYIAELSLLEYTMLSHPPSLVAASAIFLAKYTLDPT  350

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            ++PWNSTLRHYT Y+  +LR CVM L  LC N+H S+LPA+R+KYSQHKYKFVAKK CP+
Sbjct  351  RRPWNSTLRHYTQYEAMELRGCVMDLQRLCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPS  410

Query  361  SIPSEFFQD  335
             IP +FF++
Sbjct  411  IIPPDFFKN  419



>gb|KFK24211.1| hypothetical protein AALP_AAs42301U000600 [Arabis alpina]
Length=444

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA  G +EA  +QLE +A+Y+AELSLL Y ML YSPSLVAASAIFLA+
Sbjct  309  APTTKCFLRRFVRAAHGVHEAPLMQLECMANYIAELSLLEYTMLSYSPSLVAASAIFLAK  368

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+++PWNSTL+HYT Y+  +LR CV  L  LC N+H S+LPA+REKYSQHKYKFVA
Sbjct  369  YILDPTRRPWNSTLQHYTQYKALELRGCVKDLQRLCSNAHASTLPAVREKYSQHKYKFVA  428

Query  379  KKICPTSIPSEFFQD  335
            KK CP+ IP EFF +
Sbjct  429  KKFCPSIIPQEFFNN  443



>ref|XP_010532201.1| PREDICTED: cyclin-A1-1-like isoform X2 [Tarenaya hassleriana]
Length=501

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG  EA S+QLE LA+Y+AELSLL Y ML +  SLVAASAIFLA+Y L P+
Sbjct  370  FLRRFVRAAQGITEAPSMQLECLANYIAELSLLEYSMLPHPMSLVAASAIFLAKYILDPT  429

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            + PWNSTL+HYTLY+ SDLR CV  LH LCC +  S+LPA+REKYSQHKYKFVA+K CP 
Sbjct  430  RSPWNSTLKHYTLYEASDLRKCVKDLHRLCCGACTSTLPAVREKYSQHKYKFVARKFCPP  489

Query  361  SIPSEFFQDVSS  326
             IP EFF +  S
Sbjct  490  IIPPEFFHNNES  501



>ref|XP_010532200.1| PREDICTED: cyclin-A1-1-like isoform X1 [Tarenaya hassleriana]
Length=503

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG  EA S+QLE LA+Y+AELSLL Y ML +  SLVAASAIFLA+Y L P+
Sbjct  372  FLRRFVRAAQGITEAPSMQLECLANYIAELSLLEYSMLPHPMSLVAASAIFLAKYILDPT  431

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            + PWNSTL+HYTLY+ SDLR CV  LH LCC +  S+LPA+REKYSQHKYKFVA+K CP 
Sbjct  432  RSPWNSTLKHYTLYEASDLRKCVKDLHRLCCGACTSTLPAVREKYSQHKYKFVARKFCPP  491

Query  361  SIPSEFFQDVSS  326
             IP EFF +  S
Sbjct  492  IIPPEFFHNNES  503



>emb|CDY02719.1| BnaC02g07160D [Brassica napus]
Length=429

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF RA QG +EA  +QLE +ASY+AELSLL Y ML + PSLVAASAIFLA+YTL P+
Sbjct  300  FLRRFSRAAQGVHEAPCMQLECMASYIAELSLLEYTMLSHPPSLVAASAIFLAKYTLDPT  359

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            ++PWNSTL+HYT Y+  +LR CVM L  LC N+H S+LPA+R+KYSQHKYKFVAKK CP+
Sbjct  360  RRPWNSTLQHYTQYEALELRGCVMDLQRLCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPS  419

Query  361  SIPSEFFQD  335
             IP EFF++
Sbjct  420  IIPPEFFKN  428



>ref|XP_006393746.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
 gb|ESQ31032.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
Length=481

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA  G +EA  +QLE +A+Y+AELSLL Y ML +SPSLVAASAIFLA+
Sbjct  346  APTTKCFLRRFVRAAHGVHEAPLMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAK  405

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+++PWNSTL+HYT Y+  +LR CV  L  LC N+H S+LPA+REKYSQHKYKFVA
Sbjct  406  YILDPTRRPWNSTLQHYTQYRAMELRGCVKDLQRLCSNAHVSTLPAVREKYSQHKYKFVA  465

Query  379  KKICPTSIPSEFFQD  335
            KK CP+ IP EFF +
Sbjct  466  KKFCPSIIPQEFFNN  480



>ref|XP_006307397.1| hypothetical protein CARUB_v10009020mg [Capsella rubella]
 gb|EOA40295.1| hypothetical protein CARUB_v10009020mg [Capsella rubella]
Length=476

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA  G +EA  +QLE +A+Y+AELSLL Y ML +SPSLVAASAIFLA+
Sbjct  341  APTTKCFLRRFVRAAHGIHEAPLMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAK  400

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+++PWN TL+HYT Y+ S+LR CV  L  LC  SH S+LPA+REKYSQHKYKFVA
Sbjct  401  YILDPTRRPWNPTLQHYTQYKASELRGCVKDLQRLCSTSHGSTLPAVREKYSQHKYKFVA  460

Query  379  KKICPTSIPSEFFQD  335
            KK CP+ IP EFF +
Sbjct  461  KKFCPSIIPQEFFNN  475



>ref|NP_175077.1| cyclin-A1-1 [Arabidopsis thaliana]
 sp|Q9C6Y3.1|CCA11_ARATH RecName: Full=Cyclin-A1-1; AltName: Full=G2/mitotic-specific 
cyclin-A1-1; Short=CycA1;1 [Arabidopsis thaliana]
 gb|AAG50557.1|AC074228_12 mitotic cyclin a2-type, putative [Arabidopsis thaliana]
 dbj|BAD43169.1| putative mitotic cyclin a2-type [Arabidopsis thaliana]
 gb|AEE32021.1| cyclin-A1-1 [Arabidopsis thaliana]
Length=460

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA  G +EA  +QLE +A+Y+AELSLL Y ML +SPSLVAASAIFLA+
Sbjct  325  APTTKCFLRRFVRAAHGVHEAPLMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAK  384

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+++PWNSTL+HYT Y+  +LR CV  L  LC  +H S+LPA+REKYSQHKYKFVA
Sbjct  385  YILDPTRRPWNSTLQHYTQYKAMELRGCVKDLQRLCSTAHGSTLPAVREKYSQHKYKFVA  444

Query  379  KKICPTSIPSEFFQD  335
            KK CP+ IP EFF +
Sbjct  445  KKFCPSVIPQEFFNN  459



>ref|XP_002893979.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70238.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
Length=467

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA  G +EA  +QLE +A+Y+AELSLL Y ML +SPSLVAASAIFLA+
Sbjct  332  APTTKCFLRRFVRAAHGVHEAPLMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAK  391

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+++PWNSTL+HYT Y+  +LR CV  L  LC  +H S+LPA+REKYSQHKYKFVA
Sbjct  392  YILDPTRRPWNSTLQHYTQYKAMELRGCVKDLQRLCSTAHGSTLPAVREKYSQHKYKFVA  451

Query  379  KKICPTSIPSEFFQD  335
            KK CP+ IP EFF +
Sbjct  452  KKFCPSIIPQEFFNN  466



>gb|KHN05188.1| Cyclin-A1-1 [Glycine soja]
Length=503

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -3

Query  718  LRRFVRAT-QGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LRRFVRA      E  SLQLE L +++AELSLL Y MLCY PS +AASAIFLAR+ L PS
Sbjct  375  LRRFVRAAAHDVQEIPSLQLECLTNFIAELSLLEYSMLCYPPSQIAASAIFLARFILFPS  434

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            KKPWNSTL+HYTLY+PSDL  CV  LH LCC+SH S+LPAIR+KYSQHKYK VAKK  P 
Sbjct  435  KKPWNSTLQHYTLYRPSDLCACVKDLHRLCCSSHDSNLPAIRDKYSQHKYKCVAKKCIPP  494

Query  361  SIPSEFFQ  338
            SIP E FQ
Sbjct  495  SIPQEVFQ  502



>ref|NP_001241939.1| uncharacterized protein LOC100776207 [Glycine max]
 gb|ACU22685.1| unknown [Glycine max]
Length=503

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -3

Query  718  LRRFVRAT-QGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LRRFVRA      E  SLQLE L +++AELSLL Y MLCY PS +AASAIFLAR+ L PS
Sbjct  375  LRRFVRAAAHDVQEIPSLQLECLTNFIAELSLLEYSMLCYPPSQIAASAIFLARFILFPS  434

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            KKPWNSTL+HYTLY+PSDL  CV  LH LCC+SH S+LPAIR+KYSQHKYK VAKK  P 
Sbjct  435  KKPWNSTLQHYTLYRPSDLCACVKDLHRLCCSSHDSNLPAIRDKYSQHKYKCVAKKCIPP  494

Query  361  SIPSEFFQ  338
            SIP E FQ
Sbjct  495  SIPQEVFQ  502



>ref|XP_010095429.1| hypothetical protein L484_013386 [Morus notabilis]
 gb|EXB60121.1| hypothetical protein L484_013386 [Morus notabilis]
Length=498

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFV   Q  +E  S+ +E +A+YLAELSLL Y MLCY+PSL+AASA FLA+
Sbjct  361  APTAICFLRRFVCVAQLTSEVPSMHMECMANYLAELSLLDYGMLCYAPSLIAASATFLAK  420

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L+P  KPWNSTL  YT YQ SDLR+CV ALH+L C+  +S+LPAIREKYS HKYKFVA
Sbjct  421  YILSPVNKPWNSTLMSYTFYQASDLRECVKALHHLWCSGSNSNLPAIREKYSHHKYKFVA  480

Query  379  KKICPTSIPSEFFQDVS  329
            +K CP S+P EFFQD+S
Sbjct  481  QKYCPLSLPPEFFQDLS  497



>ref|XP_002455447.1| hypothetical protein SORBIDRAFT_03g010940 [Sorghum bicolor]
 gb|EES00567.1| hypothetical protein SORBIDRAFT_03g010940 [Sorghum bicolor]
Length=505

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF RA Q  +E  +L LE LA+Y+AELSLL Y++L Y PSL+AASAIFLAR
Sbjct  368  APTAKCFLRRFARAAQACDEDPALHLEFLANYIAELSLLEYNLLSYPPSLIAASAIFLAR  427

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L DCV ALH LC     ++LPAIREKYSQHKYKFVA
Sbjct  428  FILQPTKYPWNSTLAHYTQYKPSELSDCVKALHRLCSVGSGTNLPAIREKYSQHKYKFVA  487

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP  IP+EFF+D +
Sbjct  488  KKQCPPQIPTEFFRDAT  504



>gb|ADA70359.1| mitotic cyclin A1-like protein [Persea americana]
Length=479

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFV+  Q  +E   L LE LA+Y+AELSLL Y  LCY+PSL+AASA+F+A     PS
Sbjct  348  FLRRFVQVAQAGSETRLLHLEFLANYVAELSLLEYSFLCYAPSLIAASALFVANLYHQPS  407

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K+PWN+TL+HYTLY+PS+L  CV ALHNL C+SH +SLPAIREKYSQHKYKFVAKK CP+
Sbjct  408  KRPWNATLQHYTLYKPSELCSCVNALHNLFCDSHSNSLPAIREKYSQHKYKFVAKKCCPS  467

Query  361  SIPSEFFQDV  332
            +IP EFF D+
Sbjct  468  TIPLEFFYDL  477



>ref|XP_002457051.1| hypothetical protein SORBIDRAFT_03g000520 [Sorghum bicolor]
 gb|EES02171.1| hypothetical protein SORBIDRAFT_03g000520 [Sorghum bicolor]
Length=533

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF RA Q  +E  +L LE LA+Y+AELSLL Y++L Y PSL+AASA+FLARY L P+
Sbjct  377  FLRRFARAAQACDEDPALHLEFLANYIAELSLLEYNLLSYPPSLIAASAVFLARYVLQPT  436

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K PWNSTL HYT Y+PS+L DCV ALH L      S+LPAIREKYSQHKYKFVA+K CP 
Sbjct  437  KYPWNSTLAHYTQYKPSELSDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVARKQCPP  496

Query  361  SIPSEFFQDVS  329
            SIP+EFF+DV+
Sbjct  497  SIPTEFFRDVT  507



>ref|XP_004967382.1| PREDICTED: cyclin-A1-1-like [Setaria italica]
Length=506

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF RA Q  +E  +L LE LASY+AELSLL Y++L Y PSL+AASAIFLA+
Sbjct  369  APTAKCFLRRFARAAQACDEDPALHLEFLASYIAELSLLEYNLLSYPPSLIAASAIFLAK  428

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS L DCV ALH+L      S+LPAIREKYSQHKYKFVA
Sbjct  429  FVLQPTKYPWNSTLAHYTQYKPSQLCDCVKALHHLFSVGPASNLPAIREKYSQHKYKFVA  488

Query  379  KKICPTSIPSEFFQDVS  329
            KK CPTSIP+EFF+DV+
Sbjct  489  KKQCPTSIPTEFFRDVT  505



>gb|EEC70247.1| hypothetical protein OsI_01036 [Oryza sativa Indica Group]
Length=262

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  125  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  184

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKY+QHKYKFVA
Sbjct  185  FILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYTQHKYKFVA  244

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP S+PSEFF+DV+
Sbjct  245  KKHCPPSVPSEFFRDVT  261



>gb|KHN38997.1| Cyclin-A1-1 [Glycine soja]
Length=504

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -3

Query  718  LRRFVRAT-QGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LRRFVRA      E  SLQLE+L +++AELSLL Y ML Y PSLVAAS IFLAR+ L PS
Sbjct  375  LRRFVRAAAHDVQEIPSLQLEYLTNFIAELSLLEYSMLSYPPSLVAASVIFLARFILFPS  434

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            KKPWNSTL+HYTLY+PSDL  CV  LH LCC+SH S+LPAIR+KYSQHKYK VAKK  P 
Sbjct  435  KKPWNSTLQHYTLYRPSDLCACVKDLHRLCCSSHDSNLPAIRDKYSQHKYKCVAKKHIPP  494

Query  361  SIPSEFFQ  338
            SIP E FQ
Sbjct  495  SIPREVFQ  502



>ref|XP_003545652.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=504

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -3

Query  718  LRRFVRAT-QGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LRRFVRA      E  SLQLE+L +++AELSLL Y ML Y PSL+AAS IFLAR+ L PS
Sbjct  375  LRRFVRAAAHDVQEIPSLQLEYLTNFIAELSLLEYSMLSYPPSLIAASVIFLARFILFPS  434

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            KKPWNSTL+HYTLY+PSDL  CV  LH LCC+SH S+LPAIR+KYSQHKYK VAKK  P 
Sbjct  435  KKPWNSTLQHYTLYRPSDLCACVKDLHRLCCSSHDSNLPAIRDKYSQHKYKCVAKKHIPP  494

Query  361  SIPSEFFQ  338
            SIP E FQ
Sbjct  495  SIPREVFQ  502



>emb|CDY25649.1| BnaC05g25280D [Brassica napus]
Length=437

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF RA  G NEA  +QLE +A+Y+AELSLL Y ML +SPSLVAASAIFLA Y L P+
Sbjct  301  FLRRFFRAAHGVNEAPCMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLATYILDPT  360

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            ++PWNSTL+HYT Y   +LR CV  L   C N+H S+LPA+R+KYSQHKYKFVAKK CP+
Sbjct  361  RRPWNSTLQHYTQYGAMELRGCVKDLQRFCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPS  420

Query  361  SIPSEFFQD  335
             IP EFF +
Sbjct  421  IIPPEFFNN  429



>gb|ABG21984.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABG21985.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEE53081.1| hypothetical protein OsJ_35837 [Oryza sativa Japonica Group]
Length=345

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  208  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  267

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L C    S+LPAIREKY+QHKYKFVA
Sbjct  268  FILQPAKHPWNSTLAHYTQYKSSELSDCVKALHRLFCVGPGSNLPAIREKYTQHKYKFVA  327

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIP+EFF+D
Sbjct  328  KKPCPPSIPTEFFRD  342



>ref|XP_010500134.1| PREDICTED: cyclin-A1-1-like [Camelina sativa]
Length=474

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA  G +E  S+QLE +ASY+AELSLL Y ML +SPSLVAAS+IFLA+
Sbjct  339  APTTKCFLRRFVRAAHGVHETPSMQLECMASYIAELSLLEYTMLSHSPSLVAASSIFLAK  398

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+ +PWN TL+HYT Y+  +LR CV  L  LC  +H S+LPA+REKYSQHKYKFVA
Sbjct  399  YILEPTIRPWNPTLQHYTQYKALELRGCVKDLQRLCITAHGSTLPAVREKYSQHKYKFVA  458

Query  379  KKICPTSIPSEFFQD  335
            KK CP+ IP EFF +
Sbjct  459  KKFCPSVIPQEFFNN  473



>ref|XP_010461434.1| PREDICTED: cyclin-A1-1-like [Camelina sativa]
Length=486

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA  G +E  S+QLE +ASY+AELSLL Y ML +SPSLVAAS+IFLA+
Sbjct  351  APTTKCFLRRFVRAAHGVHETPSMQLECMASYIAELSLLEYTMLSHSPSLVAASSIFLAK  410

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+ +PWN TL+HYT Y+  +LR CV  L  LC  +H S+LPA+REKYSQHKYKFVA
Sbjct  411  YILEPTIRPWNPTLQHYTQYKALELRGCVKDLQRLCSTAHGSTLPAVREKYSQHKYKFVA  470

Query  379  KKICPTSIPSEFFQD  335
            KK CP+ IP EFF +
Sbjct  471  KKFCPSVIPQEFFNN  485



>ref|XP_004289008.1| PREDICTED: cyclin-A1-1-like [Fragaria vesca subsp. vesca]
Length=299

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -3

Query  718  LRRFVRATQGFN-EASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            L RFVRA +G N E  SL LE LA YLAELSLL Y MLCY+PSL+AASAIFLA Y + PS
Sbjct  172  LSRFVRAARGANHELPSLHLECLAKYLAELSLLDYSMLCYAPSLIAASAIFLANYIMLPS  231

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            KKPWN+TL+HYTLY PSDL DCV  LH LC ++  S LPAIREKYS+H+YK VA+K CP 
Sbjct  232  KKPWNATLKHYTLYHPSDLPDCVKDLHRLCYDNPSSGLPAIREKYSEHEYKCVAEKHCPA  291

Query  361  SIPSEF  344
            +IP+E+
Sbjct  292  TIPTEY  297



>ref|XP_006472825.1| PREDICTED: cyclin-A1-1-like isoform X2 [Citrus sinensis]
Length=511

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   L RF+RA Q  N+A S+Q E LA+Y+ ELSLL Y+MLCYSPSL+AASA FLA 
Sbjct  375  APTAKCFLMRFIRAAQRSNKAPSMQFECLANYILELSLLDYNMLCYSPSLIAASATFLAN  434

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P KKPWNSTL HYT YQPSDL DCV ALH L C+   S+L AIREKYSQHKYK+VA
Sbjct  435  FILYPLKKPWNSTLGHYTFYQPSDLCDCVKALHRLFCDGGLSNLSAIREKYSQHKYKYVA  494

Query  379  KKICPTSIPSEFFQDVS  329
            KK C +SI  E F+D S
Sbjct  495  KKHCSSSILPEIFEDPS  511



>ref|XP_006472824.1| PREDICTED: cyclin-A1-1-like isoform X1 [Citrus sinensis]
Length=516

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   L RF+RA Q  N+A S+Q E LA+Y+ ELSLL Y+MLCYSPSL+AASA FLA 
Sbjct  380  APTAKCFLMRFIRAAQRSNKAPSMQFECLANYILELSLLDYNMLCYSPSLIAASATFLAN  439

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P KKPWNSTL HYT YQPSDL DCV ALH L C+   S+L AIREKYSQHKYK+VA
Sbjct  440  FILYPLKKPWNSTLGHYTFYQPSDLCDCVKALHRLFCDGGLSNLSAIREKYSQHKYKYVA  499

Query  379  KKICPTSIPSEFFQDVS  329
            KK C +SI  E F+D S
Sbjct  500  KKHCSSSILPEIFEDPS  516



>ref|XP_006859067.1| PREDICTED: cyclin-A1-4 [Amborella trichopoda]
 gb|ERN20534.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
Length=498

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF +A Q  NE   LQLE LA+YLAELSLL Y  LCY PSL+AASAIFLA+
Sbjct  362  TPTAKSFLRRFFKAAQVSNEVPWLQLEFLANYLAELSLLEYSSLCYFPSLIAASAIFLAK  421

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS--SLPAIREKYSQHKYKF  386
            + L PSK+PWN+TLRHYTLY+PSDLR+CV AL  L  NS  S  +LPAIREKYSQHKYK 
Sbjct  422  FMLYPSKRPWNATLRHYTLYRPSDLRNCVKALEVLHSNSQSSNTNLPAIREKYSQHKYKC  481

Query  385  VAKKICPTSIPSEFFQD  335
            VAK  CP +IP+EFFQD
Sbjct  482  VAKYPCPPAIPAEFFQD  498



>gb|EEC70248.1| hypothetical protein OsI_01039 [Oryza sativa Indica Group]
Length=506

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  369  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  428

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L C    S+LPAIREKY+QHKYKFVA
Sbjct  429  FILQPAKHPWNSTLAHYTQYKSSELSDCVKALHRLFCVGPGSNLPAIREKYTQHKYKFVA  488

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIP+EFF+D
Sbjct  489  KKPCPPSIPTEFFRD  503



>sp|Q0INT0.2|CCA13_ORYSJ RecName: Full=Cyclin-A1-3; AltName: Full=G2/mitotic-specific 
cyclin-A1-3; Short=CycA1;3 [Oryza sativa Japonica Group]
 gb|ABG21983.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=491

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  354  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  413

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L C    S+LPAIREKY+QHKYKFVA
Sbjct  414  FILQPAKHPWNSTLAHYTQYKSSELSDCVKALHRLFCVGPGSNLPAIREKYTQHKYKFVA  473

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIP+EFF+D
Sbjct  474  KKPCPPSIPTEFFRD  488



>ref|XP_002454880.1| hypothetical protein SORBIDRAFT_03g000690 [Sorghum bicolor]
 gb|EER99999.1| hypothetical protein SORBIDRAFT_03g000690 [Sorghum bicolor]
Length=502

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF R+ Q  +E  +L LE LASY+AELSLL Y++L Y PSL+AASAIFLAR
Sbjct  366  APTAKCFLRRFARSAQACDEDPALHLEFLASYIAELSLLEYNLLSYPPSLIAASAIFLAR  425

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+LPAIREKYSQHKYKFVA
Sbjct  426  FILQPTKYPWNSTLSHYTQYKPSELSDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVA  485

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP  IP+EFF+D +
Sbjct  486  KKQCPPQIPTEFFRDTT  502



>ref|XP_008352624.1| PREDICTED: cyclin-A1-1-like [Malus domestica]
Length=479

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG NE +S+QLE LA+Y+AELSLL Y MLCY+PSL+AASAIFLA 
Sbjct  364  APTTKCFLRRFLRAAQGANEVTSMQLECLANYIAELSLLEYSMLCYAPSLIAASAIFLAN  423

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHK  395
            Y L PSK+PWN+TL HYTLYQPSDL DC+ ALH LCC+S  SSLPAIREKYSQHK
Sbjct  424  YILLPSKRPWNATLHHYTLYQPSDLLDCINALHRLCCDSQTSSLPAIREKYSQHK  478



>ref|XP_008656316.1| PREDICTED: cyclin-A1-4-like [Zea mays]
Length=194

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LRRFVR  Q  ++ SSL LE L +Y+ ELSLL Y +LCY PS+VAAS++FLA++
Sbjct  58   PTAKCFLRRFVRVAQVPDKGSSLHLEFLVNYICELSLLEYSLLCYLPSMVAASSVFLAKF  117

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
             L P K PWNS+L +YT Y PS+LR CV  LH L      S+LPAIREKYSQHKYKFVAK
Sbjct  118  ILMPIKNPWNSSLSYYTRYTPSELRGCVRVLHRLFRLGPGSNLPAIREKYSQHKYKFVAK  177

Query  376  KICPTSIPSEFFQDVSS  326
            K CP SIP++FFQD++S
Sbjct  178  KYCPQSIPTKFFQDLTS  194



>ref|XP_009145051.1| PREDICTED: cyclin-A1-1 [Brassica rapa]
 emb|CDY65994.1| BnaA05g35600D [Brassica napus]
Length=443

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF RA  G NEA  +QLE +A+Y+AELSLL Y ML +SPSLVAASAIFLA 
Sbjct  301  APTAKCFLRRFFRAAHGVNEAPCMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAM  360

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+++PWNSTL+ YT Y   +LR CV  L   C N+H S+LPA+R+KYSQHKYKFVA
Sbjct  361  YILDPTRRPWNSTLQLYTQYGAMELRGCVKDLQRFCSNAHVSTLPAVRDKYSQHKYKFVA  420

Query  379  KKICPTSIPSEFFQD  335
            KK CP+ IP EFF +
Sbjct  421  KKFCPSIIPPEFFNN  435



>ref|XP_003630475.1| Cyclin A-like protein [Medicago truncatula]
Length=531

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG +E  SLQLE L +++AELSLL Y MLCY+PSL+AAS+IFLA+Y L P+
Sbjct  380  FLRRFVRAAQGIDEVPSLQLECLTNFIAELSLLEYSMLCYAPSLIAASSIFLAKYMLFPA  439

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKK  374
             KPWN TL+HYT YQPSDL  CV  LH LCCNS +S+LPAI+EKY+QHKYK+VA K
Sbjct  440  MKPWNPTLQHYTQYQPSDLCACVKDLHRLCCNSPNSNLPAIKEKYNQHKYKYVANK  495



>ref|NP_001042512.1| Os01g0233500 [Oryza sativa Japonica Group]
 sp|Q7F830.1|CCA11_ORYSJ RecName: Full=Cyclin-A1-1; AltName: Full=G2/mitotic-specific 
cyclin-A1-1; Short=CycA1;1 [Oryza sativa Japonica Group]
 dbj|BAA86628.1| cyclin [Oryza sativa]
 dbj|BAA96590.1| putative type A-like cyclin [Oryza sativa Japonica Group]
 dbj|BAF04426.1| Os01g0233500 [Oryza sativa Japonica Group]
Length=508

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  371  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  430

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKY+QHKYKFVA
Sbjct  431  FILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYTQHKYKFVA  490

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP SIP+EFF+D +
Sbjct  491  KKPCPPSIPTEFFRDAT  507



>gb|AAA51660.1| cyclin [Brassica napus]
Length=425

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRR        +EA  +QLE +ASY+AELSLL Y ML + PSLVAASAIFLA+YTL P+
Sbjct  294  FLRRLFSGCPRVHEAPCMQLECMASYIAELSLLEYTMLSHPPSLVAASAIFLAKYTLDPT  353

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            ++PWNSTLRHYT Y+  +LR CVM L  LC N+H S+LPA+R+KYSQHKYKFVAKK CP+
Sbjct  354  RRPWNSTLRHYTQYEAMELRGCVMDLQRLCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPS  413

Query  361  SIPSEFFQD  335
             IP +FF++
Sbjct  414  IIPPDFFKN  422



>ref|NP_001288521.1| uncharacterized protein LOC103649996 [Zea mays]
 ref|XP_008673897.1| PREDICTED: cyclin-A1-1 [Zea mays]
 ref|XP_008673900.1| PREDICTED: cyclin-A1-1-like [Zea mays]
 gb|ACF87709.1| unknown [Zea mays]
Length=509

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF RA Q  +E  +L LE LA+Y+AELSLL Y +L Y PSL+AASAIFLAR
Sbjct  372  APTAKCFLRRFARAAQACDEDPALHLEFLANYIAELSLLEYSLLSYPPSLIAASAIFLAR  431

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS L +CV ALH LC     S+LPAIREKYSQHKYKFVA
Sbjct  432  FILQPTKYPWNSTLAHYTQYKPSKLSECVKALHRLCSVGSGSNLPAIREKYSQHKYKFVA  491

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP  IP+EFF+D +
Sbjct  492  KKQCPPQIPTEFFRDTT  508



>dbj|BAJ94732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=515

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA Q  +E   L LE LA+Y+AELSLL Y +L Y PSLVAASAIFL++
Sbjct  378  APTAKCFLRRFVRAAQVCDEDPPLHLEFLANYVAELSLLEYSLLAYPPSLVAASAIFLSK  437

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+LPAIREKYSQHKYKFV 
Sbjct  438  FILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVG  497

Query  379  KKICPTSIPSEFFQDVS  329
            KK CPTS+P+EFF+D +
Sbjct  498  KKQCPTSVPAEFFRDAA  514



>gb|AIL50247.1| Ttam-3D [Triticum aestivum]
Length=510

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA Q  +E   L LE LA+Y+AELSLL Y +L Y PSLVAASAIFL++
Sbjct  373  APTAKCFLRRFVRAAQVCDEDPPLHLEFLANYVAELSLLEYSLLAYPPSLVAASAIFLSK  432

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+LPAIREKYSQHKYKFV 
Sbjct  433  FILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVG  492

Query  379  KKICPTSIPSEFFQDVS  329
            KK CPTS+P+EFF+D +
Sbjct  493  KKQCPTSVPAEFFRDAA  509



>gb|AIL50245.1| Ttam-3A [Triticum turgidum]
Length=513

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA Q  +E   L LE LA+Y+AELSLL Y +L Y PSLVAASAIFL++
Sbjct  376  APTAKCFLRRFVRAAQVCDEDPPLHLEFLANYVAELSLLEYSLLAYPPSLVAASAIFLSK  435

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+LPAIREKYSQHKYKFV 
Sbjct  436  FILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVG  495

Query  379  KKICPTSIPSEFFQDVS  329
            KK CPTS+P+EFF+D +
Sbjct  496  KKQCPTSVPAEFFRDAA  512



>ref|XP_006643958.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=496

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  359  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  418

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKYSQHKYKFVA
Sbjct  419  FILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVA  478

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP S+P+EFF++ +
Sbjct  479  KKHCPPSVPTEFFRNAT  495



>ref|XP_006645684.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=538

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  401  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  460

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKYSQHKYKFVA
Sbjct  461  FILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVA  520

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP S+P+EFF++ +
Sbjct  521  KKHCPPSVPTEFFRNAA  537



>emb|CDM82517.1| unnamed protein product [Triticum aestivum]
 gb|AIL50246.1| Ttam-3B [Triticum turgidum]
Length=510

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA Q  +E   L LE LA+Y+AELSLL Y +L Y PSLVAASAIFL++
Sbjct  373  APTAKCFLRRFVRAAQVCDEDPPLHLEFLANYVAELSLLEYSLLAYPPSLVAASAIFLSK  432

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+LPAIREKYSQHKYKFV 
Sbjct  433  FILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVG  492

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP+S+P+EFF+D +
Sbjct  493  KKQCPSSVPAEFFRDAA  509



>ref|XP_007019154.1| Cyclin A1,1, putative isoform 1 [Theobroma cacao]
 gb|EOY16379.1| Cyclin A1,1, putative isoform 1 [Theobroma cacao]
Length=393

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LR FV A Q  N+   LQ E LA+Y+AELSLL Y ML Y+PSL+AASA+FLA++
Sbjct  260  PTAKSFLRHFVHAAQMINQVQFLQFECLANYIAELSLLEYIMLHYAPSLIAASAVFLAKF  319

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
             L+PS+KPW+S L  YTLYQPS+L +CV  LH+LC N    +L AI++KYSQHKYKFVA+
Sbjct  320  ILSPSRKPWDSMLGRYTLYQPSELYNCVKDLHHLCLNGDCPNLAAIKQKYSQHKYKFVAE  379

Query  376  KICPTSIPSEFFQD  335
            K CP+SIP EFF+D
Sbjct  380  KDCPSSIPQEFFRD  393



>ref|XP_010521286.1| PREDICTED: cyclin-A1-2 isoform X2 [Tarenaya hassleriana]
Length=493

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVRA QG NE   +QLE LASYLAELSLL Y ML Y PSLVAASA+FLARY L PS
Sbjct  363  FLRRFVRAAQGTNEVLPVQLECLASYLAELSLLDYAMLQYLPSLVAASAVFLARYILEPS  422

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNS--HHSSLPAIREKYSQHKYKFVAKKIC  368
            +KPWNSTL +YTLY   DLRDCV  L  L  +   H  S+PA+R+KYSQHKYKF AKK C
Sbjct  423  RKPWNSTLGNYTLYSGKDLRDCVKDLLRLYRDGTRHSCSVPAVRKKYSQHKYKFAAKKFC  482

Query  367  PTSIPSEFF  341
            P S+P EFF
Sbjct  483  PASVPPEFF  491



>ref|XP_004292715.1| PREDICTED: cyclin-A1-4-like [Fragaria vesca subsp. vesca]
Length=506

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  616  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  437
            +ML Y+PSL+AASA FLA Y L+PSK+PWNSTLRHYT Y+  DL DCV  LH+LCCN   
Sbjct  410  NMLGYAPSLIAASATFLANYILSPSKRPWNSTLRHYTNYRACDLCDCVKVLHHLCCNGSG  469

Query  436  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  326
            S+L A+REKY QHKYKFVAKK CP SIP EFF D S+
Sbjct  470  SNLAAVREKYCQHKYKFVAKKYCPPSIPPEFFHDPSN  506



>ref|XP_006654172.1| PREDICTED: cyclin-A1-4-like [Oryza brachyantha]
Length=352

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q   EA  L LE L++Y+AELSLL Y ++CY PSL+AAS+IFLA+
Sbjct  215  APTAKCFLRRFLRAAQVCCEAPVLHLEFLSNYIAELSLLEYSLICYVPSLIAASSIFLAK  274

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P++ PWNSTL  YT Y+PSDLRDC   LH L      S+L A+REKYSQHKYKFVA
Sbjct  275  FILKPTENPWNSTLCFYTQYKPSDLRDCTKGLHRLFLVGPGSNLRAVREKYSQHKYKFVA  334

Query  379  KKICPTSIPSEFFQDVSS  326
            KK  P SIP+EFFQD SS
Sbjct  335  KKYSPPSIPAEFFQDPSS  352



>ref|XP_004960667.1| PREDICTED: cyclin-A1-3-like [Setaria italica]
Length=476

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LR FV A Q F++  ++ LE LA+Y+ ELSLL Y +LCY PSLVAAS++FLAR+ L P+
Sbjct  345  FLRGFVDAAQVFDKDPTMHLEFLANYICELSLLEYSLLCYLPSLVAASSVFLARFILKPA  404

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K PWNS+L +YT Y PS+LR CV  LH L C      LPAIREKYSQHKYKFVAKK CP 
Sbjct  405  KNPWNSSLSYYTQYTPSELRCCVRVLHRLFCFGPGRDLPAIREKYSQHKYKFVAKKYCPP  464

Query  361  SIPSEFFQDVSS  326
            SIP+EFFQD +S
Sbjct  465  SIPTEFFQDATS  476



>ref|NP_001054990.1| Os05g0237100 [Oryza sativa Japonica Group]
 dbj|BAF16904.1| Os05g0237100, partial [Oryza sativa Japonica Group]
Length=204

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q  +EA  L LE LA+Y+AELSLL Y ++CY PSL+AAS+IFLA+
Sbjct  63   APTTKCFLRRFLRAAQVCHEAPVLHLEFLANYIAELSLLEYSLICYVPSLIAASSIFLAK  122

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P++ PWNSTL  YT Y+PSDL +C   LH L       +L A+REKYSQHKYKFVA
Sbjct  123  FILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGGNLRAVREKYSQHKYKFVA  182

Query  379  KKICPTSIPSEFFQDVSS  326
            KK  P SIP+EFF+D SS
Sbjct  183  KKYSPPSIPAEFFEDPSS  200



>gb|AAA20237.1| cyclin IIZm, partial [Zea mays]
Length=456

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF RA Q  +E  +L LE LA+Y+AELSLL Y +L Y PSL+AASAIFLAR
Sbjct  316  APTAKCFLRRFARAAQACDEDPALHLEFLANYIAELSLLEYSLLSYPPSLIAASAIFLAR  375

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS L +CV ALH LC     S+LPAIREKYSQHKYKFVA
Sbjct  376  FILQPTKYPWNSTLAHYTQYKPSKLSECVKALHRLCSVGSGSNLPAIREKYSQHKYKFVA  435

Query  379  KKICPTSIPS-EFFQDVS  329
            KK CP  IPS EFF+D +
Sbjct  436  KKQCPPQIPSLEFFRDAT  453



>gb|EEC78817.1| hypothetical protein OsI_19095 [Oryza sativa Indica Group]
Length=240

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q  +EA  L LE LA+Y+AELSLL Y ++CY PSL+AAS+IFLA+
Sbjct  99   APTTKCFLRRFLRAAQVCHEAPVLHLEFLANYIAELSLLEYSLICYVPSLIAASSIFLAK  158

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P++ PWNSTL  YT Y+PSDL +C   LH L       +L A+REKYSQHKYKFVA
Sbjct  159  FILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGGNLRAVREKYSQHKYKFVA  218

Query  379  KKICPTSIPSEFFQDVSS  326
            KK  P SIP+EFF+D SS
Sbjct  219  KKYSPPSIPAEFFEDPSS  236



>gb|ACF80031.1| unknown [Zea mays]
Length=502

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF R+ Q  +E  +L LE LA+Y+AELSLL Y +L Y PSL+AASAIFLAR
Sbjct  365  APTAKCFLRRFARSAQACDEDPALHLEFLANYIAELSLLEYSLLSYPPSLIAASAIFLAR  424

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L +CV  LH L      S+LPAIREKYSQHKYKFVA
Sbjct  425  FVLQPTKYPWNSTLAHYTQYKPSELSECVKTLHRLSSVGPGSNLPAIREKYSQHKYKFVA  484

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP  IP+EFF+D +
Sbjct  485  KKQCPPQIPAEFFRDAA  501



>dbj|BAD81374.1| putative type A-like cyclin [Oryza sativa Japonica Group]
Length=521

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = -3

Query  715  RRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKK  536
            RRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA++ L P+K 
Sbjct  391  RRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAKFILQPTKH  450

Query  535  PW-NSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
            PW NSTL HYT Y+ S+L DCV ALH L      S+LPAIREKY+QHKYKFVAKK CP S
Sbjct  451  PWQNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYTQHKYKFVAKKHCPPS  510

Query  358  IPSEFFQDVS  329
            +PSEFF+D +
Sbjct  511  VPSEFFRDAT  520



>gb|ACR33952.1| unknown [Zea mays]
Length=527

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF R+ Q  +E  +L LE LA+Y+AELSLL Y +L Y PSL+AASAIFLAR
Sbjct  390  APTAKCFLRRFARSAQACDEDPALHLEFLANYIAELSLLEYSLLSYPPSLIAASAIFLAR  449

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L +CV  LH L      S+LPAIREKYSQHKYKFVA
Sbjct  450  FVLQPTKYPWNSTLAHYTQYKPSELSECVKTLHRLSSVGPGSNLPAIREKYSQHKYKFVA  509

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP  IP+EFF+D +
Sbjct  510  KKQCPPQIPAEFFRDAA  526



>sp|Q0JPA4.2|CCA12_ORYSJ RecName: Full=Cyclin-A1-2; AltName: Full=G2/mitotic-specific 
cyclin-A1-2; Short=CycA1;2 [Oryza sativa Japonica Group]
Length=477

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  341  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  400

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKY+QHK KFVA
Sbjct  401  FILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYTQHK-KFVA  459

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP S+PSEFF+D +
Sbjct  460  KKHCPPSVPSEFFRDAT  476



>ref|XP_007161469.1| hypothetical protein PHAVU_001G071600g [Phaseolus vulgaris]
 gb|ESW33463.1| hypothetical protein PHAVU_001G071600g [Phaseolus vulgaris]
Length=457

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = -3

Query  721  LLRRFVR-ATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTP  545
             LRRFV  A     E  SLQLE L +++AELSLL Y MLCY PSL+AASA FLAR+ L P
Sbjct  327  FLRRFVHVAAHDVQEVPSLQLECLTNFIAELSLLEYSMLCYPPSLIAASATFLARFILFP  386

Query  544  SKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS-LPAIREKYSQHKYKFVAKKIC  368
            SKKPWNS L+HY  Y+PSDL  CV  LH LCC+S  +S LPAIREKYSQHKYK VAKK  
Sbjct  387  SKKPWNSILQHYAQYRPSDLCACVKDLHRLCCSSSDTSNLPAIREKYSQHKYKCVAKKYI  446

Query  367  PTSIPSEFFQD  335
            P SIP E F++
Sbjct  447  PLSIPQEVFRN  457



>ref|NP_001176910.1| Os12g0298950 [Oryza sativa Japonica Group]
 dbj|BAH95638.1| Os12g0298950 [Oryza sativa Japonica Group]
Length=391

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -3

Query  616  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  437
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L C    
Sbjct  295  NLLSYPPSLVAASAIFLAKFILQPAKHPWNSTLAHYTQYKSSELSDCVKALHRLFCVGPG  354

Query  436  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  335
            S+LPAIREKY+QHKYKFVAKK CP SIP+EFF+D
Sbjct  355  SNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  388



>gb|AAN87004.1| cyclin A [Populus alba]
Length=191

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG  EA S+QLE LA+Y+AEL LL Y MLCY+PSLVAASAIFLA+
Sbjct  83   APTAKCFLRRFVRAAQGIIEAPSMQLECLANYIAELPLLEYSMLCYAPSLVAASAIFLAK  142

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIRE  413
            Y L PSK+PWNSTL+HYTLY+P DL DCV   H LCC  H+S+LPAIRE
Sbjct  143  YILLPSKRPWNSTLQHYTLYEPVDLSDCVKDPHRLCCGDHNSTLPAIRE  191



>ref|NP_001105387.1| cyclin2 [Zea mays]
 gb|AAC50013.1| type A-like cyclin [Zea mays]
Length=502

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF R+ Q  +E  +L LE LA+Y+AELSLL Y +L Y PSL+AASAIFLAR
Sbjct  365  APTAKCFLRRFARSAQACDEDPALHLEFLANYIAELSLLEYSLLSYPPSLIAASAIFLAR  424

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+PS+L +CV ALH L      S+LPAIREKYSQHKYKFVA
Sbjct  425  FVLQPTKYPWNSTLAHYTQYKPSELSECVKALHRLSSVGPGSNLPAIREKYSQHKYKFVA  484

Query  379  KKICPTSIPSEFFQDVS  329
            KK  P  IP+EFF+D +
Sbjct  485  KKQSPPQIPAEFFRDAA  501



>sp|Q0DJR9.2|CCA14_ORYSJ RecName: Full=Cyclin-A1-4; AltName: Full=G2/mitotic-specific 
cyclin-A1-4; Short=CycA1;4 [Oryza sativa Japonica Group]
Length=356

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q  +EA  L LE LA+Y+AELSLL Y ++CY PSL+AAS+IFLA+
Sbjct  215  APTTKCFLRRFLRAAQVCHEAPVLHLEFLANYIAELSLLEYSLICYVPSLIAASSIFLAK  274

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P++ PWNSTL  YT Y+PSDL +C   LH L       +L A+REKYSQHKYKFVA
Sbjct  275  FILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGGNLRAVREKYSQHKYKFVA  334

Query  379  KKICPTSIPSEFFQDVSS  326
            KK  P SIP+EFF+D SS
Sbjct  335  KKYSPPSIPAEFFEDPSS  352



>ref|XP_003566404.1| PREDICTED: cyclin-A1-4-like [Brachypodium distachyon]
Length=482

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q  +E  +L LE LASY+AELSLL Y +LCY+PSL+AAS++FLA 
Sbjct  345  APTAKCFLRRFIRAAQVCHERPALHLEFLASYIAELSLLEYSLLCYAPSLIAASSVFLAN  404

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P++ PWN++L ++T Y+PS L DCV  LH L      S+LPAIREKYSQHKYKFVA
Sbjct  405  FILKPTRNPWNTSLSYHTQYKPSSLHDCVKVLHLLFRVGPGSNLPAIREKYSQHKYKFVA  464

Query  379  KKICPTSIPSEFFQD  335
            KK CP SIP EFFQD
Sbjct  465  KKYCPPSIPVEFFQD  479



>gb|EEE62924.1| hypothetical protein OsJ_17729 [Oryza sativa Japonica Group]
Length=425

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q  +EA  L LE LA+Y+AELSLL Y ++CY PSL+AAS+IFLA+
Sbjct  284  APTTKCFLRRFLRAAQVCHEAPVLHLEFLANYIAELSLLEYSLICYVPSLIAASSIFLAK  343

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P++ PWNSTL  YT Y+PSDL +C   LH L       +L A+REKYSQHKYKFVA
Sbjct  344  FILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGGNLRAVREKYSQHKYKFVA  403

Query  379  KKICPTSIPSEFFQDVSS  326
            KK  P SIP+EFF+D SS
Sbjct  404  KKYSPPSIPAEFFEDPSS  421



>ref|XP_006390095.1| hypothetical protein EUTSA_v10018521mg [Eutrema salsugineum]
 gb|ESQ27381.1| hypothetical protein EUTSA_v10018521mg [Eutrema salsugineum]
Length=457

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG  E  SL  E LASYL ELSLL Y ML Y+PSLVAASA+FLA+
Sbjct  323  TPTAKCFLRRFVRAAQGKKEVPSLLFECLASYLTELSLLDYAMLRYAPSLVAASAVFLAQ  382

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS++PWN+TL HYT Y+  DL  CV +L  LC  S  + + A+R+KYSQHKYKF A
Sbjct  383  YILHPSREPWNATLEHYTSYRAKDLEGCVKSLLQLCHESPSADVVAVRKKYSQHKYKFAA  442

Query  379  KKICPTSIPSEFF  341
            KK CP S+P E F
Sbjct  443  KKFCPASLPQELF  455



>ref|XP_003566077.1| PREDICTED: cyclin-A1-1-like [Brachypodium distachyon]
Length=510

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y +L Y PSLVAASA+FL+++ L P+
Sbjct  379  FLRRFVRVAQVCDEDPALHLEFLANYVAELSLLEYSLLAYPPSLVAASAVFLSKFILQPT  438

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKYSQHKYKFVAKK CP 
Sbjct  439  KCPWNSTLAHYTQYKASELCDCVKALHRLFSVGPGSNLPAIREKYSQHKYKFVAKKQCPP  498

Query  361  SIPSEFFQDVS  329
             +P++FF+D +
Sbjct  499  LVPADFFRDAT  509



>gb|EMS46237.1| Cyclin-A1-1 [Triticum urartu]
Length=439

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 104/155 (67%), Gaps = 18/155 (12%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA Q  +E   L LE LA+Y+AELSLL Y +L Y PSLVAASAIFL++
Sbjct  284  APTAKCFLRRFVRAAQVCDEDPPLHLEFLANYVAELSLLEYSLLAYPPSLVAASAIFLSK  343

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQH------  398
            + L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+LPAIREKYSQH      
Sbjct  344  FILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNLPAIREKYSQHKLLGKL  403

Query  397  ------------KYKFVAKKICPTSIPSEFFQDVS  329
                        +YKFV KK CPTS+P+EFFQD +
Sbjct  404  MLMLTSSTPFFPQYKFVGKKQCPTSVPAEFFQDAA  438



>ref|NP_177863.2| cyclin-A1-2 [Arabidopsis thaliana]
 sp|Q9FVX0.2|CCA12_ARATH RecName: Full=Cyclin-A1-2; AltName: Full=G2/mitotic-specific 
cyclin-A1-2; Short=CycA1;2; AltName: Full=Protein TARDY ASYNCHRONOUS 
MEIOSIS [Arabidopsis thaliana]
 gb|AEE35972.1| cyclin-A1-2 [Arabidopsis thaliana]
Length=442

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG  E  SL  E LA YL ELSLL Y ML Y+PSLVAASA+FLA+
Sbjct  309  TPTAKCFLRRFLRAAQGRKEVPSLLSECLACYLTELSLLDYAMLRYAPSLVAASAVFLAQ  368

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            YTL PS+KPWN+TL HYT Y+   +  CV  L  LC     S + AIR+KYSQHKYKF A
Sbjct  369  YTLHPSRKPWNATLEHYTSYRAKHMEACVKNLLQLCNEKLSSDVVAIRKKYSQHKYKFAA  428

Query  379  KKICPTSIPSEFF  341
            KK+CPTS+P E F
Sbjct  429  KKLCPTSLPQELF  441



>ref|XP_004502519.1| PREDICTED: cyclin-A1-1-like [Cicer arietinum]
Length=514

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+   Q   E   +QLE+LA YLAELSLL YDML Y+PSL+AASA FLA+
Sbjct  378  APTTRCFLRRFIIVAQQTCEVPLMQLEYLADYLAELSLLEYDMLQYAPSLIAASATFLAK  437

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS--SLPAIREKYSQHKYKF  386
            Y L P KKPWNS LRHYT YQ S+L +C+  L  L CN +HS  S+ AIREKYSQHK+KF
Sbjct  438  YILLPRKKPWNSMLRHYTGYQASELCECINGLCLLYCNGYHSSPSIIAIREKYSQHKFKF  497

Query  385  VAKKICPTSIPSEFFQD  335
            VAKK CP SIP E F +
Sbjct  498  VAKKYCPPSIPVEAFHN  514



>gb|KEH35322.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=510

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF+   Q   E   +QLE+LA Y+A+LSLL YDML Y+PSL+AASA FLA+Y L  +
Sbjct  380  FLRRFITVAQQTCEIPLMQLEYLADYVADLSLLEYDMLKYTPSLIAASATFLAKYILLST  439

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS--SLPAIREKYSQHKYKFVAKKIC  368
            K PWNS LRHYT YQ S+LR+CV  LH L  N +HS  S+ AIREKYSQHK+KF AKK C
Sbjct  440  KNPWNSMLRHYTGYQASELRECVEGLHLLYRNGYHSSPSITAIREKYSQHKFKFAAKKCC  499

Query  367  PTSIPSEFFQD  335
            P SIP E F +
Sbjct  500  PPSIPVEVFHN  510



>ref|XP_002889141.1| CYCA1_2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65400.1| CYCA1_2 [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG  E  SL  E LA YL ELSLL Y ML Y+PSLVAASA+FLA+
Sbjct  309  TPTAKCFLRRFLRAAQGRKEVPSLLSECLACYLTELSLLDYAMLRYAPSLVAASAVFLAQ  368

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS+KPWN+TL HYT Y+   +  CV  L  LC     S + AIR+KYSQHKYKF A
Sbjct  369  YILHPSRKPWNATLEHYTSYRAKHMEACVKNLLQLCNEKPSSDVVAIRKKYSQHKYKFAA  428

Query  379  KKICPTSIPSEFF  341
            KK+CPTS+P E F
Sbjct  429  KKLCPTSLPQELF  441



>ref|XP_003566081.1| PREDICTED: cyclin-A1-1-like [Brachypodium distachyon]
Length=501

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA Q  +E  +L LE LA Y+ ELSLL Y +L Y PSLVAASA+FL++
Sbjct  364  APTAKCFLRRFVRAAQVCDEDPALHLESLACYVTELSLLEYSLLVYPPSLVAASALFLSK  423

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV  L  L C +  S LPAIREKYSQHKYKF A
Sbjct  424  FILQPTKSPWNSTLAHYTQYKASELCDCVKELQRLFCVAPGSKLPAIREKYSQHKYKFAA  483

Query  379  KKICPTSIPSEFFQDVS  329
            KK CP  +P+++F D +
Sbjct  484  KKQCPPMVPADYFCDAA  500



>ref|XP_009106401.1| PREDICTED: cyclin-A1-2 [Brassica rapa]
Length=386

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG  E SSL  E LASY +ELSLL Y ML Y+PSLVAASA+FLA+
Sbjct  253  TPTAKCFLRRFVRAAQGRKEVSSLLFESLASYFSELSLLDYAMLRYAPSLVAASAVFLAQ  312

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS KPW+STL HYT Y+   L  CV  L  LC  S  + + A+R+KYSQ KYKF A
Sbjct  313  YILHPSTKPWSSTLEHYTSYRAKHLEACVKNLLQLCHESPSADVVAVRKKYSQDKYKFAA  372

Query  379  KKICPTSIPSEFF  341
            KK CPTS+P E F
Sbjct  373  KKFCPTSLPQELF  385



>emb|CDX87520.1| BnaA07g33530D [Brassica napus]
Length=386

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG  E SSL  E LASY +ELSLL Y ML Y+PSLVAASA+FLA+
Sbjct  253  TPTAKCFLRRFVRAAQGRKEVSSLLFESLASYFSELSLLDYAMLRYAPSLVAASAVFLAQ  312

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS KPW+STL HYT Y+   L  CV  L  LC  S  + + A+R+KYSQ KYKF A
Sbjct  313  YILHPSTKPWSSTLEHYTSYRAKHLEACVKNLLQLCHESPSADVVAVRKKYSQDKYKFAA  372

Query  379  KKICPTSIPSEFF  341
            KK CPTS+P E F
Sbjct  373  KKFCPTSLPQELF  385



>ref|XP_008653791.1| PREDICTED: cyclin-A1-1-like [Zea mays]
Length=124

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -3

Query  598  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  419
            PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+ S+L +CV  LH L      S+LP+I
Sbjct  34   PSLIAASAIFLARFVLQPTKYPWNSTLAHYTQYKRSELSECVKTLHRLSSVGPGSNLPSI  93

Query  418  REKYSQHKYKFVAKKICPTSIPSEFFQDVS  329
             EKYSQHKYKFVAKK CP  IP+EFF+D +
Sbjct  94   TEKYSQHKYKFVAKKQCPPQIPAEFFKDAA  123



>ref|XP_010521285.1| PREDICTED: cyclin-A1-2 isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 97/154 (63%), Gaps = 27/154 (18%)
 Frame = -3

Query  721  LLRRFVRATQGFNEAS-------------------------SLQlehlasylaelsllaY  617
             LRRFVRA QG NE                            +QLE LASYLAELSLL Y
Sbjct  363  FLRRFVRAAQGTNEVLCHVQIEFLHVYSVGMSNRISHFQVLPVQLECLASYLAELSLLDY  422

Query  616  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNS--  443
             ML Y PSLVAASA+FLARY L PS+KPWNSTL +YTLY   DLRDCV  L  L  +   
Sbjct  423  AMLQYLPSLVAASAVFLARYILEPSRKPWNSTLGNYTLYSGKDLRDCVKDLLRLYRDGTR  482

Query  442  HHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFF  341
            H  S+PA+R+KYSQHKYKF AKK CP S+P EFF
Sbjct  483  HSCSVPAVRKKYSQHKYKFAAKKFCPASVPPEFF  516



>ref|XP_006302208.1| hypothetical protein CARUB_v10020219mg, partial [Capsella rubella]
 gb|EOA35106.1| hypothetical protein CARUB_v10020219mg, partial [Capsella rubella]
Length=478

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG  E  SL  E LA YL ELSLL Y ML Y+PSLVAASA+FL +
Sbjct  344  TPTAKCFLRRFLRAAQGRKEVPSLLSECLACYLTELSLLDYAMLRYTPSLVAASAVFLTQ  403

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS+KPWN+TL+HYT Y+ + +  CV  L  LC  +  S + A+R+KYSQH YKF A
Sbjct  404  YILHPSRKPWNATLQHYTSYKVTHMETCVKELLQLCHGNPSSDVVAVRKKYSQHNYKFAA  463

Query  379  KKICPTSIPSEFF  341
            KK+CPTS+P E F
Sbjct  464  KKLCPTSLPQELF  476



>ref|XP_010428818.1| PREDICTED: cyclin-A1-2-like [Camelina sativa]
Length=412

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG  E  SL  E+LA YL ELSLL Y ML Y+PSL+AASA+FL +
Sbjct  278  TPTANCFLRRFLRAAQGGKEVPSLLSEYLACYLTELSLLDYAMLRYTPSLIAASAVFLTQ  337

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PS KPWN+TL HYT Y+ + +  CV  L  LC  +  S + AIR+KYSQHKYKF A
Sbjct  338  HILHPSIKPWNATLEHYTSYKATHMEACVKDLLQLCRGNPSSDVVAIRKKYSQHKYKFAA  397

Query  379  KKICPTSIPSEFF  341
            KK+CPTS+P E F
Sbjct  398  KKLCPTSLPQELF  410



>ref|XP_004962645.1| PREDICTED: cyclin-A1-1-like isoform X1 [Setaria italica]
Length=509

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+ A +  +E  +  +E LA+Y+ ELSLL Y++LCY PS +AASAIFLA+
Sbjct  373  APTAKCFLRRFLHAARACDEDPAY-IEVLANYITELSLLEYNLLCYPPSQIAASAIFLAK  431

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+K+PWN TL  YT Y+PS+L +CV A+H +      ++LPA+REKY QHKYKFVA
Sbjct  432  YILYPTKQPWNPTLARYTRYKPSELCECVKAMHRVFSIGPMNNLPAVREKYGQHKYKFVA  491

Query  379  KKICPTSIPSEFFQDVS  329
            K  CP SIP+ FF+DV+
Sbjct  492  KLRCPASIPTGFFEDVT  508



>ref|XP_004962646.1| PREDICTED: cyclin-A1-1-like isoform X2 [Setaria italica]
Length=511

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+ A +  +E  +  +E LA+Y+ ELSLL Y++LCY PS +AASAIFLA+
Sbjct  375  APTAKCFLRRFLHAARACDEDPAY-IEVLANYITELSLLEYNLLCYPPSQIAASAIFLAK  433

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L P+K+PWN TL  YT Y+PS+L +CV A+H +      ++LPA+REKY QHKYKFVA
Sbjct  434  YILYPTKQPWNPTLARYTRYKPSELCECVKAMHRVFSIGPMNNLPAVREKYGQHKYKFVA  493

Query  379  KKICPTSIPSEFFQDVS  329
            K  CP SIP+ FF+DV+
Sbjct  494  KLRCPASIPTGFFEDVT  510



>ref|XP_010429845.1| PREDICTED: cyclin-A1-2-like [Camelina sativa]
Length=448

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG  E  SL  E+LA YL ELSLL Y ML Y+PSLVAASA+FL +
Sbjct  314  TPTANCFLRRFLRAAQGGKEVPSLLSEYLACYLTELSLLDYAMLRYTPSLVAASAVFLTQ  373

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PS+KPWN+TL HYT Y+ + +  CV  L  LC  +  S + A+R+KYSQH YKF A
Sbjct  374  HILHPSRKPWNATLEHYTSYKATHMEACVKDLLQLCHGNPSSDVVAVRKKYSQHNYKFAA  433

Query  379  KKICPTSIPSEFF  341
            KK+CPTS+P E F
Sbjct  434  KKLCPTSLPQELF  446



>ref|XP_010471932.1| PREDICTED: cyclin-A1-2-like [Camelina sativa]
Length=456

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG  E  SL  E LA YL ELSLL Y ML Y+PSLVAASA+FL +
Sbjct  322  TPTAKCFLRRFLRAAQGGKEVPSLLSECLACYLTELSLLDYAMLRYTPSLVAASAVFLTQ  381

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PS+KPWN+TL HYT Y+ + +  CV  L  LC  +  S + A+R+KYSQH YKF A
Sbjct  382  HILHPSRKPWNATLEHYTSYKATHMEACVKDLLQLCHGNPSSDVVAVRKKYSQHNYKFAA  441

Query  379  KKICPTSIPSEFF  341
            KK+CPTS+P E F
Sbjct  442  KKLCPTSLPQELF  454



>gb|KFK38207.1| hypothetical protein AALP_AA3G082800 [Arabis alpina]
Length=399

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = -3

Query  703  RATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNS  524
            RA  G +EA  +QLE +A+Y+AELSL+ Y ML +SPSLVAAS +FLA+Y L P+++PWNS
Sbjct  279  RAAHGVHEAPMMQLECMANYIAELSLVEYTMLSHSPSLVAASVVFLAKYILYPTRRPWNS  338

Query  523  TLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEF  344
            TL+HYT Y+  +LR CV  L  L  N+H     A+REKYSQHKYKFVA K+CP+ IP EF
Sbjct  339  TLQHYTQYKGLELRGCVKDLQRLSSNAHAF---AVREKYSQHKYKFVAYKLCPSIIPQEF  395

Query  343  FQDV  332
            F ++
Sbjct  396  FNNI  399



>ref|XP_010416680.1| PREDICTED: cyclin-A1-2-like [Camelina sativa]
Length=455

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG  E  SL  E LA YL ELSLL Y ML Y+PSLVAASA+FL +
Sbjct  321  TPTAKCFLRRFLRAAQGGKEVPSLLSECLACYLTELSLLDYAMLRYTPSLVAASAVFLTQ  380

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PS+KPWN+TL HYT Y+ + +  CV  L  LC  +  + + A+R+KYSQH YKF A
Sbjct  381  HVLHPSRKPWNATLEHYTSYKATHMEACVKDLLQLCHGNPSTDVVAVRKKYSQHNYKFAA  440

Query  379  KKICPTSIPSEFF  341
            KK+CPTS+P E F
Sbjct  441  KKLCPTSLPQELF  453



>emb|CDX88368.1| BnaC06g38120D [Brassica napus]
Length=380

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA +G  E +SL  E LASYL+ELSLL Y ML Y+PSLVAASA+FLA+
Sbjct  247  TPTAKCFLRRFVRAAKGKKEVTSLLFESLASYLSELSLLDYAMLRYAPSLVAASAVFLAQ  306

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
              L PS+KPW+STL HYT Y+   L  CV  L  LC  S  + + A+R+KYSQ KYKF A
Sbjct  307  CILHPSRKPWSSTLEHYTSYRAKHLEGCVKNLLQLCHESPSADVVAVRKKYSQDKYKFAA  366

Query  379  KKICPTSIPSEFF  341
            KK CPTS+P E F
Sbjct  367  KKFCPTSLPQELF  379



>ref|XP_006434257.1| hypothetical protein CICLE_v10003984mg, partial [Citrus clementina]
 gb|ESR47497.1| hypothetical protein CICLE_v10003984mg, partial [Citrus clementina]
Length=489

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   L RF+RA Q  N+A S+Q E LA+Y+ ELSLL Y MLCYSPSL+AASA FLA 
Sbjct  375  APTAKCFLMRFIRAAQRSNKAPSMQFECLANYILELSLLDYKMLCYSPSLIAASATFLAN  434

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHK  395
            + L P KKPWNSTL HYT YQPSDL DCV ALH L C+   S+L AIREKYSQHK
Sbjct  435  FILYPLKKPWNSTLGHYTFYQPSDLCDCVKALHRLFCDGGLSNLSAIREKYSQHK  489



>gb|KFK42133.1| hypothetical protein AALP_AA2G215400 [Arabis alpina]
Length=399

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA QG  E S L  E LA Y+ ELSLL Y ML Y+PSL+AASA+FLA+
Sbjct  266  TPTAKCFLRRFLRAAQGEKEVS-LLFECLAGYITELSLLDYAMLRYAPSLIAASAVFLAQ  324

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            Y L PS+ PWN+TL HYT Y+   L  CV  L  LC  +  + + ++R+KYSQHKYKF A
Sbjct  325  YILQPSRTPWNATLEHYTSYRAKHLEACVKNLLQLCHENPSADVVSVRKKYSQHKYKFAA  384

Query  379  KKICPTSIPSEFF  341
            KK+CPTS+P E F
Sbjct  385  KKLCPTSLPQELF  397



>gb|KDO80524.1| hypothetical protein CISIN_1g043577mg, partial [Citrus sinensis]
Length=402

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  712  RFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKP  533
            RF+RA Q  N+A S+Q E LA+Y+ ELSLL Y MLCYSPSL+AASA FLA + L P KKP
Sbjct  297  RFIRAAQRSNKAPSMQFECLANYILELSLLDYKMLCYSPSLIAASATFLANFILYPLKKP  356

Query  532  WNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHK  395
            WNSTL HYT YQPSDL DCV ALH L C+   S+L AIREKYSQHK
Sbjct  357  WNSTLGHYTFYQPSDLCDCVKALHRLFCDGGLSNLSAIREKYSQHK  402



>ref|XP_011629119.1| PREDICTED: cyclin-A3-1 [Amborella trichopoda]
Length=360

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            SP     LRRF RA+Q  N+ S L LE L +YLAELSLL Y  + + PS++AAS IFLAR
Sbjct  223  SPTIKTFLRRFNRASQEGNKTSELVLEFLGNYLAELSLLDYGCVRFFPSIIAASVIFLAR  282

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            +TL P   PW STL+HYT Y+ SDL+DCV+A+H+L  N+   SL AIR+KY  HK+K V+
Sbjct  283  FTLRPQTHPWTSTLQHYTGYKSSDLKDCVIAIHSLQLNTKGCSLAAIRDKYKSHKFKCVS  342

Query  379  KKICPTSIPSEFFQDVSS  326
                PT IPS+FF+D++ 
Sbjct  343  SLSPPTEIPSQFFEDING  360



>gb|ERM96686.1| hypothetical protein AMTR_s00001p00272790 [Amborella trichopoda]
Length=361

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            L RRF RA+Q  N+ S L LE L +YLAELSLL Y  + + PS++AAS IFLAR+TL P 
Sbjct  230  LSRRFNRASQEGNKTSELVLEFLGNYLAELSLLDYGCVRFFPSIIAASVIFLARFTLRPQ  289

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW STL+HYT Y+ SDL+DCV+A+H+L  N+   SL AIR+KY  HK+K V+    PT
Sbjct  290  THPWTSTLQHYTGYKSSDLKDCVIAIHSLQLNTKGCSLAAIRDKYKSHKFKCVSSLSPPT  349

Query  361  SIPSEFFQDVSS  326
             IPS+FF+D++ 
Sbjct  350  EIPSQFFEDING  361



>ref|XP_001778367.1| predicted protein [Physcomitrella patens]
 gb|EDQ56818.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF+RA Q   EA +L LE L +YLAEL+L+ Y  L + PS++AAS  +LAR TL  S+
Sbjct  143  LRRFIRAAQAGCEAPALVLEFLGNYLAELTLVEYGFLPFLPSMIAASCAYLARVTLDSSR  202

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
            +PW++TL+HYT Y+PS+L  CV A+H L CN+   +LPA+REKY  HK+K VA  + P  
Sbjct  203  RPWDATLQHYTGYRPSELEQCVRAMHELQCNTRGCTLPAVREKYRHHKFKCVAALVPPAV  262

Query  358  IPSEFFQDVS  329
            +P E+F+++ 
Sbjct  263  LPEEYFRELE  272



>ref|XP_001766438.1| predicted protein [Physcomitrella patens]
 gb|EDQ68766.1| predicted protein, partial [Physcomitrella patens]
Length=282

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF+RA Q   EA +L LE L +YLAEL+L+ Y  L + PS++AAS  +LAR TL  S+
Sbjct  153  LRRFIRAAQAGCEAPALVLEFLGNYLAELTLVEYGFLPFLPSMIAASCAYLARVTLDSSR  212

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
            +PW++TL+HYT Y+PS+L  CV A+H L CN+   +LPA+REKY  HK+K VA  + P  
Sbjct  213  RPWDATLQHYTGYRPSELEQCVRAMHELQCNTRGCTLPAVREKYRHHKFKCVAALVPPAL  272

Query  358  IPSEFFQDVS  329
            +P E+F+++ 
Sbjct  273  LPEEYFRELE  282



>ref|XP_001786071.1| predicted protein [Physcomitrella patens]
 gb|EDQ49118.1| predicted protein, partial [Physcomitrella patens]
Length=284

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q   +AS+L LE L +YLAEL+L  Y ML + PS+VAASA+++AR
Sbjct  146  TPTTKSFLRRFIRAAQASCKASTLVLEFLGNYLAELTLTEYSMLGFLPSMVAASAVYMAR  205

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             TL PS  PW++TL+HYT Y+ S L  CV  +H+L  NS + +LPAIREKY  HK+K VA
Sbjct  206  LTLDPSSCPWDATLQHYTGYKASALEKCVRDIHDLQRNSKNCTLPAIREKYRLHKFKCVA  265

Query  379  KKICPTSIPSEFFQDV  332
                P+ +P EFF+D+
Sbjct  266  TLTPPSVLPPEFFKDL  281



>ref|XP_010277154.1| PREDICTED: G2/mitotic-specific cyclin C13-1-like [Nelumbo nucifera]
Length=360

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF RA Q   ++ +LQLE L  YLAELSLL Y  + + PSLVAAS +FLAR+T+ P  
Sbjct  230  LRRFTRAAQEDRKSPNLQLEFLGCYLAELSLLDYGCVRFLPSLVAASVVFLARFTIRPKM  289

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+ TL+HY+ Y+PSDL+DCV+A+H+L  N   SSL A+R+KY QHK+K VA    P  
Sbjct  290  NPWSLTLQHYSGYRPSDLKDCVLAIHDLQLNRKGSSLVAVRDKYKQHKFKCVATLASPPE  349

Query  358  IPSEFFQDVSS  326
            +P+ +F+D+  
Sbjct  350  MPNHYFEDIKG  360



>ref|XP_002972287.1| hypothetical protein SELMODRAFT_412894 [Selaginella moellendorffii]
 gb|EFJ26373.1| hypothetical protein SELMODRAFT_412894 [Selaginella moellendorffii]
Length=404

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF+RA Q      SLQLE L ++LAELSL+ Y  L Y PS++AASA+FLA+ T+ P++
Sbjct  275  LRRFMRAAQASYHTPSLQLEFLGNFLAELSLVEYTFLKYKPSMIAASAVFLAKLTVDPTE  334

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWN TLRHYT Y  S+L  CV  +H L CN+    LPA+REKY QHK+K VA    P+ 
Sbjct  335  DPWNGTLRHYTGYCASELAQCVRDIHELQCNTKGCGLPAVREKYKQHKFKCVATLAAPSP  394

Query  358  IPSEFFQD  335
            I +E F+D
Sbjct  395  IAAEKFED  402



>dbj|BAA11560.1| cyclin [Adiantum capillus-veneris]
Length=532

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
             P +   LRRFVRA Q   ++ +LQLE L +YLAEL+LL Y  L + PS++A +A+ +AR
Sbjct  396  GPTTKSFLRRFVRAAQAGQKSPTLQLEFLGNYLAELTLLEYGFLHFLPSMIAGAAVLVAR  455

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             TL P+ +PWNSTL+HY+ Y+ S+L++C  A+  L  N+ + +LPAIREKY QHK+K VA
Sbjct  456  VTLNPTWRPWNSTLQHYSGYKASELKECAKAILELQKNTKNCTLPAIREKYRQHKFKCVA  515

Query  379  KKICPTSIPSEFFQDV  332
                P SIP+E+F D+
Sbjct  516  TLHPPASIPAEYFDDI  531



>ref|XP_010271477.1| PREDICTED: putative cyclin-A3-1 isoform X1 [Nelumbo nucifera]
Length=390

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF RA Q   +  +LQLE L  YLAELSLL    L + PSLVAAS +FL+R+T+ P  
Sbjct  260  LRRFTRAAQEDKKFPNLQLEFLGCYLAELSLLDCSCLRFLPSLVAASVVFLSRFTIQPKM  319

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWNSTL+HY+ Y+PSDL+DCV+A+ +L  N    SL A+++KY QHK+K VA    P  
Sbjct  320  HPWNSTLQHYSGYKPSDLKDCVIAIQDLQLNRRGGSLIAVKDKYKQHKFKCVATLSSPPE  379

Query  358  IPSEFFQDV  332
            IP+ +F+D+
Sbjct  380  IPTHYFEDI  388



>ref|XP_007019146.1| Cyclin A1,1, putative [Theobroma cacao]
 gb|EOY16371.1| Cyclin A1,1, putative [Theobroma cacao]
Length=126

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 75/108 (69%), Gaps = 15/108 (14%)
 Frame = -3

Query  613  MLCYSPSLVAASAIFLARYTLTPSKKPWNST-----LRHYTLYQPSDLRDC--------V  473
            ML Y+PSL+AASA FLA++TL+P+KKPW        L H TL+   ++  C        V
Sbjct  20   MLHYAPSLIAASAAFLAKFTLSPTKKPWVIFVYFFYLLHRTLFW--NITHCTSPLICVTV  77

Query  472  MALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  329
             +LH+LC N   ++LPAIREKYSQHKYKFVAKK CP SIP EFFQD+S
Sbjct  78   KSLHHLCRNGGRANLPAIREKYSQHKYKFVAKKYCPASIPQEFFQDLS  125



>ref|XP_002984199.1| hypothetical protein SELMODRAFT_423455 [Selaginella moellendorffii]
 gb|EFJ14709.1| hypothetical protein SELMODRAFT_423455 [Selaginella moellendorffii]
Length=404

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF+RA Q      SLQLE L ++LAELSL+ Y  L Y PS++AASA+FLA+ T+ P++
Sbjct  275  LRRFMRAAQASYHTPSLQLEFLGNFLAELSLVEYTFLKYKPSMIAASAVFLAKLTVDPTE  334

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWN TLRHYT Y  S+L  CV  +H L CN+    LPA+REKY QHK+K VA    P+ 
Sbjct  335  DPWNGTLRHYTGYCASELAQCVRDIHELQCNTKGCGLPAVREKYKQHKFKCVATLAAPSP  394

Query  358  IPSEFFQ  338
            I +E F+
Sbjct  395  IAAEKFE  401



>ref|XP_001764427.1| predicted protein [Physcomitrella patens]
 gb|EDQ70694.1| predicted protein [Physcomitrella patens]
Length=237

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF+RA Q   +A +L LE L ++LAEL+L  Y  L + PS++AASA+++++ TL PS 
Sbjct  106  LRRFIRAAQATCKAPNLILEFLGNFLAELTLTEYVFLGFLPSMIAASAVYMSKLTLDPST  165

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
            +PW+ TL+HYT Y+ SDL  CV  +H+L  N+ + +LPAIREKY  HK+K VA    P+ 
Sbjct  166  RPWDVTLQHYTGYKASDLEKCVRLIHDLQRNTKNCTLPAIREKYRNHKFKCVATLTPPSV  225

Query  358  IPSEFFQD  335
            +P EFF+D
Sbjct  226  LPPEFFKD  233



>ref|XP_001772176.1| predicted protein [Physcomitrella patens]
 gb|EDQ62989.1| predicted protein [Physcomitrella patens]
Length=297

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA Q   +A +L LE L ++LAEL+L  Y ML + PS+VAASA++LA+
Sbjct  159  TPTTKSFLRRFVRAAQSSCQAPALVLEFLGNFLAELTLTEYSMLGFLPSMVAASAVYLAK  218

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             TL PSK PW+++L+HYT Y+ S+L  CV  +H+L  N+    LPAIREKY +HK+K V 
Sbjct  219  LTLDPSKCPWDASLQHYTGYRASELEKCVKVIHDLQRNTSSCILPAIREKYRKHKFKCVE  278

Query  379  KKICPTSIPSEFFQD  335
                P+ IP EFF D
Sbjct  279  MLTPPSVIPPEFFID  293



>dbj|BAA20410.1| A-type cyclin [Catharanthus roseus]
Length=372

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRR  R  Q  ++  +LQ E L  YLAELSLL Y  + + PSL+A+S IFL+R+TL P  
Sbjct  244  LRRLTRVVQDGDKNPNLQFEFLGYYLAELSLLDYGCVKFLPSLIASSVIFLSRFTLQPKV  303

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWNS L+H + Y+P+DL++CV+ +H+L  +   SSL A+R+KY QHK+K V+    P S
Sbjct  304  HPWNSLLQHNSGYKPADLKECVLIIHDLQLSKRGSSLVAVRDKYKQHKFKCVSTLTAPPS  363

Query  358  IPSEFFQDV  332
            IP EFF+D+
Sbjct  364  IPDEFFEDI  372



>ref|XP_010271484.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Nelumbo nucifera]
Length=389

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  712  RFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKP  533
            RF RA Q   +  +LQLE L  YLAELSLL    L + PSLVAAS +FL+R+T+ P   P
Sbjct  261  RFTRAAQEDKKFPNLQLEFLGCYLAELSLLDCSCLRFLPSLVAASVVFLSRFTIQPKMHP  320

Query  532  WNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIP  353
            WNSTL+HY+ Y+PSDL+DCV+A+ +L  N    SL A+++KY QHK+K VA    P  IP
Sbjct  321  WNSTLQHYSGYKPSDLKDCVIAIQDLQLNRRGGSLIAVKDKYKQHKFKCVATLSSPPEIP  380

Query  352  SEFFQDV  332
            + +F+D+
Sbjct  381  THYFEDI  387



>ref|XP_001764550.1| predicted protein [Physcomitrella patens]
 gb|EDQ70532.1| predicted protein [Physcomitrella patens]
Length=234

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q   +AS+L LE L ++LAEL+L  Y  L + PS+VAASA+++A+
Sbjct  99   TPTTKSFLRRFIRAAQTNCKASTLVLESLGNFLAELTLTEYSFLGFLPSMVAASAVYVAK  158

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             TL PS  PW++TL+HYT Y+ S+L  CV  +H+L  N+ + +LPAIREKY  HK+K VA
Sbjct  159  LTLDPSTCPWDATLQHYTGYRASELEKCVRIIHDLQRNTKNCTLPAIREKYRHHKFKCVA  218

Query  379  KKICPTSIPSEFFQD  335
                P  +  EFF+D
Sbjct  219  TLTPPLVLTPEFFKD  233



>ref|XP_010688280.1| PREDICTED: putative cyclin-A3-1 [Beta vulgaris subsp. vulgaris]
Length=383

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF R  QG ++  +LQLE L  YLAELSLL Y  + + PS+VAAS IFLA+
Sbjct  245  NPTAKTFLRRFTRVAQGNSKNPNLQLEFLGYYLAELSLLDYGCVKFLPSMVAASVIFLAK  304

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            +T+ P K PWNS+L+ YT Y+PSDL++CV+ + +L  +    SL A++ KY QHKYK V+
Sbjct  305  FTIHPKKHPWNSSLQSYTGYKPSDLKECVLRIQDLQLDRRGGSLVAVKNKYKQHKYKCVS  364

Query  379  KKICPTSIPSEFFQDVSS  326
                 + IP+ +F+DV+ 
Sbjct  365  TLTSLSEIPASYFEDVNE  382



>ref|XP_006374858.1| cyclin A3.1 family protein [Populus trichocarpa]
 gb|ERP52655.1| cyclin A3.1 family protein [Populus trichocarpa]
Length=363

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LLRRF RA Q   + S LQ E L  YLAELSLL Y+ + Y PSLVAAS IFL R+ + P 
Sbjct  234  LLRRFTRAAQEDYKTSDLQFEFLGFYLAELSLLDYNCVKYLPSLVAASVIFLTRFLMRPK  293

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW+STL+ YT Y+ +DL+DCV+ +H+L  +     L A+REKY QHK+K VA    P 
Sbjct  294  THPWSSTLQQYTGYKATDLKDCVLIIHDLYLSRRGGGLQAVREKYKQHKFKCVANMPSPP  353

Query  361  SIPSEFFQDV  332
             IP+ +F +V
Sbjct  354  EIPALYFDEV  363



>gb|EEE54182.1| hypothetical protein OsJ_01005 [Oryza sativa Japonica Group]
Length=505

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVR  Q  +E  +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA+
Sbjct  373  APTAKCFLRRFVRVAQVSDEDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAK  432

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKY+QHK    A
Sbjct  433  FILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYTQHKILHAA  492

Query  379  KKI  371
              I
Sbjct  493  DVI  495



>ref|XP_011029106.1| PREDICTED: putative cyclin-A3-1 [Populus euphratica]
Length=363

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LLRRF RA Q     S LQLE L  YLAELSLL Y+ + Y PSLVAAS IFL R+ + P 
Sbjct  234  LLRRFTRAAQEDYRTSDLQLEFLGFYLAELSLLDYNCVKYLPSLVAASVIFLTRFLMRPK  293

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW+STL+ YT Y+ +DL+DCV+ +H+L  +     L A+REKY QHK+K VA    P 
Sbjct  294  THPWSSTLQQYTGYKATDLKDCVLIIHDLYLSRRGGGLQAVREKYKQHKFKCVANMPSPP  353

Query  361  SIPSEFFQDV  332
             IP+ +F +V
Sbjct  354  EIPALYFDEV  363



>ref|XP_001766360.1| predicted protein [Physcomitrella patens]
 gb|EDQ68688.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q   +  +L LE L +YLAEL+LL Y  L + PS++AASA++LA+
Sbjct  350  TPTTKSFLRRFIRAAQASYKTPTLVLEFLGNYLAELTLLEYGFLPFLPSMIAASAVYLAK  409

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             TL  S  PW++TL+HYT Y+PS+L  CV A+H L  N+   SLPA+REKY QHK+K VA
Sbjct  410  ITLDSSTCPWDATLQHYTGYRPSELGHCVKAIHELQRNTDSCSLPAVREKYRQHKFKCVA  469

Query  379  KKICPTSIPSEFFQD  335
                P  +P E+F D
Sbjct  470  TLAPPAVLPEEYFLD  484



>ref|XP_007019155.1| Cyclin A1,1, putative isoform 2 [Theobroma cacao]
 gb|EOY16380.1| Cyclin A1,1, putative isoform 2 [Theobroma cacao]
Length=418

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LR FV A Q  N+   LQ E LA+Y+AELSLL Y ML Y+PSL+AASA+FLA++
Sbjct  260  PTAKSFLRHFVHAAQMINQVQFLQFECLANYIAELSLLEYIMLHYAPSLIAASAVFLAKF  319

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             L+PS+KPW+S L  YTLYQPS+L +CV  LH+LC N    +L AI++KYSQHK   V 
Sbjct  320  ILSPSRKPWDSMLGRYTLYQPSELYNCVKDLHHLCLNGDCPNLAAIKQKYSQHKVNVVV  378



>ref|XP_008452613.1| PREDICTED: putative cyclin-A3-1 [Cucumis melo]
 ref|XP_008452615.1| PREDICTED: putative cyclin-A3-1 [Cucumis melo]
 ref|XP_008452616.1| PREDICTED: putative cyclin-A3-1 [Cucumis melo]
 ref|XP_008452617.1| PREDICTED: putative cyclin-A3-1 [Cucumis melo]
Length=377

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF    Q   E ++LQ E L  YLAELSLL Y+ + + PSLVAAS  FLAR+ +   
Sbjct  246  FLRRFTLVAQETYEFNTLQFEFLGYYLAELSLLDYNCVKFLPSLVAASVTFLARFMIQSK  305

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K PW S L H+T Y+P+D++DC++ +H+L  +    +L AIREKY QHK+KFV+    P 
Sbjct  306  KHPWTSRLEHFTGYKPADMKDCILLVHDLYLSRRGGALSAIREKYKQHKFKFVSVMPSPP  365

Query  361  SIPSEFFQDV  332
             IP  +F+DV
Sbjct  366  EIPIPYFEDV  375



>ref|XP_004141395.1| PREDICTED: putative cyclin-A3-1 [Cucumis sativus]
 ref|XP_011654138.1| PREDICTED: putative cyclin-A3-1 [Cucumis sativus]
 ref|XP_011654139.1| PREDICTED: putative cyclin-A3-1 [Cucumis sativus]
 ref|XP_011654140.1| PREDICTED: putative cyclin-A3-1 [Cucumis sativus]
 ref|XP_011654141.1| PREDICTED: putative cyclin-A3-1 [Cucumis sativus]
Length=376

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF    Q   E ++LQ E L  YLAELSLL Y+ + + PSLVAAS  FLAR+ +   
Sbjct  245  FLRRFTLVAQETYEFNTLQFEFLGYYLAELSLLDYNCVKFLPSLVAASVTFLARFMIQSK  304

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K PW S L H+T Y+P+D++DC++ +H+L  +    +L AIREKY QHK+KFV+    P 
Sbjct  305  KHPWTSRLEHFTGYKPADMKDCILLVHDLYLSRRGGALSAIREKYKQHKFKFVSVMPSPP  364

Query  361  SIPSEFFQDV  332
             IP  +F+DV
Sbjct  365  EIPIPYFEDV  374



>ref|XP_010936556.1| PREDICTED: cyclin-A3-1-like [Elaeis guineensis]
Length=376

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF +A QG     +LQLE L++YLAELSL+ Y  + + PS++AASA+FLAR+T+ P 
Sbjct  245  FLRRFTKAGQGDGNYPNLQLEFLSNYLAELSLVDYSCVRFLPSVIAASAVFLARFTINPK  304

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW+  L+  T Y+PS+L+DCV A+H+L  N   SSL AIREKY QH++K  +  + P+
Sbjct  305  VHPWSLPLQQQTGYKPSELKDCVCAIHDLQLNRKWSSLTAIREKYKQHRFKCASMLLSPS  364

Query  361  SIPSEFFQDV  332
             IP+ + +D+
Sbjct  365  EIPASYLEDL  374



>gb|KGN55246.1| hypothetical protein Csa_4G642270 [Cucumis sativus]
Length=353

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF    Q   E ++LQ E L  YLAELSLL Y+ + + PSLVAAS  FLAR+ +   
Sbjct  222  FLRRFTLVAQETYEFNTLQFEFLGYYLAELSLLDYNCVKFLPSLVAASVTFLARFMIQSK  281

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            K PW S L H+T Y+P+D++DC++ +H+L  +    +L AIREKY QHK+KFV+    P 
Sbjct  282  KHPWTSRLEHFTGYKPADMKDCILLVHDLYLSRRGGALSAIREKYKQHKFKFVSVMPSPP  341

Query  361  SIPSEFFQDV  332
             IP  +F+DV
Sbjct  342  EIPIPYFEDV  351



>ref|XP_008787130.1| PREDICTED: cyclin-A3-1-like [Phoenix dactylifera]
Length=376

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF +A QG     +LQLE L++YLAELSL+ Y  + + PS++AASA+F+AR+T+ P 
Sbjct  245  FLRRFTKAGQGDGNYPNLQLEFLSNYLAELSLVDYGCVRFLPSVIAASAVFIARFTIDPK  304

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW+ +L+  T Y+P++L+DCV A+H+L  N   SSL AIREKY QH++K  +  + P+
Sbjct  305  AHPWSLSLQQQTGYKPTELKDCVCAIHDLQLNRKWSSLTAIREKYKQHRFKCASMLLSPS  364

Query  361  SIPSEFFQDV  332
             IP+ + +D+
Sbjct  365  EIPASYLEDL  374



>ref|XP_010059872.1| PREDICTED: putative cyclin-A3-1 [Eucalyptus grandis]
 gb|KCW66318.1| hypothetical protein EUGRSUZ_F00143 [Eucalyptus grandis]
Length=385

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -3

Query  718  LRRFVR-ATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LRRF R A +G    + LQLE L  YLAELSLL Y  + + PSLVAAS IFLAR+ + P 
Sbjct  254  LRRFNRIAQEGLKANNHLQLEFLGYYLAELSLLDYSCVKFLPSLVAASVIFLARFMIRPK  313

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW+  L+ Y+ Y P DL+DCV  LH+L  +    SLPA+REKY QHK+K VA    P 
Sbjct  314  SHPWSLALQQYSGYCPKDLKDCVQILHDLYLSRRGGSLPAVREKYRQHKFKCVASMASPP  373

Query  361  SIPSEFFQDVSS  326
             IP+ +F+D+  
Sbjct  374  EIPATYFEDIGE  385



>ref|XP_002974260.1| hypothetical protein SELMODRAFT_442428 [Selaginella moellendorffii]
 gb|EFJ24482.1| hypothetical protein SELMODRAFT_442428 [Selaginella moellendorffii]
Length=361

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 91/134 (68%), Gaps = 2/134 (1%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LRRF+RA Q   +  SLQLE L +YLAEL+LL Y+ L +S SLVAAS +FLAR 
Sbjct  225  PTTKTFLRRFIRAAQSSYQVPSLQLEFLGNYLAELTLLEYNFLKFSSSLVAASIVFLARI  284

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
            T+  S +PW++TL+HY+ Y+PS L  CV+A+H L   S  S+LP +REKY QHK+K VA 
Sbjct  285  TIDSSARPWSTTLQHYSGYRPSQLEACVLAIHGLQTKS--STLPGVREKYKQHKFKCVAT  342

Query  376  KICPTSIPSEFFQD  335
               P  +  ++F D
Sbjct  343  LQPPPVLFFQYFDD  356



>ref|XP_002985630.1| hypothetical protein SELMODRAFT_234858 [Selaginella moellendorffii]
 gb|EFJ13208.1| hypothetical protein SELMODRAFT_234858 [Selaginella moellendorffii]
Length=361

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 91/134 (68%), Gaps = 2/134 (1%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LRRF+RA Q   +  SLQLE L +YLAEL+LL Y+ L +S SLVAAS +FLAR 
Sbjct  225  PTTKTFLRRFIRAAQSSYQVPSLQLEFLGNYLAELTLLEYNFLKFSSSLVAASIVFLARI  284

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
            T+  S +PW++TL+HY+ Y+PS L  CV+A+H L   S  S+LP +REKY QHK+K VA 
Sbjct  285  TIDSSARPWSTTLQHYSGYRPSQLEACVLAIHGLQTKS--STLPGVREKYKQHKFKCVAT  342

Query  376  KICPTSIPSEFFQD  335
               P  +  ++F D
Sbjct  343  LQPPPVLFFQYFDD  356



>ref|XP_002285074.2| PREDICTED: putative cyclin-A3-1 [Vitis vinifera]
 emb|CBI19446.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF R  Q   +  +LQLE L  YLAELSLL Y  + + PS+VAAS IFL+R+TL P 
Sbjct  234  FLRRFTRIAQENYKTPNLQLEFLVYYLAELSLLDYGCVKFLPSMVAASVIFLSRFTLRPK  293

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW S+L+H++ Y+PS+L++CV+ +H+L  +    SL A+REKY QHK+K VA    P+
Sbjct  294  THPWCSSLQHHSGYKPSELKECVLIIHDLQLSRRGGSLVAVREKYKQHKFKCVATLSSPS  353

Query  361  SIPSEFFQDV  332
             IP  +F+D+
Sbjct  354  VIPVSYFEDI  363



>ref|XP_010906637.1| PREDICTED: cyclin-A3-1-like [Elaeis guineensis]
Length=372

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF +A Q   +  +L LE L SYLAELSLL Y  + + PS+VAASA+FLAR
Sbjct  235  NPTTKTFLRRFTKAGQEEGKYPALLLEFLGSYLAELSLLDYGCVRFLPSVVAASAVFLAR  294

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             T+ P+  PWN TL++ T Y+PS+L++CV A+H L  N   S+L AI++KY QH++K V+
Sbjct  295  LTINPASHPWNETLQNNTGYRPSELKECVHAIHALQLNKKGSALVAIKDKYKQHRFKCVS  354

Query  379  KKICPTSIPSEFFQDV  332
              + P+ IP+ +F+D+
Sbjct  355  ALLPPSKIPTSYFEDL  370



>gb|KFK44637.1| hypothetical protein AALP_AA1G284800 [Arabis alpina]
Length=370

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            SP     LRRF R  Q   EAS LQ+E L  YL+ELS+L Y  + + PSL+AASAIFLAR
Sbjct  228  SPTIRTFLRRFTRVAQEDFEASHLQMEFLCCYLSELSMLDYSCVGFLPSLLAASAIFLAR  287

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P + PWN TL  YT Y+ SDL+ CV  +H+L  +   + L A+R KY QHK+K VA
Sbjct  288  FILRPKQHPWNQTLEEYTKYKASDLQLCVGIIHDLYLSRRGNGLEAVRNKYKQHKFKCVA  347

Query  379  KKICPTSIPSEFFQDVS  329
                   +P  FF+DV+
Sbjct  348  TMPVSPEMPLAFFEDVT  364



>gb|KFK44638.1| hypothetical protein AALP_AA1G284800 [Arabis alpina]
Length=369

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            SP     LRRF R  Q   EAS LQ+E L  YL+ELS+L Y  + + PSL+AASAIFLAR
Sbjct  227  SPTIRTFLRRFTRVAQEDFEASHLQMEFLCCYLSELSMLDYSCVGFLPSLLAASAIFLAR  286

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L P + PWN TL  YT Y+ SDL+ CV  +H+L  +   + L A+R KY QHK+K VA
Sbjct  287  FILRPKQHPWNQTLEEYTKYKASDLQLCVGIIHDLYLSRRGNGLEAVRNKYKQHKFKCVA  346

Query  379  KKICPTSIPSEFFQDVS  329
                   +P  FF+DV+
Sbjct  347  TMPVSPEMPLAFFEDVT  363



>dbj|BAK05525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            SP     +RRF R+     + SSL LE + SYLAELSLL Y  L + PS+VAAS+IFLAR
Sbjct  239  SPTIKTFIRRFTRSGPEDKKRSSLLLEFMGSYLAELSLLDYSCLRFLPSVVAASSIFLAR  298

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             T+ P   PW   +   T Y  S+L+DC++A+H+L  N    SLPAIR+KY QH++K V+
Sbjct  299  LTIGPDTNPWGKEMHKLTGYGASELKDCIIAIHDLQLNRKGPSLPAIRDKYKQHRFKCVS  358

Query  379  KKICPTSIPSEFFQDVS  329
              + P  IP+ +FQD++
Sbjct  359  MLLPPVEIPASYFQDLT  375



>ref|XP_003630468.1| Cyclin A [Medicago truncatula]
Length=558

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF+   Q   E   +QLE+LA Y+A+LSLL YDML Y+PSL+AASA FLA+Y L  +
Sbjct  380  FLRRFITVAQQTCEIPLMQLEYLADYVADLSLLEYDMLKYTPSLIAASATFLAKYILLST  439

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS--SLPAIREKYSQHK  395
            K PWNS LRHYT YQ S+LR+CV  LH L  N +HS  S+ AIREKYSQHK
Sbjct  440  KNPWNSMLRHYTGYQASELRECVEGLHLLYRNGYHSSPSITAIREKYSQHK  490



>emb|CAC27333.1| putative A-like cyclin [Picea abies]
Length=380

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -3

Query  616  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  437
            D L Y PSL+AA+A+FLAR TL P   PWNSTL+HYT Y+ SD+RDC+ A+H+L  N   
Sbjct  284  DFLKYLPSLIAAAAVFLARMTLDPMVHPWNSTLQHYTGYKVSDMRDCICAIHDLQLNRKG  343

Query  436  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  335
             +L AIR+KY+Q K+K VA    P  I  +FF D
Sbjct  344  CTLAAIRDKYNQPKFKCVANLFPPPVISPQFFID  377



>ref|XP_010442082.1| PREDICTED: putative cyclin-A3-1 [Camelina sativa]
Length=364

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P S   LRRF R  Q   E S LQ+E L SYL+ELS+L Y+ L + PS+VAASA+FLAR
Sbjct  227  NPTSNTFLRRFTRVAQEDFEMSPLQMEFLCSYLSELSMLDYNSLKFLPSIVAASAVFLAR  286

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P + PWN  L  YT Y+  DL++CV  +H+L  +    +L AIREKY QHK+K VA
Sbjct  287  FIIRPKQHPWNVMLEEYTKYKAGDLKECVRMIHDLYLSRKGGALQAIREKYKQHKFKCVA  346

Query  379  KKICPTSIPSEFFQDVS  329
                   +P   F+DV+
Sbjct  347  TMPVSPELPLTAFEDVN  363



>ref|XP_008455012.1| PREDICTED: cyclin-A3-1-like isoform X2 [Cucumis melo]
Length=359

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -3

Query  598  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  419
            PS VAASAIFL+R+T+ P + PW   L+HYT Y+PS+L++C++A+H+L  N   SSL AI
Sbjct  263  PSKVAASAIFLSRFTIQPGEHPWCLALQHYTGYRPSELKECILAIHDLQLNRKGSSLRAI  322

Query  418  REKYSQHKYKFVAKKICPTSIPSEFFQDVSS  326
            R KY ++K++ VA+   P+ IP+++F+D+ S
Sbjct  323  RNKYKENKFRRVAELSSPSEIPADYFEDIVS  353



>ref|XP_008455011.1| PREDICTED: cyclin-A3-1-like isoform X1 [Cucumis melo]
Length=360

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -3

Query  598  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  419
            PS VAASAIFL+R+T+ P + PW   L+HYT Y+PS+L++C++A+H+L  N   SSL AI
Sbjct  264  PSKVAASAIFLSRFTIQPGEHPWCLALQHYTGYRPSELKECILAIHDLQLNRKGSSLRAI  323

Query  418  REKYSQHKYKFVAKKICPTSIPSEFFQDVSS  326
            R KY ++K++ VA+   P+ IP+++F+D+ S
Sbjct  324  RNKYKENKFRRVAELSSPSEIPADYFEDIVS  354



>emb|CDP01248.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF R  +      +LQLE L  YLAELSLL Y  + Y PSLVAA+ +FL+R+TL P 
Sbjct  226  FLRRFTRVAKEDYNNPNLQLEFLGYYLAELSLLDYGCVKYLPSLVAAAVVFLSRFTLQPE  285

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PWN+ L+ Y+ Y+P++L++CV  +H+L      S+L A+REKY+QHK+K V+    P 
Sbjct  286  LHPWNAALQQYSGYKPAELKECVQLIHDLQLGRRGSTLVAVREKYNQHKFKCVSTLSPPP  345

Query  361  SIPSEFFQDVSS  326
             IP  FF+DV  
Sbjct  346  GIPDTFFEDVKD  357



>ref|XP_011017147.1| PREDICTED: putative cyclin-A3-1 [Populus euphratica]
Length=363

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF R      + S+LQLE L  YLAELSLL Y+ + + PSLVAAS IFL R+ + P  
Sbjct  235  LRRFTRVALEDYKTSNLQLEFLGFYLAELSLLDYNCVKFLPSLVAASVIFLTRFLMRPKT  294

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+STL+ YT Y+ +DLR+CV+ +H+L        LPA+ EKY QHK+K VA    P  
Sbjct  295  NPWSSTLQQYTGYKAADLRECVLIIHDLYLRRRGGGLPAVGEKYKQHKFKCVANMPSPPE  354

Query  358  IPSEFFQDV  332
            +P+ +F++V
Sbjct  355  LPALYFEEV  363



>ref|XP_004290941.1| PREDICTED: putative cyclin-A3-1 [Fragaria vesca subsp. vesca]
Length=365

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            +LRRF R  +  N+   L  E L  YLAELSLL Y+ + + PSLVAAS +FL R+ + P 
Sbjct  234  ILRRFNRVAEEGNKDPDLHFEFLGYYLAELSLLDYNCVKFLPSLVAASVVFLTRFIIQPR  293

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW S+L+ Y+ Y+PS+L++CV+ +H+L       SL AIREKY +HK+K VA    P 
Sbjct  294  MNPWTSSLQQYSGYKPSELKECVLIIHDLYLGRRGGSLQAIREKYKRHKFKCVAVMPSPP  353

Query  361  SIPSEFFQDV  332
             +P+ FF+DV
Sbjct  354  EVPAYFFEDV  363



>ref|XP_007018576.1| Cyclin A3,1 [Theobroma cacao]
 gb|EOY15801.1| Cyclin A3,1 [Theobroma cacao]
Length=390

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRR  R  Q  N+ASSLQLE L  YLAELSLL Y  + + PS+VAAS  FL R+ + P +
Sbjct  246  LRRLTRVAQEDNKASSLQLEFLGYYLAELSLLDYGCVKFLPSMVAASVTFLTRFIIQPKR  305

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+S ++ Y+ Y+ SDL++CV+ +H+L  +    +L A+REKY QHK+K VA       
Sbjct  306  HPWSSAVQQYSGYKASDLKECVLIIHDLYLSRRGGALQAVREKYKQHKFKCVAMMPASPE  365

Query  358  IPSEFFQDVSS  326
            IP+ +F+DV  
Sbjct  366  IPASYFEDVQE  376



>gb|EPS73971.1| hypothetical protein M569_00786 [Genlisea aurea]
Length=324

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 86/133 (65%), Gaps = 27/133 (20%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFVRA QG +EA  L LE L++++AELSLL Y ML ++PS++AASAIFLA+
Sbjct  213  APTTKCFLRRFVRAAQGADEAPLLLLECLSNFVAELSLLEYGMLRFAPSMIAASAIFLAK  272

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + L PSK+PWN+TLRHYT Y+ SDLR+C                           YKFVA
Sbjct  273  FILLPSKRPWNATLRHYTRYEASDLREC---------------------------YKFVA  305

Query  379  KKICPTSIPSEFF  341
            KK CP ++P ++F
Sbjct  306  KKYCPPAVPQDYF  318



>ref|XP_010494276.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Camelina sativa]
Length=364

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P S   LRRF R  Q   + S LQ+E L SYL+ELS+L Y+ L + PS+VAASA+FLAR
Sbjct  227  NPTSNTFLRRFTRVAQEDFQMSPLQMEFLCSYLSELSMLDYNSLKFLPSIVAASAVFLAR  286

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P + PWN  L  YT Y+  DL++CV  +H+L  +    +L AIREKY QHK+K VA
Sbjct  287  FIIRPKQHPWNVMLEEYTKYKAGDLKECVRMIHDLYLSRKGGALQAIREKYKQHKFKCVA  346

Query  379  KKICPTSIPSEFFQDVS  329
                   +P   F+DV+
Sbjct  347  TMPVSPELPLTVFEDVN  363



>ref|XP_011015741.1| PREDICTED: putative cyclin-A3-1 [Populus euphratica]
Length=363

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF R      + S+LQLE L  YLAELSLL Y+ + + PSLVAAS IFL R+ + P  
Sbjct  235  LRRFTRVALEDYKTSNLQLEFLGFYLAELSLLDYNCVKFLPSLVAASVIFLTRFLMRPKT  294

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+STL+ YT Y+ +DLR+CV+ +H+L  +     L A+REKY QHK+K VA    P  
Sbjct  295  NPWSSTLQQYTGYKAADLRECVLIIHDLYLSRRGGGLQAVREKYKQHKFKCVANMPSPPE  354

Query  358  IPSEFFQDV  332
            +P+ +F++V
Sbjct  355  LPALYFEEV  363



>ref|XP_002301157.1| cyclin A3.1 family protein [Populus trichocarpa]
 gb|EEE80430.1| cyclin A3.1 family protein [Populus trichocarpa]
Length=360

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF R      + S+LQLE L  YLAELSLL Y+ + + PSLVAAS IFL R+ + P  
Sbjct  232  LRRFTRVALEDYKTSNLQLEFLGFYLAELSLLDYNCVKFLPSLVAASVIFLTRFLMRPKT  291

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+STL+ YT Y+ +DLR+CV+ +H+L  +     L A+REKY QHK+K VA    P  
Sbjct  292  NPWSSTLQQYTGYKAADLRECVLIIHDLYLSRRGGGLQAVREKYKQHKFKCVANMPSPPE  351

Query  358  IPSEFFQDV  332
            +P+ +F++V
Sbjct  352  LPALYFEEV  360



>ref|XP_011069760.1| PREDICTED: putative cyclin-A3-1 [Sesamum indicum]
Length=386

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LR+F +  Q   E+SS QLE L  YLAELSLL Y  + + PSLVAAS IFL+R+TL P  
Sbjct  250  LRKFTQIAQEDYESSSEQLEFLGGYLAELSLLDYGCVKFLPSLVAASVIFLSRFTLQPQL  309

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWNS L+ ++ Y+ +DL++CV  LH+L  +   S+L A+REKY Q K+K V+    P+ 
Sbjct  310  HPWNSALQRHSGYEAADLKECVCILHDLQMSRRGSALVAVREKYKQQKFKCVSTLSTPSE  369

Query  358  IPSEFFQDVSS  326
            +P  FF+D+ S
Sbjct  370  VPESFFEDIKS  380



>ref|XP_002466828.1| hypothetical protein SORBIDRAFT_01g014850 [Sorghum bicolor]
 gb|EER93826.1| hypothetical protein SORBIDRAFT_01g014850 [Sorghum bicolor]
Length=378

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (70%), Gaps = 1/128 (1%)
 Frame = -3

Query  718  LRRFVRATQ-GFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LR F+R+ Q   N+  SLQLE L +YL ELSLL Y +L + PSLVAAS +F+AR TL P 
Sbjct  247  LRMFIRSAQEDNNKCPSLQLEFLGNYLCELSLLDYSLLRFLPSLVAASVVFVARLTLDPH  306

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW+  ++  T Y+PS+L+DCV A+H++  N  +SS+ AIREKY QHK+K V+  + P 
Sbjct  307  TNPWSKKMQTLTGYKPSELKDCVAAIHHMQLNRKYSSMMAIREKYKQHKFKGVSALLPPV  366

Query  361  SIPSEFFQ  338
             IP+ +F+
Sbjct  367  EIPASYFK  374



>ref|XP_003550316.1| PREDICTED: putative cyclin-A3-1-like isoform X1 [Glycine max]
 gb|KHN45268.1| Putative cyclin-A3-1 [Glycine soja]
Length=367

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF R  Q   + S LQ E L+ YLAELSLL Y+ + + PSLVAAS +FLAR+  +  
Sbjct  231  FLRRFSRVGQEGVDTSDLQFEFLSCYLAELSLLDYNCIKFLPSLVAASVVFLARFMFSTK  290

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PWNS L   T Y+P+DL++CV+ LH+L  +   +SL A+REKY QHK+K VA    P 
Sbjct  291  THPWNSALHQLTRYKPADLKECVLNLHDLYLSRRGASLQAVREKYKQHKFKCVATTPSPP  350

Query  361  SIPSEFFQ  338
             IP  FF+
Sbjct  351  EIPLSFFE  358



>ref|XP_006280684.1| hypothetical protein CARUB_v10026648mg [Capsella rubella]
 gb|EOA13582.1| hypothetical protein CARUB_v10026648mg [Capsella rubella]
Length=362

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P S   LRRF R +Q   E S LQ+E L SYL+ELS+L Y+ L + PS+VAAS++FLAR
Sbjct  225  NPTSNTFLRRFTRVSQEDFEMSPLQMEFLCSYLSELSMLDYNSLKFLPSIVAASSVFLAR  284

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P + PW+  L  YT Y+  DL++CV  +H+L  +    +L AIR+KY QHK+K VA
Sbjct  285  FIIRPKQHPWSVMLEEYTKYKAGDLKECVGMIHDLYLSRKGGALQAIRDKYKQHKFKCVA  344

Query  379  KKICPTSIPSEFFQDVS  329
                   +P  FF+DV+
Sbjct  345  TMPVSPELPLTFFEDVN  361



>ref|XP_002510134.1| cyclin A, putative [Ricinus communis]
 gb|EEF52321.1| cyclin A, putative [Ricinus communis]
Length=373

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF R  Q   +  +LQLE L  YLAELSLL Y+ + + PSLVA+S IFLAR+ + P  
Sbjct  243  LRRFTRIAQEGYKNLNLQLEFLGYYLAELSLLDYNCVKFLPSLVASSVIFLARFMIKPKM  302

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+STL+ ++ Y+PSDL++CV+ +H+L  +     L A+REKY QHK+K VA    P  
Sbjct  303  HPWSSTLQQHSGYRPSDLKECVLIIHDLYLSRRGGGLQAVREKYKQHKFKCVATMPSPPE  362

Query  358  IPSEFFQDV  332
            IP+ +F+ V
Sbjct  363  IPAAYFEGV  371



>ref|XP_006433587.1| hypothetical protein CICLE_v10001544mg [Citrus clementina]
 gb|ESR46827.1| hypothetical protein CICLE_v10001544mg [Citrus clementina]
 gb|KDO81588.1| hypothetical protein CISIN_1g017386mg [Citrus sinensis]
Length=372

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            SP     LRRF R  Q    AS+LQLE L  YLAELSLL Y  + + PS VAAS IFLAR
Sbjct  235  SPTVKTFLRRFTRVAQEDYNASNLQLEFLGYYLAELSLLDYACVKFLPSSVAASVIFLAR  294

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            +   PSK PW ++L+ Y+ Y+PS++  CV+ LH+L  +    +L A+REKY QHK+K VA
Sbjct  295  FITQPSKHPWTASLQQYSGYKPSEIEGCVLILHDLYLSRRGGNLQAVREKYKQHKFKCVA  354

Query  379  KKICPTSIPSEFFQDV  332
                   IPS +F+D+
Sbjct  355  TTPSSPEIPSCYFEDI  370



>ref|XP_008780924.1| PREDICTED: cyclin-A3-1-like [Phoenix dactylifera]
Length=379

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF +A Q   +  +L LE L SYLAELSLL Y  + + PS++AASA+FLAR
Sbjct  241  NPTTKTFLRRFTKAGQEDGKYPALLLEFLGSYLAELSLLDYGCVRFLPSVIAASAVFLAR  300

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
             T+  +  PWN TL+ YT Y+PS+L++CV A+++L  N   S+L AI+EKY QH++K VA
Sbjct  301  LTINRASHPWNETLQRYTGYKPSELKECVHAIYDLQLNKKGSALVAIKEKYRQHRFKCVA  360

Query  379  KKICPTS-IPSEFFQDV  332
              + P S IP+ +F+D+
Sbjct  361  AALLPPSEIPASYFEDL  377



>gb|KHN21404.1| Cyclin-A3-4 [Glycine soja]
Length=265

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 82/127 (65%), Gaps = 0/127 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF R  Q   + S LQ E L+ YLAELSLL Y+ + + PSLVAAS +FLAR+  +   
Sbjct  130  LRRFSRVAQEGVDTSDLQFEFLSCYLAELSLLDYNCIKFLPSLVAASVVFLARFMFSTKT  189

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWN  L   T Y+P+DL++CV+ LH+L  +   +SL A+REKY QHK+K VA    P  
Sbjct  190  HPWNLALHQLTRYKPADLKECVLNLHDLYLSRRGASLQAVREKYKQHKFKCVATTASPPK  249

Query  358  IPSEFFQ  338
            IP  FF+
Sbjct  250  IPLSFFE  256



>ref|NP_001233768.1| cyclin A2 [Solanum lycopersicum]
 emb|CAB46642.1| cyclin A2 [Solanum lycopersicum]
Length=475

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFV+A+Q   E  S++LE +A+YLAEL+L  Y  L + PS+ AASA+FLAR
Sbjct  344  APTTKKFLRRFVQASQASYEVPSVELEFMANYLAELTLAEYSFLKFLPSVTAASAVFLAR  403

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            +TL  S  PWNSTL HYT Y+ SDL+  V+ L +L  N+  S+L AIREKY Q K+K VA
Sbjct  404  WTLDQSNHPWNSTLEHYTTYKASDLKTTVLLLQDLQMNTSGSTLNAIREKYKQPKFKSVA  463

Query  379  KKICPTSIPSEF  344
                P  + S F
Sbjct  464  TLSSPKPVQSLF  475



>gb|AEX07598.1| cyclin A3-1, partial [Brassica juncea]
Length=267

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF R  Q     S LQ+E L SYL+ELS+L Y  L + PS+VAASA++LAR
Sbjct  130  NPTTNTFLRRFTRVAQEDFNMSHLQMEFLCSYLSELSMLDYSSLKFLPSVVAASAVYLAR  189

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P + PW+  L  YT Y+  DLR+CV  +H+L  +    +L A+REKY QHK+K VA
Sbjct  190  FIIRPKQHPWSVMLEEYTRYKAGDLRECVCMIHDLYLSRKGGALQAVREKYKQHKFKCVA  249

Query  379  KKICPTSIPSEFFQDVS  329
                   +P  FF+DVS
Sbjct  250  TMPVSPELPLTFFEDVS  266



>ref|XP_002865455.1| CYCA3_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41714.1| CYCA3_1 [Arabidopsis lyrata subsp. lyrata]
Length=359

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P S   LRRF R  Q   E S LQ+E L SYL+ELS+L Y  + + PS+VAASA+FLAR
Sbjct  222  NPTSNTFLRRFTRVAQEDFEMSHLQMEFLCSYLSELSMLDYQSVKFLPSIVAASAVFLAR  281

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P + PWN  L  YT Y+  DL++CV  +H+L  +    +L AIR+KY QHK+K VA
Sbjct  282  FIIRPKQHPWNVMLEEYTKYKAGDLKECVGMIHDLYLSRKGGALQAIRDKYKQHKFKCVA  341

Query  379  KKICPTSIPSEFFQDVS  329
                   +P   F+DV+
Sbjct  342  TMPVSPELPLTLFEDVN  358



>ref|XP_010322316.1| PREDICTED: cyclin A2 isoform X1 [Solanum lycopersicum]
Length=492

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRFV+A+Q   E  S++LE +A+YLAEL+L  Y  L + PS+ AASA+FLAR
Sbjct  361  APTTKKFLRRFVQASQASYEVPSVELEFMANYLAELTLAEYSFLKFLPSVTAASAVFLAR  420

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            +TL  S  PWNSTL HYT Y+ SDL+  V+ L +L  N+  S+L AIREKY Q K+K VA
Sbjct  421  WTLDQSNHPWNSTLEHYTTYKASDLKTTVLLLQDLQMNTSGSTLNAIREKYKQPKFKSVA  480

Query  379  KKICPTSIPSEF  344
                P  + S F
Sbjct  481  TLSSPKPVQSLF  492



>gb|KHG09323.1| Cyclin-A3-2 -like protein [Gossypium arboreum]
Length=389

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF R  Q   + SSLQLE L  YLAELSLL Y  + + PS+VAAS IFLAR+ + P  
Sbjct  247  LRRFTRVAQEDYKDSSLQLECLGCYLAELSLLDYGCVKFLPSMVAASVIFLARFIIEPKM  306

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+S ++ Y+ Y+ SDL++CV+ +H+L  +    +L A+REKY QHK+K VA       
Sbjct  307  HPWSSAVQEYSGYKASDLKECVLIIHDLYLSRRGGALQAVREKYKQHKFKCVATMPASPE  366

Query  358  IPSEFFQDV  332
            IP+ +F+DV
Sbjct  367  IPASYFEDV  375



>emb|CDY22369.1| BnaA06g36910D [Brassica napus]
Length=351

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF R  Q     S LQ+E L SYL+ELS+L Y+ L + PS+VAASA++LAR
Sbjct  214  NPTTNTFLRRFTRVAQEDFNMSHLQMEFLCSYLSELSMLDYNSLKFLPSVVAASAVYLAR  273

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P + PW+  L  YT Y+  DLR+CV  +H+L  +    +L A+REKY QHK+K VA
Sbjct  274  FIIRPKQHPWSVMLEEYTRYKAGDLRECVCMIHDLYLSRKGGALQAVREKYKQHKFKCVA  333

Query  379  KKICPTSIPSEFFQDVS  329
                   +P  FF+DVS
Sbjct  334  TMPVSPELPLTFFEDVS  350



>ref|NP_001146465.1| cyclin superfamily protein, putative [Zea mays]
 gb|ACL54073.1| unknown [Zea mays]
 tpg|DAA50473.1| TPA: cyclin superfamily protein, putative [Zea mays]
Length=372

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEA-SSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLA  563
            SP +   LR F+R+ Q  N+   SLQLE L SYL+ELSLL Y ++   PSLVAASA+F+A
Sbjct  234  SPTAKTFLRMFIRSAQEDNKKYPSLQLEFLGSYLSELSLLDYGLIRSLPSLVAASAVFVA  293

Query  562  RYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFV  383
            R TL P   PW+  ++  T Y+PS+L+DCV A+HNL  N    S+ AIREKY QH++K V
Sbjct  294  RLTLDPHTHPWSKKVQTLTGYKPSELKDCVAAIHNLQLNRTCQSMVAIREKYRQHRFKGV  353

Query  382  AKKICPTSIPSEFF  341
            +  + P  IP+ +F
Sbjct  354  SALLPPVEIPASYF  367



>gb|KJB58584.1| hypothetical protein B456_009G216800 [Gossypium raimondii]
Length=389

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF R  Q   + SSLQLE L  YLAELSLL Y  + + PS+VAAS IFLAR+ + P  
Sbjct  247  LRRFTRVAQEDYKDSSLQLECLGCYLAELSLLDYGCVKFLPSMVAASVIFLARFIIQPKM  306

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+S ++ Y+ Y+ SDL++CV+ +H+L  +    +L A+REKY QHK+K VA       
Sbjct  307  HPWSSAVQEYSGYKASDLKECVLIIHDLYLSRRGGALQAVREKYKQHKFKCVATMPASPE  366

Query  358  IPSEFFQDV  332
            IP+ +F+DV
Sbjct  367  IPASYFEDV  375



>gb|EEE54185.1| hypothetical protein OsJ_01008 [Oryza sativa Japonica Group]
Length=497

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 81/112 (72%), Gaps = 5/112 (4%)
 Frame = -3

Query  715  RRFVRATQGFNE-----ASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTL  551
            RRFVR  Q  +E       +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA++ L
Sbjct  369  RRFVRVAQVSDELFIVQDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAKFIL  428

Query  550  TPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHK  395
             P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKY+QHK
Sbjct  429  QPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYTQHK  480



>ref|XP_009101815.1| PREDICTED: putative cyclin-A3-1 [Brassica rapa]
Length=379

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF R  Q     S LQ+E L SYL+ELS+L Y+ L + PS+VAASA++LAR
Sbjct  242  NPTTNTFLRRFTRVAQEDFNMSHLQMEFLCSYLSELSMLDYNSLKFLPSVVAASAVYLAR  301

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P + PW+  L  YT Y+  DLR+CV  +H+L  +    +L A+REKY QHK+K VA
Sbjct  302  FIIRPKQHPWSVMLEEYTRYKAGDLRECVCMIHDLYLSRKGGALQAVREKYKQHKFKCVA  361

Query  379  KKICPTSIPSEFFQDVS  329
                   +P  FF+DVS
Sbjct  362  TMPVSPELPLTFFEDVS  378



>ref|XP_006601271.1| PREDICTED: putative cyclin-A3-1-like isoform X2 [Glycine max]
Length=405

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  724  MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTP  545
            ++ RRF R  Q   + S LQ E L+ YLAELSLL Y+ + + PSLVAAS +FLAR+  + 
Sbjct  268  LVCRRFSRVGQEGVDTSDLQFEFLSCYLAELSLLDYNCIKFLPSLVAASVVFLARFMFST  327

Query  544  SKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICP  365
               PWNS L   T Y+P+DL++CV+ LH+L  +   +SL A+REKY QHK+K VA    P
Sbjct  328  KTHPWNSALHQLTRYKPADLKECVLNLHDLYLSRRGASLQAVREKYKQHKFKCVATTPSP  387

Query  364  TSIPSEFFQ  338
              IP  FF+
Sbjct  388  PEIPLSFFE  396



>ref|XP_003544479.1| PREDICTED: putative cyclin-A3-1-like isoform X1 [Glycine max]
Length=364

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF R  Q   + S LQ E L+ YLAELSLL Y+ + + PSLVAAS +FLAR+  +  
Sbjct  228  FLRRFSRVAQEGVDTSDLQFEFLSCYLAELSLLDYNCIKFLPSLVAASVVFLARFMFSTK  287

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PWN  L   T Y+P+DL++CV+ LH+L  +   +SL A+REKY QHK+K VA    P 
Sbjct  288  THPWNLALHQLTRYKPADLKECVLNLHDLYLSRRGASLQAVREKYKQHKFKCVATTASPP  347

Query  361  SIPSEFFQ  338
             IP  FF+
Sbjct  348  KIPLSFFE  355



>ref|XP_012068270.1| PREDICTED: putative cyclin-A3-1 [Jatropha curcas]
 gb|KDP41661.1| hypothetical protein JCGZ_16068 [Jatropha curcas]
Length=368

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 87/138 (63%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            SP     LRRF    Q   +  +LQLE L  YL+ELSLL Y+ + + PSLVAAS IFLAR
Sbjct  231  SPTVKTFLRRFTNVAQEDYKMLNLQLEFLGYYLSELSLLDYNCVKFLPSLVAASVIFLAR  290

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P   PW+ TL+ Y+ Y+ S+L++CV+ +H+L  +   + L A+REKY QHK+K+VA
Sbjct  291  FIIKPKMHPWSLTLQQYSRYKSSELKECVLIIHDLYLSRRGAGLQAVREKYKQHKFKYVA  350

Query  379  KKICPTSIPSEFFQDVSS  326
                P  +P  FF+ V  
Sbjct  351  TLPSPPEVPGYFFEGVKE  368



>ref|XP_004963009.1| PREDICTED: cyclin-A3-2-like isoform X1 [Setaria italica]
 ref|XP_004963010.1| PREDICTED: cyclin-A3-2-like isoform X2 [Setaria italica]
Length=437

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF R+     + S L +E L SYLAELSLL Y  L + PS+VAAS +F+AR T+ P  
Sbjct  307  LRRFTRSAHEDKKRSILLMEFLGSYLAELSLLDYGCLRFLPSVVAASVMFVARLTIDPDV  366

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWN  L+  T Y+ S+L+DC++A+H+L  N   SSL AIR+KY QHK+KFV+  + P  
Sbjct  367  NPWNKKLQKVTGYKASELKDCIIAIHDLQLNRKCSSLMAIRDKYKQHKFKFVSTLLPPVV  426

Query  358  IPSEFFQDVSS  326
            IP+ + +D++ 
Sbjct  427  IPASYLEDLAE  437



>emb|CAA83460.1| cyclin 3a [Arabidopsis thaliana]
Length=443

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LRRF+RA Q  ++   +++E+LA+Y AEL+L  Y  L + PSL+AASA+FLAR+
Sbjct  311  PTTKTFLRRFIRAAQASDKVPLIEMEYLANYFAELTLTEYTFLRFLPSLIAASAVFLARW  370

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
            TL  S  PWN TL+HYT Y+ S L++ V+A+ +L  N+  S+L AIR KY+Q K+K VA 
Sbjct  371  TLDQSNHPWNKTLQHYTRYETSALKNAVLAMEDLQLNTSGSTLIAIRTKYNQQKFKRVAT  430

Query  376  KICPTSIPSEF  344
               P  + + F
Sbjct  431  LTSPERVNTLF  441



>gb|AAT73638.1| unknown protein, contains cyclins regulate cyclin dependent kinases 
(CDKs), PF00134 [Oryza sativa Japonica Group]
Length=441

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q  +EA  L LE LA+Y+AELSLL Y ++CY PSL+AAS+IFLA+
Sbjct  251  APTTKCFLRRFLRAAQVCHEAPVLHLEFLANYIAELSLLEYSLICYVPSLIAASSIFLAK  310

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKF  386
            + L P++ PWNSTL  YT Y+PSDL +C   LH L       +L A+REKYSQHK + 
Sbjct  311  FILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGGNLRAVREKYSQHKAQL  368



>ref|XP_007160890.1| hypothetical protein PHAVU_001G025600g [Phaseolus vulgaris]
 gb|ESW32884.1| hypothetical protein PHAVU_001G025600g [Phaseolus vulgaris]
Length=360

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF R  Q   +AS LQ + L+ YLAELSLL Y+ + + PSLVAAS +FL R+ L+  
Sbjct  227  FLRRFCRVGQEGIDASDLQFDFLSCYLAELSLLDYNCVKFVPSLVAASVVFLTRFMLSTK  286

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PWNS L   T Y+P+D ++CV+ +H+L  +    SL A+REKY QHK+K VA    P 
Sbjct  287  THPWNSALHQLTRYKPADFKECVLNIHDLYLSRKGPSLQAVREKYKQHKFKCVATTPSPP  346

Query  361  SIPSEFFQ  338
             IP  FF+
Sbjct  347  EIPLSFFE  354



>ref|NP_001042509.2| Os01g0233100 [Oryza sativa Japonica Group]
 dbj|BAF04423.2| Os01g0233100 [Oryza sativa Japonica Group]
Length=634

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = -3

Query  715  RRFVRATQGFNE-----ASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTL  551
            RRFVR  Q  +E       +L LE LA+Y+AELSLL Y++L Y PSLVAASAIFLA++ L
Sbjct  474  RRFVRVAQVSDELFIVQDPALHLEFLANYVAELSLLEYNLLSYPPSLVAASAIFLAKFIL  533

Query  550  TPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKI  371
             P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LPAIREKY+QHK    A  I
Sbjct  534  QPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPGSNLPAIREKYTQHKILHAADVI  593



>ref|NP_199122.1| cyclin A3-1 [Arabidopsis thaliana]
 sp|Q9FMH5.1|CCA31_ARATH RecName: Full=Putative cyclin-A3-1; AltName: Full=G2/mitotic-specific 
cyclin-A3-1; Short=CycA3;1 [Arabidopsis thaliana]
 dbj|BAB08272.1| cyclin A-type [Arabidopsis thaliana]
 gb|AED94908.1| cyclin A3-1 [Arabidopsis thaliana]
Length=355

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P S   LRRF R  Q   E S LQ+E L SYL+ELS+L Y  + + PS VAASA+FLAR
Sbjct  218  NPTSNTFLRRFTRVAQEDFEMSHLQMEFLCSYLSELSMLDYQSVKFLPSTVAASAVFLAR  277

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            + + P + PWN  L  YT Y+  DL++CV  +H+L  +    +L AIREKY QHK+K VA
Sbjct  278  FIIRPKQHPWNVMLEEYTRYKAGDLKECVAMIHDLYLSRKCGALEAIREKYKQHKFKCVA  337

Query  379  KKICPTSIPSEFFQDVS  329
                   +P   F+DV+
Sbjct  338  TMPVSPELPLTVFEDVN  354



>ref|XP_008674080.1| PREDICTED: cyclin-A3-2-like [Zea mays]
 tpg|DAA54691.1| TPA: cyclin superfamily protein, putative [Zea mays]
Length=437

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF+R+     + S L +E L SYLAELSLL Y  L + PS+VAAS +F+AR T+ P+ 
Sbjct  307  LRRFIRSAHEDKKGSILLMEFLGSYLAELSLLDYGCLRFLPSVVAASVMFVARLTIDPNT  366

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWN+ L+  T Y+ S+L+DC++A+H+L  N    SL AIR+KY QHK+K V+  + P  
Sbjct  367  NPWNTKLQKMTGYKVSELKDCIVAIHDLQLNRKCPSLTAIRDKYKQHKFKCVSLILVPVV  426

Query  358  IPSEFFQDVS  329
            IP+ +F+D++
Sbjct  427  IPTSYFEDLA  436



>gb|KJB53898.1| hypothetical protein B456_009G011300 [Gossypium raimondii]
 gb|KJB53899.1| hypothetical protein B456_009G011300 [Gossypium raimondii]
Length=420

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LRRF++A Q   +   L+LE LA YLAEL+LL Y  L + PS +AASA+FLAR+
Sbjct  288  PTTKTFLRRFIQAAQASYKVPCLELEFLAKYLAELTLLEYSFLKFLPSNIAASAVFLARW  347

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
            TL  S  PWN TL HYT Y+ S+L++ V+AL +L  N++  SL AIREKY Q K+K VA 
Sbjct  348  TLNQSDHPWNPTLEHYTSYKASELKNTVLALEDLQLNTNGCSLNAIREKYRQQKFKCVAM  407

Query  376  KICPTSIPSEFFQ  338
               P S+ S F +
Sbjct  408  MTSPESVGSVFLR  420



>ref|XP_008367648.1| PREDICTED: putative cyclin-A3-1 isoform X1 [Malus domestica]
Length=378

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LLRRF    Q   +  +LQLE L  YLAELSLL Y+ + + PSLVAAS  FLAR+ + P 
Sbjct  235  LLRRFTXFAQESYKDPNLQLEFLGYYLAELSLLDYECVKFLPSLVAASVTFLARFMIRPK  294

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW  +L+ Y+ Y+P+DL++CV+ +++L CN   +SL +IR KY QHK+K VA    P 
Sbjct  295  DHPWTLSLQRYSGYKPADLKECVLLIYDLHCNKRGASLQSIRAKYKQHKFKCVATISSPA  354

Query  361  SIPSEFFQD  335
             +PS +F+D
Sbjct  355  EVPSNYFED  363



>ref|XP_008367649.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Malus domestica]
Length=373

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            LLRRF    Q   +  +LQLE L  YLAELSLL Y+ + + PSLVAAS  FLAR+ + P 
Sbjct  230  LLRRFTXFAQESYKDPNLQLEFLGYYLAELSLLDYECVKFLPSLVAASVTFLARFMIRPK  289

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW  +L+ Y+ Y+P+DL++CV+ +++L CN   +SL +IR KY QHK+K VA    P 
Sbjct  290  DHPWTLSLQRYSGYKPADLKECVLLIYDLHCNKRGASLQSIRAKYKQHKFKCVATISSPA  349

Query  361  SIPSEFFQD  335
             +PS +F+D
Sbjct  350  EVPSNYFED  358



>ref|XP_002972285.1| hypothetical protein SELMODRAFT_412891 [Selaginella moellendorffii]
 gb|EFJ26371.1| hypothetical protein SELMODRAFT_412891 [Selaginella moellendorffii]
Length=466

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            +RRF+RA Q   +  SLQLE L +YLAELSL+ Y  L Y PS++AASA+FLAR T  P+ 
Sbjct  338  IRRFMRAAQAAYQEPSLQLEFLGNYLAELSLVEYSFLKYMPSMIAASAVFLARLTHNPAA  397

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
            KPW++TL  YT Y+ S+L +CV  +++L  N     LPA REKY QHK+K V+    P  
Sbjct  398  KPWDATLSRYTRYKASELSECVADMYDLQRNIKGCGLPATREKYKQHKFKCVSSLQPPVL  457

Query  358  IPSEFFQDV  332
             P  F  DV
Sbjct  458  APEHFQDDV  466



>ref|XP_010540385.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Tarenaya hassleriana]
Length=374

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF RA Q     S LQLE L  YL+ELSLL Y+ + + PS+ AASAIFLAR+ L P 
Sbjct  243  FLRRFTRAAQEDFRMSHLQLEFLCCYLSELSLLDYNCVKFLPSMSAASAIFLARFILHPK  302

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            + PWN  L  YT Y+P+DL++CV  +H+L  +    +L A+R++Y QHK+K VA      
Sbjct  303  QHPWNHMLHEYTRYKPADLKECVGIIHDLYLSRRGGALQAVRDRYKQHKFKCVATMPVSP  362

Query  361  SIPSEFFQD  335
             IP +FF+D
Sbjct  363  EIPPDFFED  371



>tpg|DAA54692.1| TPA: cyclin superfamily protein, putative [Zea mays]
Length=474

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF+R+     + S L +E L SYLAELSLL Y  L + PS+VAAS +F+AR T+ P+ 
Sbjct  344  LRRFIRSAHEDKKGSILLMEFLGSYLAELSLLDYGCLRFLPSVVAASVMFVARLTIDPNT  403

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PWN+ L+  T Y+ S+L+DC++A+H+L  N    SL AIR+KY QHK+K V+  + P  
Sbjct  404  NPWNTKLQKMTGYKVSELKDCIVAIHDLQLNRKCPSLTAIRDKYKQHKFKCVSLILVPVV  463

Query  358  IPSEFFQDVS  329
            IP+ +F+D++
Sbjct  464  IPTSYFEDLA  473



>ref|XP_011100040.1| PREDICTED: putative cyclin-A3-1 [Sesamum indicum]
Length=391

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LR+F    Q   E+SS QLE L  YLAELSLL Y  + + PSLVAAS IFL+R+TL P 
Sbjct  259  FLRKFTHIAQQDYESSSEQLEFLGGYLAELSLLDYGCVKFLPSLVAASVIFLSRFTLQPQ  318

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PWNS L+ ++ Y+ +DL++CV  LH+L  +   S L A+REKY Q K+K V+    P+
Sbjct  319  LHPWNSALQRHSGYEAADLKECVCILHDLQMSRRGSGLVAVREKYKQQKFKCVSTLSTPS  378

Query  361  SIPSEFFQDV  332
             +P  FF+D+
Sbjct  379  QVPESFFEDI  388



>ref|XP_010540384.1| PREDICTED: putative cyclin-A3-1 isoform X1 [Tarenaya hassleriana]
Length=375

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF RA Q     S LQLE L  YL+ELSLL Y+ + + PS+ AASAIFLAR+ L P 
Sbjct  244  FLRRFTRAAQEDFRMSHLQLEFLCCYLSELSLLDYNCVKFLPSMSAASAIFLARFILHPK  303

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
            + PWN  L  YT Y+P+DL++CV  +H+L  +    +L A+R++Y QHK+K VA      
Sbjct  304  QHPWNHMLHEYTRYKPADLKECVGIIHDLYLSRRGGALQAVRDRYKQHKFKCVATMPVSP  363

Query  361  SIPSEFFQD  335
             IP +FF+D
Sbjct  364  EIPPDFFED  372



>ref|XP_009404125.1| PREDICTED: cyclin-A3-1-like [Musa acuminata subsp. malaccensis]
Length=375

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
             LRRF++A Q   + S+LQ E L SYLAELSLL Y  + + PS++AASA+F+AR+TL P 
Sbjct  244  FLRRFIQAGQEDGKYSNLQFEFLGSYLAELSLLDYGCVQFLPSVIAASAVFVARFTLDPK  303

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PWN  L+  T Y  SDL++C+ A+ +L  N   S+L +IR+KY QH++K V   + PT
Sbjct  304  SNPWNKRLKECTGYNVSDLKECIHAILDLQLNKKASTLLSIRDKYKQHRFKCVPSLVPPT  363

Query  361  SIPSEFFQD  335
             IP+ +F D
Sbjct  364  EIPAIYFND  372



>ref|XP_004290942.1| PREDICTED: cyclin-A3-2-like [Fragaria vesca subsp. vesca]
Length=355

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LR+F    QG  +  +L+ E L SYL ELSLL Y  + + PS+VA+S +FLAR  +    
Sbjct  225  LRKFTDVAQGNYKTPNLEFEFLVSYLGELSLLDYKCVKFLPSMVASSVVFLARLMIRSKI  284

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW STL+HYT Y+ +DL+DCV+ LH+L        L  +REKY QHK+K+VA   CP  
Sbjct  285  NPWCSTLQHYTGYKAADLKDCVVVLHDLYLGRRGGLLQVVREKYKQHKFKYVANLPCPPE  344

Query  358  IPSEFFQDVSS  326
            +P+  F +V +
Sbjct  345  LPAPLFDNVKA  355



>gb|KJB53897.1| hypothetical protein B456_009G011300 [Gossypium raimondii]
 gb|KJB53900.1| hypothetical protein B456_009G011300 [Gossypium raimondii]
Length=490

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LRRF++A Q   +   L+LE LA YLAEL+LL Y  L + PS +AASA+FLAR+
Sbjct  358  PTTKTFLRRFIQAAQASYKVPCLELEFLAKYLAELTLLEYSFLKFLPSNIAASAVFLARW  417

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
            TL  S  PWN TL HYT Y+ S+L++ V+AL +L  N++  SL AIREKY Q K+K VA 
Sbjct  418  TLNQSDHPWNPTLEHYTSYKASELKNTVLALEDLQLNTNGCSLNAIREKYRQQKFKCVAM  477

Query  376  KICPTSIPSEFFQ  338
               P S+ S F +
Sbjct  478  MTSPESVGSVFLR  490



>gb|KJB35078.1| hypothetical protein B456_006G100200 [Gossypium raimondii]
 gb|KJB35079.1| hypothetical protein B456_006G100200 [Gossypium raimondii]
Length=482

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            +P +   LRRF+RA Q   ++ S+++E+LA+YLAEL+L+ Y+ L + PS+VAASA+FLAR
Sbjct  351  APTAKTFLRRFLRAAQASYKSPSIEMEYLANYLAELTLIDYEFLNFVPSIVAASAVFLAR  410

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            +TL  S  PWNSTL HYT Y  SDL+  V+AL +L  N+    L AIR KY Q K+K VA
Sbjct  411  WTLDQSSHPWNSTLEHYTAYNQSDLKTTVIALQDLQLNTKGCPLSAIRMKYRQQKFKSVA  470

Query  379  KKICPTSIPSEF  344
                P  + + F
Sbjct  471  ALTSPKLLETLF  482



>ref|XP_009794344.1| PREDICTED: G2/mitotic-specific cyclin C13-1-like [Nicotiana sylvestris]
 emb|CAA63541.1| cyclin A-like protein [Nicotiana tabacum]
Length=384

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  718  LRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSK  539
            LRRF    Q   +  +LQLE L  YLAELS+L Y  + Y PSL+AA+ +FL+R+TL P+ 
Sbjct  253  LRRFTGVAQEDYKTPNLQLEFLGYYLAELSILDYSCVKYVPSLLAAAVVFLSRFTLQPNT  312

Query  538  KPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTS  359
             PW+  L+ Y+ Y+ +DL++C++ LH+L  +    SL A+R+KY QHK+K V+    P  
Sbjct  313  HPWSLALQQYSGYKAADLKECILILHDLQLSRRGGSLAAVRDKYKQHKFKCVSSLTSPVE  372

Query  358  IPSEFFQDV  332
            IP+ FF+D+
Sbjct  373  IPASFFEDM  381



>ref|XP_006287744.1| hypothetical protein CARUB_v10000955mg [Capsella rubella]
 gb|EOA20642.1| hypothetical protein CARUB_v10000955mg [Capsella rubella]
Length=446

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P +   LRRF+ A Q   +   +++E LA+Y AEL+L+ Y  L + PSL+AASA+FLAR+
Sbjct  314  PTTKTFLRRFILAAQASEKVPLIEMEFLANYFAELTLVEYTFLRFQPSLIAASAVFLARW  373

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
            TL  S  PWN TL+HYT Y+ S L++ V+A+ NL  N++ S+L AIR KY+Q K+K VA 
Sbjct  374  TLDQSSHPWNPTLQHYTRYEASALKNTVIAMENLQLNTNGSTLIAIRTKYNQEKFKSVAT  433

Query  376  KICPTSIPSEF  344
               P  + + F
Sbjct  434  LTSPERVTTLF  444



>emb|CDY62408.1| BnaCnng40230D [Brassica napus]
Length=211

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = -3

Query  613  MLCYSPSLVAASAIFLARYTLTPSKKP-WNSTLRHYTLYQPSDLRDCVMALHNLCCNS-H  440
            ML Y+PSLVAASA+FLARY L PS+KP W+STL HYT Y+   L  CV  L  LC  S  
Sbjct  118  MLRYAPSLVAASAVFLARYVLHPSRKPSWSSTLEHYTRYRAEHLEACVKNLLRLCHESPS  177

Query  439  HSSLPAIREKYSQHKYKFVAKKICPTSIPSEFF  341
              ++ A+R+KYS+ KYKF A  I PTS+P E F
Sbjct  178  GDNVVAVRKKYSKAKYKFAANMIYPTSLPQELF  210



>ref|XP_006472254.1| PREDICTED: cyclin-A3-4-like [Citrus sinensis]
Length=372

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  739  SPDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLAR  560
            SP     LRR  R  Q    AS+LQLE L  YLAELSLL Y  + + PS VAAS IFLAR
Sbjct  235  SPTVKTFLRRLTRVAQEDYNASNLQLEFLGYYLAELSLLDYACVKFLPSSVAASVIFLAR  294

Query  559  YTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVA  380
            +   PSK PW ++L+ Y+ Y+PS++  CV+ LH+L  +    +L A+REKY QHK+K VA
Sbjct  295  FITQPSKHPWTASLQRYSGYKPSEIEGCVLVLHDLYLSRRGGNLQAVREKYKQHKFKCVA  354

Query  379  KKICPTSIPSEFFQDV  332
                   IP  +F+D+
Sbjct  355  TTPSSPEIPGCYFEDI  370



>ref|XP_010539515.1| PREDICTED: cyclin-A2-4-like [Tarenaya hassleriana]
 ref|XP_010539516.1| PREDICTED: cyclin-A2-4-like [Tarenaya hassleriana]
Length=464

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = -3

Query  736  PDS*MLLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARY  557
            P S   LRRF+RA Q  + +SSL++E LA+YL EL+L+ YD L + PSL+AASA+FLA++
Sbjct  334  PTSKTFLRRFLRAAQASHVSSSLEMEFLANYLTELTLIEYDFLKFLPSLIAASAVFLAKW  393

Query  556  TLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAK  377
            TL  S  PWN TL HYT+Y+ +DL+  V+AL  L  N+    L AIR KY Q K+K VA 
Sbjct  394  TLDQSCHPWNPTLEHYTMYKATDLKASVLALQELQMNTKACPLNAIRFKYKQEKFKSVAA  453

Query  376  KICPTSIPSEF  344
               P  + S F
Sbjct  454  LSSPKLLDSLF  464



>ref|XP_007227627.1| hypothetical protein PRUPE_ppa024921mg [Prunus persica]
 gb|EMJ28826.1| hypothetical protein PRUPE_ppa024921mg [Prunus persica]
Length=368

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = -3

Query  721  LLRRFVRATQGFNEASSLQlehlasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPS  542
            +LRRF R TQ   +  +LQLE L  YLAELSLL Y+ + + PSLVAAS  FLAR+ + P 
Sbjct  237  ILRRFARVTQESYKDPNLQLEFLGYYLAELSLLEYECVKFLPSLVAASVTFLARFMIRPK  296

Query  541  KKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPT  362
              PW  +L+ Y+ Y+P+DLR+CV+ +H+L  +   ++L +IR KY  HK+K VA    P 
Sbjct  297  SHPWTLSLQQYSGYKPTDLRECVLIIHDLHRSKRGATLQSIRGKYKSHKFKCVATISSPP  356

Query  361  SIPSEFFQDVSS  326
             +P+++F+D+  
Sbjct  357  EVPTDYFEDLKE  368



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1510973279075