BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5767

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002281255.1|  PREDICTED: 60S ribosomal protein L12               324   2e-109   Vitis vinifera
ref|XP_011077350.1|  PREDICTED: 60S ribosomal protein L12-3             323   5e-109   Sesamum indicum [beniseed]
ref|XP_011089905.1|  PREDICTED: 60S ribosomal protein L12               323   6e-109   Sesamum indicum [beniseed]
ref|XP_011089297.1|  PREDICTED: 60S ribosomal protein L12-like          322   9e-109   Sesamum indicum [beniseed]
ref|XP_004241274.1|  PREDICTED: 60S ribosomal protein L12               322   2e-108   Solanum lycopersicum
ref|XP_011089299.1|  PREDICTED: 60S ribosomal protein L12-like          322   2e-108   
ref|XP_004137822.1|  PREDICTED: 60S ribosomal protein L12-1             321   3e-108   Cucumis sativus [cucumbers]
ref|XP_010651161.1|  PREDICTED: 60S ribosomal protein L12               321   3e-108   Vitis vinifera
ref|XP_010098189.1|  60S ribosomal protein L12                          321   3e-108   Morus notabilis
ref|XP_004143249.1|  PREDICTED: 60S ribosomal protein L12-1-like        320   5e-108   Cucumis sativus [cucumbers]
emb|CDP19832.1|  unnamed protein product                                320   7e-108   Coffea canephora [robusta coffee]
ref|XP_009592198.1|  PREDICTED: 60S ribosomal protein L12-like          320   9e-108   Nicotiana tomentosiformis
ref|XP_002274407.1|  PREDICTED: 60S ribosomal protein L12               319   1e-107   Vitis vinifera
ref|XP_004250933.1|  PREDICTED: 60S ribosomal protein L12-like          319   2e-107   Solanum lycopersicum
ref|XP_011089298.1|  PREDICTED: 60S ribosomal protein L12               319   2e-107   
ref|NP_001275600.1|  60S ribosomal protein L12-like                     319   2e-107   Solanum tuberosum [potatoes]
ref|XP_009596063.1|  PREDICTED: 60S ribosomal protein L12               318   3e-107   Nicotiana tomentosiformis
gb|AAR83868.1|  60S ribosomal protein L12                               318   5e-107   Capsicum annuum
ref|XP_010046645.1|  PREDICTED: 60S ribosomal protein L12               318   6e-107   Eucalyptus grandis [rose gum]
ref|XP_010535606.1|  PREDICTED: 60S ribosomal protein L12-3             317   9e-107   Tarenaya hassleriana [spider flower]
ref|NP_001240945.1|  uncharacterized protein LOC100811654               317   1e-106   Glycine max [soybeans]
ref|XP_006428784.1|  hypothetical protein CICLE_v10012805mg             318   1e-106   
ref|XP_012082353.1|  PREDICTED: 60S ribosomal protein L12               317   2e-106   Jatropha curcas
ref|XP_006340196.1|  PREDICTED: 60S ribosomal protein L12-like          316   2e-106   Solanum tuberosum [potatoes]
ref|XP_007132258.1|  hypothetical protein PHAVU_011G079400g             316   3e-106   Phaseolus vulgaris [French bean]
gb|ADR71265.1|  60S ribosomal protein L12A                              316   3e-106   Hevea brasiliensis [jebe]
gb|EYU42156.1|  hypothetical protein MIMGU_mgv1a024330mg                316   3e-106   Erythranthe guttata [common monkey flower]
ref|XP_010920408.1|  PREDICTED: 60S ribosomal protein L12               316   4e-106   Elaeis guineensis
ref|XP_010253677.1|  PREDICTED: 60S ribosomal protein L12-like          316   4e-106   Nelumbo nucifera [Indian lotus]
gb|ABB29921.1|  unknown                                                 315   5e-106   Solanum tuberosum [potatoes]
ref|XP_007145216.1|  hypothetical protein PHAVU_007G220300g             317   5e-106   Phaseolus vulgaris [French bean]
ref|XP_006481460.1|  PREDICTED: 60S ribosomal protein L12-like          315   5e-106   Citrus sinensis [apfelsine]
ref|XP_012064820.1|  PREDICTED: 60S ribosomal protein L12               315   7e-106   Jatropha curcas
ref|XP_002530279.1|  60S ribosomal protein L12, putative                315   8e-106   Ricinus communis
ref|XP_010927173.1|  PREDICTED: 60S ribosomal protein L12-like          315   8e-106   Elaeis guineensis
gb|EYU36188.1|  hypothetical protein MIMGU_mgv1a015152mg                315   9e-106   Erythranthe guttata [common monkey flower]
ref|XP_010264684.1|  PREDICTED: 60S ribosomal protein L12               315   1e-105   Nelumbo nucifera [Indian lotus]
ref|XP_008798177.1|  PREDICTED: 60S ribosomal protein L12               315   1e-105   Phoenix dactylifera
ref|XP_004505994.1|  PREDICTED: 60S ribosomal protein L12-3-like        314   1e-105   Cicer arietinum [garbanzo]
ref|XP_003606385.1|  60S ribosomal protein L12                          314   1e-105   Medicago truncatula
ref|NP_001238575.1|  uncharacterized protein LOC100527860               314   1e-105   
ref|XP_006652746.1|  PREDICTED: 60S ribosomal protein L12-1-like        314   2e-105   Oryza brachyantha
ref|XP_010929416.1|  PREDICTED: 60S ribosomal protein L12-3             314   2e-105   Elaeis guineensis
gb|KJB36604.1|  hypothetical protein B456_006G166700                    314   2e-105   Gossypium raimondii
ref|XP_009419991.1|  PREDICTED: 60S ribosomal protein L12               314   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB78968.1|  hypothetical protein B456_013G027300                    314   2e-105   Gossypium raimondii
ref|XP_006424575.1|  hypothetical protein CICLE_v10029416mg             313   3e-105   Citrus clementina [clementine]
gb|KJB83758.1|  hypothetical protein B456_013G266700                    313   3e-105   Gossypium raimondii
ref|XP_010541327.1|  PREDICTED: 60S ribosomal protein L12-3             313   3e-105   Tarenaya hassleriana [spider flower]
ref|XP_009410228.1|  PREDICTED: 60S ribosomal protein L12-like          313   3e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846773.1|  PREDICTED: 60S ribosomal protein L12               313   4e-105   Amborella trichopoda
ref|XP_006647736.1|  PREDICTED: 60S ribosomal protein L12-1-like        313   4e-105   Oryza brachyantha
ref|XP_009395874.1|  PREDICTED: 60S ribosomal protein L12-1             313   5e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553323.1|  PREDICTED: 60S ribosomal protein L12-1             313   5e-105   Tarenaya hassleriana [spider flower]
ref|XP_003542515.1|  PREDICTED: 60S ribosomal protein L12-like          313   5e-105   Glycine max [soybeans]
gb|EPS61110.1|  hypothetical protein M569_13690                         313   5e-105   Genlisea aurea
ref|XP_004291576.1|  PREDICTED: 60S ribosomal protein L12               313   6e-105   Fragaria vesca subsp. vesca
ref|XP_008387661.1|  PREDICTED: 60S ribosomal protein L12               313   6e-105   Malus domestica [apple tree]
gb|EYU34446.1|  hypothetical protein MIMGU_mgv1a015171mg                313   7e-105   Erythranthe guttata [common monkey flower]
ref|XP_004487110.1|  PREDICTED: 60S ribosomal protein L12-like          312   8e-105   Cicer arietinum [garbanzo]
ref|XP_004497502.1|  PREDICTED: 60S ribosomal protein L12-like          312   8e-105   Cicer arietinum [garbanzo]
ref|XP_004304429.1|  PREDICTED: 60S ribosomal protein L12               312   9e-105   Fragaria vesca subsp. vesca
ref|XP_007027331.1|  Ribosomal protein L11 family protein               312   1e-104   Theobroma cacao [chocolate]
ref|XP_007016741.1|  Ribosomal protein L11 family protein               312   1e-104   
ref|XP_008791537.1|  PREDICTED: 60S ribosomal protein L12-3             312   1e-104   Phoenix dactylifera
ref|XP_010037962.1|  PREDICTED: 60S ribosomal protein L12-1             312   1e-104   Eucalyptus grandis [rose gum]
ref|XP_006837179.1|  PREDICTED: 60S ribosomal protein L12               312   1e-104   Amborella trichopoda
ref|NP_001047832.1|  Os02g0699600                                       312   1e-104   
ref|XP_009413975.1|  PREDICTED: 60S ribosomal protein L12-like          311   2e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56130.1|  hypothetical protein B456_009G107300                    311   2e-104   Gossypium raimondii
ref|XP_009403298.1|  PREDICTED: 60S ribosomal protein L12-3-like        311   2e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934342.1|  PREDICTED: 60S ribosomal protein L12-like          311   2e-104   Elaeis guineensis
gb|ACG35173.1|  60S ribosomal protein L12                               311   3e-104   Zea mays [maize]
ref|XP_007206032.1|  hypothetical protein PRUPE_ppa012511mg             311   3e-104   Prunus persica
ref|XP_008385312.1|  PREDICTED: 60S ribosomal protein L12-like          311   3e-104   
ref|XP_003537293.1|  PREDICTED: 60S ribosomal protein L12-like          311   4e-104   Glycine max [soybeans]
gb|KJB26183.1|  hypothetical protein B456_004G229100                    311   4e-104   Gossypium raimondii
ref|XP_002519537.1|  60S ribosomal protein L12, putative                310   4e-104   Ricinus communis
gb|EPS62643.1|  hypothetical protein M569_12145                         310   9e-104   Genlisea aurea
gb|AFK45138.1|  unknown                                                 310   1e-103   Medicago truncatula
ref|XP_002454433.1|  hypothetical protein SORBIDRAFT_04g030890          310   1e-103   Sorghum bicolor [broomcorn]
ref|XP_006372196.1|  hypothetical protein POPTR_0018s14210g             309   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_002447035.1|  hypothetical protein SORBIDRAFT_06g027330          309   2e-103   Sorghum bicolor [broomcorn]
gb|EAY95398.1|  hypothetical protein OsI_17237                          309   2e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_008385313.1|  PREDICTED: 60S ribosomal protein L12-like is...    310   2e-103   
ref|XP_008681298.1|  PREDICTED: uncharacterized protein LOC100216...    308   2e-103   Zea mays [maize]
ref|XP_008385314.1|  PREDICTED: 60S ribosomal protein L12-like is...    309   3e-103   
gb|KHG10663.1|  60S ribosomal L12-3 -like protein                       311   3e-103   Gossypium arboreum [tree cotton]
ref|NP_001053741.1|  Os04g0598200                                       308   4e-103   
gb|AGT16537.1|  60S ribosomal protein L12                               308   5e-103   Saccharum hybrid cultivar R570
gb|KHG20688.1|  60S ribosomal L12-3 -like protein                       309   5e-103   Gossypium arboreum [tree cotton]
ref|NP_001150452.1|  60S ribosomal protein L12                          307   7e-103   Zea mays [maize]
ref|XP_010689548.1|  PREDICTED: 60S ribosomal protein L12-1-like        307   8e-103   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT00997.1|  60S ribosomal protein L12-1                             307   9e-103   
ref|XP_004953540.1|  PREDICTED: 60S ribosomal protein L12-1-like        307   9e-103   Setaria italica
ref|NP_001148350.1|  60S ribosomal protein L12                          307   1e-102   Zea mays [maize]
ref|XP_002308123.1|  ribosomal protein L12                              306   1e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010240357.1|  PREDICTED: 60S ribosomal protein L12-3             306   3e-102   Brachypodium distachyon [annual false brome]
gb|ABK26190.1|  unknown                                                 305   6e-102   Picea sitchensis
ref|XP_009345771.1|  PREDICTED: 60S ribosomal protein L12-like          306   1e-101   Pyrus x bretschneideri [bai li]
gb|EMS60074.1|  60S ribosomal protein L12                               304   1e-101   Triticum urartu
ref|XP_010684100.1|  PREDICTED: 60S ribosomal protein L12-1             304   1e-101   Beta vulgaris subsp. vulgaris [field beet]
sp|O50003.1|RL12_PRUAR  RecName: Full=60S ribosomal protein L12         304   1e-101   Prunus armeniaca
dbj|BAK06704.1|  predicted protein                                      304   1e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008785284.1|  PREDICTED: 60S ribosomal protein L12-3-like        304   1e-101   Phoenix dactylifera
ref|NP_001148735.1|  LOC100282351                                       304   2e-101   Zea mays [maize]
gb|EMS58010.1|  60S ribosomal protein L12-1                             304   2e-101   Triticum urartu
ref|XP_001754545.1|  predicted protein                                  303   3e-101   
ref|XP_002881494.1|  60S ribosomal protein L12                          303   5e-101   Arabidopsis lyrata subsp. lyrata
gb|EMT00865.1|  60S ribosomal protein L12                               302   8e-101   
ref|XP_009139412.1|  PREDICTED: 60S ribosomal protein L12-2             302   1e-100   Brassica rapa
ref|XP_009133126.1|  PREDICTED: 60S ribosomal protein L12-2             301   2e-100   Brassica rapa
ref|XP_001780484.1|  predicted protein                                  301   2e-100   
ref|XP_006410898.1|  hypothetical protein EUTSA_v10017332mg             301   2e-100   Eutrema salsugineum [saltwater cress]
ref|NP_181256.1|  ribosomal protein L11 family protein                  301   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296028.1|  hypothetical protein CARUB_v10025173mg             300   4e-100   Capsella rubella
ref|NP_001136822.1|  uncharacterized protein LOC100216970               300   4e-100   Zea mays [maize]
ref|XP_002877919.1|  60S ribosomal protein L12                          300   5e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_001768595.1|  predicted protein                                  300   5e-100   
ref|NP_190911.1|  60S ribosomal protein L12-2                           300   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001778620.1|  predicted protein                                  300   8e-100   
ref|XP_001765722.1|  predicted protein                                  300   9e-100   
ref|XP_010505296.1|  PREDICTED: 60S ribosomal protein L12-2-like        299   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_003570163.1|  PREDICTED: 60S ribosomal protein L12-3-like        299   1e-99    Brachypodium distachyon [annual false brome]
ref|XP_006403690.1|  hypothetical protein EUTSA_v10010772mg             299   1e-99    Eutrema salsugineum [saltwater cress]
ref|XP_009116035.1|  PREDICTED: 60S ribosomal protein L12-2-like        299   1e-99    Brassica rapa
gb|KFK36607.1|  hypothetical protein AALP_AA4G145600                    298   2e-99    Arabis alpina [alpine rockcress]
ref|XP_006291953.1|  hypothetical protein CARUB_v10018141mg             298   3e-99    Capsella rubella
gb|KFK34593.1|  hypothetical protein AALP_AA5G165900                    298   4e-99    Arabis alpina [alpine rockcress]
emb|CDX78178.1|  BnaA09g33730D                                          298   5e-99    
ref|XP_009103861.1|  PREDICTED: 60S ribosomal protein L12-2-like        298   5e-99    Brassica rapa
ref|XP_009120601.1|  PREDICTED: 60S ribosomal protein L12-3             297   7e-99    Brassica rapa
ref|NP_200875.1|  60S ribosomal protein L12-3                           297   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456654.1|  PREDICTED: 60S ribosomal protein L12-3             296   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006400823.1|  hypothetical protein EUTSA_v10014862mg             296   1e-98    Eutrema salsugineum [saltwater cress]
ref|XP_010509370.1|  PREDICTED: 60S ribosomal protein L12-2-like        296   2e-98    Camelina sativa [gold-of-pleasure]
emb|CDY53628.1|  BnaC09g53910D                                          296   2e-98    Brassica napus [oilseed rape]
ref|XP_006281217.1|  hypothetical protein CARUB_v10027257mg             296   3e-98    Capsella rubella
gb|KFK27593.1|  hypothetical protein AALP_AA8G403900                    294   2e-97    Arabis alpina [alpine rockcress]
ref|XP_004293618.1|  PREDICTED: 60S ribosomal protein L12-like          293   4e-97    Fragaria vesca subsp. vesca
ref|XP_008663151.1|  PREDICTED: 60S ribosomal protein L12-like          286   2e-94    Zea mays [maize]
emb|CDY27019.1|  BnaA02g10390D                                          285   7e-94    Brassica napus [oilseed rape]
ref|XP_001759613.1|  predicted protein                                  284   9e-94    
ref|XP_002963454.1|  hypothetical protein SELMODRAFT_227409             283   3e-93    Selaginella moellendorffii
ref|XP_002988167.1|  hypothetical protein SELMODRAFT_183633             281   1e-92    Selaginella moellendorffii
ref|XP_002507299.1|  predicted protein                                  280   4e-92    Micromonas commoda
ref|XP_002866390.1|  hypothetical protein ARALYDRAFT_496216             279   8e-92    
ref|XP_003597238.1|  60S ribosomal Protein L12-like protein             276   2e-90    Medicago truncatula
ref|XP_003054831.1|  predicted protein                                  270   5e-88    Micromonas pusilla CCMP1545
ref|XP_005642636.1|  hypothetical protein COCSUDRAFT_55030              268   1e-87    Coccomyxa subellipsoidea C-169
ref|XP_002953500.1|  component of cytosolic 80S ribosome and 60S ...    268   2e-87    Volvox carteri f. nagariensis
ref|XP_001696972.1|  ribosomal protein L12, component of cytosoli...    268   3e-87    Chlamydomonas reinhardtii
gb|AAC84136.1|  ribosomal protein L12                                   266   7e-87    Cichorium intybus [radicchio]
ref|XP_001416788.1|  Ribosomal protein L12, component of cytosoli...    265   2e-86    Ostreococcus lucimarinus CCE9901
emb|CEF97341.1|  Ribosomal protein L11                                  266   6e-86    Ostreococcus tauri
gb|KDD76983.1|  hypothetical protein H632_c48p1                         264   1e-85    Helicosporidium sp. ATCC 50920
ref|XP_011018204.1|  PREDICTED: 60S ribosomal protein L12-like          266   5e-85    Populus euphratica
gb|KIY92888.1|  60S ribosomal protein L12-3                             262   7e-85    Monoraphidium neglectum
ref|XP_005848435.1|  hypothetical protein CHLNCDRAFT_35072              261   8e-85    Chlorella variabilis
ref|XP_007512325.1|  60S ribosomal protein L12                          260   3e-84    Bathycoccus prasinos
ref|XP_011400372.1|  60S ribosomal protein L12-1                        258   1e-83    Auxenochlorella protothecoides
emb|CEG72388.1|  Putative 60S ribosomal protein L12                     255   3e-82    Rhizopus microsporus
ref|NP_587897.1|  60S ribosomal protein L12                             255   3e-82    Schizosaccharomyces pombe
gb|KJB20286.1|  hypothetical protein B456_003G141700                    254   3e-82    Gossypium raimondii
gb|KFH64665.1|  60S ribosomal protein L12                               255   3e-82    Mortierella verticillata NRRL 6337
ref|XP_002173065.1|  60S ribosomal protein/L12A                         253   1e-81    Schizosaccharomyces japonicus yFS275
ref|XP_002173743.1|  60S ribosomal protein/L12A                         253   2e-81    Schizosaccharomyces japonicus yFS275
emb|CEP15404.1|  hypothetical protein                                   252   4e-81    Parasitella parasitica
gb|EIE75752.1|  60S ribosomal protein L12                               252   4e-81    Rhizopus delemar RA 99-880
gb|ABC67745.1|  ribosomal protein L12                                   251   1e-80    Anthopleura elegantissima
gb|ABK94455.1|  unknown                                                 250   2e-80    Populus trichocarpa [western balsam poplar]
ref|XP_003382502.1|  PREDICTED: 60S ribosomal protein L12-like          250   2e-80    Amphimedon queenslandica
gb|EPB83569.1|  60S ribosomal protein L12                               250   2e-80    Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN08145.1|  60S ribosomal protein L12                              250   3e-80    Mucor ambiguus
gb|EPB84410.1|  60S ribosomal protein L12                               250   3e-80    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002741477.1|  PREDICTED: 60S ribosomal protein L12-like          250   3e-80    Saccoglossus kowalevskii
ref|XP_001642047.1|  predicted protein                                  249   4e-80    Nematostella vectensis
emb|CBY39335.1|  unnamed protein product                                249   4e-80    Oikopleura dioica
ref|XP_003403428.1|  PREDICTED: 60S ribosomal protein L12-like          249   4e-80    Bombus terrestris [large earth bumblebee]
gb|ESA16310.1|  hypothetical protein GLOINDRAFT_345643                  248   1e-79    
sp|P50884.1|RL12_CHLRE  RecName: Full=60S ribosomal protein L12         248   1e-79    Chlamydomonas reinhardtii
ref|XP_008556549.1|  PREDICTED: 60S ribosomal protein L12               248   2e-79    Microplitis demolitor
gb|AEE63592.1|  unknown                                                 248   2e-79    Dendroctonus ponderosae
gb|EFX76123.1|  hypothetical protein DAPPUDRAFT_306294                  248   2e-79    Daphnia pulex
ref|XP_975530.1|  PREDICTED: 60S ribosomal protein L12                  248   2e-79    Tribolium castaneum [rust-red flour beetle]
ref|XP_001605642.1|  PREDICTED: 60S ribosomal protein L12               248   2e-79    Nasonia vitripennis
ref|XP_011123623.1|  hypothetical protein AOL_s00083g142                247   3e-79    Arthrobotrys oligospora ATCC 24927
emb|CEP08490.1|  hypothetical protein                                   254   4e-79    Parasitella parasitica
gb|AAX62480.1|  ribosomal protein L12                                   247   4e-79    Lysiphlebus testaceipes
ref|XP_003695708.1|  PREDICTED: 60S ribosomal protein L12-like is...    247   4e-79    Apis florea [dwarf honeybee]
ref|XP_002425460.1|  60S ribosomal protein L12, putative                247   5e-79    Pediculus humanus corporis [human body lice]
emb|CAJ17266.1|  ribosomal protein L12e                                 246   6e-79    Scarabaeus laticollis
ref|XP_002591842.1|  hypothetical protein BRAFLDRAFT_125332             246   6e-79    Branchiostoma floridae
emb|CBN08622.1|  ribosomal protein L12                                  246   1e-78    Microcosmus squamiger
gb|EPY49867.1|  60S ribosomal protein/L12A                              246   1e-78    Schizosaccharomyces cryophilus OY26
ref|XP_003695709.1|  PREDICTED: 60S ribosomal protein L12-like is...    245   2e-78    
gb|KDR08977.1|  60S ribosomal protein L12                               245   2e-78    Zootermopsis nevadensis
gb|EPX71937.1|  60S ribosomal protein/L12A                              245   3e-78    Schizosaccharomyces octosporus yFS286
ref|XP_001960698.1|  GF11364                                            245   3e-78    Drosophila ananassae
ref|XP_011335603.1|  PREDICTED: 60S ribosomal protein L12               244   4e-78    Ooceraea biroi
gb|ETN62244.1|  60S ribosomal protein L12                               244   4e-78    Anopheles darlingi [American malaria mosquito]
ref|XP_003706877.1|  PREDICTED: 60S ribosomal protein L12               244   4e-78    Megachile rotundata
ref|NP_001119643.1|  ribosomal protein L12                              244   4e-78    Acyrthosiphon pisum
gb|KFM82963.1|  60S ribosomal protein L12                               244   5e-78    Stegodyphus mimosarum
gb|AAY54943.1|  IP07888p                                                249   5e-78    Drosophila melanogaster
ref|XP_319222.2|  AGAP010065-PA                                         244   5e-78    Anopheles gambiae str. PEST
gb|ACY71245.1|  ribosomal protein L12                                   244   7e-78    Chrysomela tremula
ref|XP_011311827.1|  PREDICTED: 60S ribosomal protein L12               243   9e-78    Fopius arisanus
emb|CAJ17264.1|  ribosomal protein L12e                                 243   1e-77    Biphyllus lunatus
ref|XP_011134856.1|  PREDICTED: 60S ribosomal protein L12               243   2e-77    Harpegnathos saltator
gb|KFB44942.1|  60S ribosomal protein L12                               243   2e-77    Anopheles sinensis
ref|XP_002005849.1|  GI18857                                            243   2e-77    Drosophila mojavensis
ref|XP_002049983.1|  GJ20445                                            243   2e-77    Drosophila virilis
gb|AIW62640.1|  ribosomal protein L12                                   243   2e-77    Scytodes thoracica
ref|XP_001865531.1|  60S ribosomal protein L12                          243   2e-77    Culex quinquefasciatus
ref|XP_005705340.1|  60S ribosomal protein L12e                         243   2e-77    Galdieria sulphuraria
emb|CAJ82729.1|  60s ribosomal protien rpl12 prov protein               242   2e-77    Xenopus tropicalis [western clawed frog]
gb|ABI83774.1|  ribosomal protein L12                                   242   3e-77    Anopheles funestus
ref|XP_007149604.1|  hypothetical protein PHAVU_005G083600g             241   3e-77    Phaseolus vulgaris [French bean]
ref|XP_002840383.1|  60S ribosomal protein L12                          243   3e-77    Tuber melanosporum Mel28
ref|XP_001802348.1|  hypothetical protein SNOG_12114                    242   3e-77    Parastagonospora nodorum SN15
ref|XP_001364951.2|  PREDICTED: 60S ribosomal protein L12               242   4e-77    Monodelphis domestica
gb|KFY27378.1|  hypothetical protein V493_03530                         242   4e-77    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_011561160.1|  PREDICTED: 60S ribosomal protein L12               241   5e-77    Plutella xylostella [cabbage moth]
ref|XP_011056487.1|  PREDICTED: 60S ribosomal protein L12               241   5e-77    Acromyrmex echinatior
gb|KFY16547.1|  hypothetical protein V492_01265                         241   5e-77    Pseudogymnoascus sp. VKM F-4246
gb|ELR06397.1|  60S ribosomal protein L12                               241   6e-77    Pseudogymnoascus destructans 20631-21
ref|XP_003108385.1|  CRE-RPL-12 protein                                 241   6e-77    Caenorhabditis remanei
gb|EHK49773.1|  hypothetical protein TRIATDRAFT_297636                  241   6e-77    Trichoderma atroviride IMI 206040
ref|NP_524819.1|  ribosomal protein L12, isoform A                      241   6e-77    Drosophila melanogaster
ref|XP_001647834.1|  AAEL014562-PA                                      241   6e-77    Aedes aegypti
emb|CCX29538.1|  Similar to 60S ribosomal protein L12; acc. no. Q...    241   7e-77    Pyronema omphalodes CBS 100304
gb|KFY13744.1|  hypothetical protein V491_06309                         241   8e-77    Pseudogymnoascus sp. VKM F-3775
gb|ESZ91150.1|  hypothetical protein SBOR_8461                          241   9e-77    Sclerotinia borealis F-4128
ref|XP_002792305.1|  60S ribosomal protein L12                          241   9e-77    
ref|XP_001360891.1|  GA16582                                            241   9e-77    Drosophila pseudoobscura pseudoobscura
dbj|BAF98659.1|  ribosomal protein L12                                  241   1e-76    Solea senegalensis
gb|KFY72814.1|  hypothetical protein V499_07078                         241   1e-76    Pseudogymnoascus sp. VKM F-103
gb|KFX98364.1|  hypothetical protein V490_02360                         241   1e-76    Pseudogymnoascus sp. VKM F-3557
ref|NP_502542.1|  Protein RPL-12, isoform a                             241   1e-76    Caenorhabditis elegans [roundworm]
ref|XP_003841726.1|  similar to 60S ribosomal protein L12               241   1e-76    Leptosphaeria maculans JN3
ref|XP_001817789.1|  60S ribosomal protein L12                          240   2e-76    Aspergillus oryzae RIB40
ref|XP_002558757.1|  Pc13g03190                                         240   2e-76    Penicillium rubens Wisconsin 54-1255
gb|EWC46803.1|  60S ribosomal protein L12                               240   2e-76    Drechslerella stenobrocha 248
emb|CDH53248.1|  60s ribosomal protein l12                              240   2e-76    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011685510.1|  PREDICTED: 60S ribosomal protein L12               240   2e-76    Wasmannia auropunctata
gb|ADM64581.1|  ribosomal protein L12                                   240   2e-76    Hypophthalmichthys nobilis [noble carp]
gb|EKV05219.1|  60S ribosomal protein L12                               240   2e-76    Penicillium digitatum Pd1
ref|XP_011269459.1|  PREDICTED: 60S ribosomal protein L12               240   2e-76    Camponotus floridanus
ref|XP_011206105.1|  PREDICTED: 60S ribosomal protein L12               240   2e-76    Bactrocera dorsalis [papaya fruit fly]
ref|XP_007783227.1|  60S ribosomal protein L12                          240   2e-76    Coniosporium apollinis CBS 100218
ref|XP_001987065.1|  GH21709                                            240   2e-76    Drosophila grimshawi
ref|XP_003078444.1|  putative 60S ribosomal protein L12 (ISS)           242   3e-76    
emb|CDH50993.1|  60s ribosomal protein l12                              239   3e-76    Lichtheimia corymbifera JMRC:FSU:9682
gb|EER43283.1|  60S ribosomal protein L12                               239   3e-76    Histoplasma capsulatum H143
emb|CAJ17268.1|  ribosomal protein L12e                                 239   3e-76    Timarcha balearica
ref|XP_005187254.1|  PREDICTED: 60S ribosomal protein L12               239   4e-76    Musca domestica
ref|XP_008308459.1|  PREDICTED: 60S ribosomal protein L12               239   4e-76    Cynoglossus semilaevis [half-smooth tongue sole]
gb|KJK62108.1|  Ribosomal protein L11 N-terminal domain protein         239   4e-76    Aspergillus parasiticus SU-1
ref|XP_001557403.1|  60S ribosomal protein L12                          239   4e-76    Botrytis cinerea B05.10
ref|XP_003489012.1|  PREDICTED: 60S ribosomal protein L12-like          239   4e-76    
emb|CCQ18598.1|  60S ribosomal protein rpl12b                           239   5e-76    Sycon ciliatum
gb|EKG14184.1|  Ribosomal protein L11                                   239   5e-76    Macrophomina phaseolina MS6
ref|XP_001245370.1|  60S ribosomal protein L12                          239   6e-76    Coccidioides immitis RS
ref|XP_007586635.1|  putative 60s ribosomal protein l12 protein         239   6e-76    
gb|EPB75302.1|  Ribosomal protein L11, RNA binding domain protein       239   6e-76    Ancylostoma ceylanicum
ref|XP_011504554.1|  PREDICTED: 60S ribosomal protein L12               239   7e-76    Ceratosolen solmsi marchali
gb|AEL28818.1|  ribosomal protein L12                                   239   7e-76    Heliconius melpomene cythera
gb|AEZ49170.1|  60S ribosomal protein L12                               237   7e-76    Wolffia australiana
ref|XP_006696935.1|  60S ribosomal protein L12-like protein             239   7e-76    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_004997143.1|  60S ribosomal protein L12                          239   7e-76    Salpingoeca rosetta
ref|XP_001586492.1|  60S ribosomal protein L12                          239   8e-76    Sclerotinia sclerotiorum 1980 UF-70
ref|XP_008286318.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    238   8e-76    Stegastes partitus
emb|CDS12746.1|  Putative 60S ribosomal protein L12                     238   8e-76    Lichtheimia ramosa
gb|ABR23481.1|  40S ribosomal protein S2                                238   9e-76    Ornithodoros parkeri
ref|XP_011184550.1|  PREDICTED: 60S ribosomal protein L12               238   1e-75    Zeugodacus cucurbitae [melon fruit fly]
gb|ABW23217.1|  ribosomal protein rpl12                                 238   1e-75    Eurythoe complanata
ref|XP_002620177.1|  60S ribosomal protein L12                          238   1e-75    Blastomyces gilchristii SLH14081
gb|AAS55903.1|  60S ribosomal protein L12                               239   1e-75    Sus scrofa [pigs]
ref|XP_009547624.1|  hypothetical protein HETIRDRAFT_476664             238   1e-75    
gb|EYE91527.1|  hypothetical protein EURHEDRAFT_406014                  238   1e-75    
ref|XP_002150135.1|  60S ribosomal protein L12                          238   1e-75    
dbj|BAM18953.1|  ribosomal protein L12                                  238   1e-75    
ref|XP_006834849.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    238   1e-75    
gb|ACV72068.1|  ribosomal-like protein                                  238   2e-75    
ref|XP_002484126.1|  60S ribosomal protein L12                          238   2e-75    
gb|ELR51979.1|  60S ribosomal protein L12                               239   2e-75    
emb|CDJ97477.1|  Ribosomal protein L11 domain containing protein        238   2e-75    
ref|XP_005570655.1|  PREDICTED: 60S ribosomal protein L12-like          238   2e-75    
ref|XP_001265315.1|  60S ribosomal protein L12                          238   2e-75    
dbj|BAN20354.1|  ribosomal protein L12                                  237   2e-75    
ref|XP_006074559.1|  PREDICTED: 60S ribosomal protein L12               239   2e-75    
ref|XP_002131561.1|  PREDICTED: 60S ribosomal protein L12               237   2e-75    
gb|ABV44716.1|  60S ribosomal protein L12-like protein                  237   2e-75    
ref|XP_007898372.1|  PREDICTED: 60S ribosomal protein L12               237   2e-75    
ref|XP_012003022.1|  PREDICTED: 60S ribosomal protein L12 isoform X2    239   2e-75    
gb|KIW02320.1|  60S ribosomal protein L12                               237   3e-75    
gb|KIL90563.1|  60s ribosomal protein l12                               237   3e-75    
ref|XP_001515188.2|  PREDICTED: 60S ribosomal protein L12               237   3e-75    
ref|XP_007798673.1|  putative 60s ribosomal protein l12 protein         237   3e-75    
ref|XP_003229631.1|  PREDICTED: 60S ribosomal protein L12               237   3e-75    
ref|NP_001102668.1|  60S ribosomal protein L12                          237   3e-75    
ref|XP_008478463.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    237   3e-75    
ref|XP_007194713.1|  PREDICTED: 60S ribosomal protein L12 isoform X2    239   3e-75    
ref|XP_011317767.1|  60S ribosomal protein L12                          237   4e-75    
gb|AAX48844.1|  L12                                                     237   4e-75    
gb|KEQ70729.1|  hypothetical protein M436DRAFT_75055                    237   4e-75    
ref|XP_003437649.1|  PREDICTED: 60S ribosomal protein L12-like          237   4e-75    
ref|XP_002743371.2|  PREDICTED: 60S ribosomal protein L12               239   4e-75    
ref|XP_009243147.1|  PREDICTED: 60S ribosomal protein L12               239   4e-75    
emb|CCU80395.1|  60S ribosomal protein L12/RPL12B                       237   4e-75    
ref|XP_005687214.1|  PREDICTED: 60S ribosomal protein L12               239   4e-75    
ref|XP_002063463.1|  GK21921                                            236   5e-75    
gb|ACF35542.1|  ribosomal protein L12                                   236   5e-75    
gb|ADT80637.1|  ribosomal protein L12                                   236   5e-75    
ref|XP_001388901.1|  60S ribosomal protein L12                          236   5e-75    
emb|CEL52506.1|  60S ribosomal protein L12 OS=Canis familiaris GN...    236   6e-75    
emb|CEF68058.1|  60S ribosomal protein L12                              236   6e-75    
gb|EMD97422.1|  hypothetical protein COCHEDRAFT_1164310                 236   6e-75    
ref|XP_007574439.1|  PREDICTED: 60S ribosomal protein L12 isoform X2    236   6e-75    
emb|CAJ17265.1|  ribosomal protein L12e                                 236   6e-75    
gb|EUC56486.1|  60S ribosomal protein L12                               236   6e-75    
gb|AEG78346.1|  ribosomal protein L12                                   236   6e-75    
dbj|BAD92708.1|  ribosomal protein L12 variant                          237   6e-75    
emb|CCT73125.1|  probable ribosomal protein L12                         236   6e-75    
ref|XP_007194712.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    239   7e-75    
gb|ABM55637.1|  putative ribosomal protein L12e                         236   7e-75    
ref|XP_003029916.1|  60S ribosomal protein L12                          236   7e-75    
ref|XP_007942566.1|  PREDICTED: 60S ribosomal protein L12               237   7e-75    
ref|XP_006460940.1|  hypothetical protein AGABI2DRAFT_136019            236   8e-75    
gb|KIM91957.1|  hypothetical protein PILCRDRAFT_94140                   236   8e-75    
ref|XP_004671699.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    236   8e-75    
gb|KKA67858.1|  ribosomal protein                                       236   9e-75    
ref|XP_007257040.1|  PREDICTED: 60S ribosomal protein L12-like is...    236   9e-75    
ref|XP_006205554.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    236   9e-75    
gb|ADO28263.1|  60S ribosomal protein l12                               236   9e-75    
ref|NP_001080122.1|  ribosomal protein L12                              236   1e-74    
gb|KEQ63455.1|  hypothetical protein M437DRAFT_74709                    236   1e-74    
gb|EHK15136.1|  hypothetical protein TRIVIDRAFT_78230                   236   1e-74    
ref|XP_009847972.1|  hypothetical protein NEUTE1DRAFT_115864            236   1e-74    
ref|XP_008050036.1|  PREDICTED: 60S ribosomal protein L12               236   1e-74    
gb|KFH43271.1|  60S ribosomal protein-like protein                      236   1e-74    
ref|NP_001037150.1|  ribosomal protein L12                              236   1e-74    
ref|NP_001180489.1|  60S ribosomal protein L12                          236   1e-74    
tpe|CBF89859.1|  TPA: 60S ribosomal protein L12 (AFU_orthologue; ...    235   1e-74    
ref|XP_003267862.1|  PREDICTED: 60S ribosomal protein L12-like is...    235   1e-74    
dbj|GAD92544.1|  60S ribosomal protein L12                              235   1e-74    
ref|XP_004349295.1|  ribosomal protein L12                              235   1e-74    
gb|ELQ43639.1|  hypothetical protein OOU_Y34scaffold00140g47            237   1e-74    
ref|XP_001936597.1|  60S ribosomal protein L12                          235   1e-74    
ref|XP_011566140.1|  PREDICTED: 60S ribosomal protein L12-like          235   1e-74    
ref|XP_004534738.1|  PREDICTED: 60S ribosomal protein L12-like          235   1e-74    
gb|KIY44514.1|  hypothetical protein FISHEDRAFT_67431                   235   2e-74    
dbj|BAE39794.1|  unnamed protein product                                235   2e-74    
gb|KJH44438.1|  Ribosomal protein L11, RNA binding domain protein       235   2e-74    
ref|XP_961403.1|  60S ribosomal protein L12                             235   2e-74    
ref|NP_033102.2|  60S ribosomal protein L12                             235   2e-74    
ref|XP_004677371.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    235   2e-74    
gb|KDQ57696.1|  hypothetical protein JAAARDRAFT_78765                   235   2e-74    
gb|AGH70159.1|  60S ribosomal protein L12b                              235   2e-74    
ref|XP_003661394.1|  hypothetical protein MYCTH_2314521                 235   2e-74    
gb|KKA25093.1|  60S ribosomal protein L12                               235   2e-74    
gb|KID89101.1|  Ribosomal protein L11                                   235   2e-74    
ref|XP_007875375.1|  hypothetical protein PNEG_03300                    235   2e-74    
ref|XP_010982619.1|  PREDICTED: 60S ribosomal protein L12               235   2e-74    
ref|XP_001500251.2|  PREDICTED: 60S ribosomal protein L12               235   2e-74    
ref|NP_001264608.1|  60S ribosomal protein L12                          235   2e-74    
ref|XP_006181918.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    235   2e-74    
ref|XP_006882184.1|  PREDICTED: 60S ribosomal protein L12-like          237   2e-74    
gb|KIK98664.1|  hypothetical protein PAXRUDRAFT_823635                  235   2e-74    
gb|AAT68131.1|  60S ribosomal protein L12                               235   2e-74    
gb|EJU02062.1|  hypothetical protein DACRYDRAFT_22160                   235   2e-74    
dbj|GAM84675.1|  hypothetical protein ANO11243_026740                   235   2e-74    
gb|KDQ21818.1|  hypothetical protein BOTBODRAFT_26227                   235   2e-74    
ref|NP_000967.1|  60S ribosomal protein L12                             235   2e-74    
gb|ACY95312.1|  ribosomal protein L12                                   235   2e-74    
ref|XP_007799879.1|  60S ribosomal protein L12                          236   2e-74    
ref|XP_010611890.1|  PREDICTED: 60S ribosomal protein L12               235   2e-74    
emb|CCO31764.1|  60S ribosomal protein L12                              235   2e-74    
ref|XP_004895873.1|  PREDICTED: 60S ribosomal protein L12 isoform X2    235   2e-74    
gb|KHJ31155.1|  putative 60s ribosomal protein l12                      235   2e-74    
ref|XP_004269247.1|  PREDICTED: 60S ribosomal protein L12               235   2e-74    
gb|KIJ49589.1|  hypothetical protein M422DRAFT_66064                    235   2e-74    
gb|AAX43636.1|  ribosomal protein L12                                   234   3e-74    
ref|XP_003648873.1|  60S ribosomal protein L12                          234   3e-74    
ref|XP_005994521.1|  PREDICTED: 60S ribosomal protein L12-like          234   3e-74    
ref|XP_007409052.1|  hypothetical protein MELLADRAFT_52368              234   3e-74    
ref|XP_003333549.1|  60S ribosomal protein L12                          234   3e-74    
ref|XP_006918046.1|  PREDICTED: 60S ribosomal protein L12 isoform X2    235   3e-74    
gb|EXV03602.1|  60S ribosomal protein L12                               234   3e-74    
ref|XP_003192555.1|  60S ribosomal protein L12                          234   3e-74    
pdb|4W22|K  Chain K, Structure Of The 80s Mammalian Ribosome Boun...    234   3e-74    
ref|XP_006079492.1|  PREDICTED: 60S ribosomal protein L12-like          236   3e-74    
ref|XP_005809544.1|  PREDICTED: 60S ribosomal protein L12-like is...    234   3e-74    
ref|XP_004613554.1|  PREDICTED: 60S ribosomal protein L12               234   3e-74    
ref|XP_004423534.1|  PREDICTED: 60S ribosomal protein L12               234   3e-74    
ref|XP_007420652.1|  PREDICTED: 60S ribosomal protein L12-like          234   3e-74    
ref|XP_010763046.1|  60S ribosomal protein L12                          235   4e-74    
gb|KFO19465.1|  60S ribosomal protein L12                               235   4e-74    
ref|XP_011894493.1|  PREDICTED: 60S ribosomal protein L12 isoform X2    235   4e-74    
ref|XP_003709623.1|  60S ribosomal protein L12                          234   4e-74    
ref|XP_005213240.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    235   4e-74    
gb|ACD65165.1|  putative 60S ribosomal protein RPL12                    234   4e-74    
gb|ABX44814.1|  putative 60S ribosomal protein RPL12                    234   4e-74    
ref|XP_008696960.1|  PREDICTED: 60S ribosomal protein L12               236   4e-74    
dbj|BAM17772.1|  ribosomal protein L12                                  234   4e-74    
ref|XP_010779103.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    234   4e-74    
emb|CEF62941.1|  60S ribosomal protein L12                              234   4e-74    
ref|XP_002434030.1|  ribosomal protein L12, putative                    234   4e-74    
ref|XP_006022733.1|  PREDICTED: 60S ribosomal protein L12-like          234   4e-74    
ref|XP_007161912.1|  hypothetical protein PHAVU_001G108100g             233   5e-74    
ref|NP_001291796.1|  ribosomal protein L12                              234   5e-74    
ref|XP_002801422.1|  PREDICTED: 60S ribosomal protein L12-like is...    234   5e-74    
ref|XP_007812791.1|  60S ribosomal protein L12                          234   5e-74    
ref|XP_007289135.1|  60S ribosomal protein L12                          234   5e-74    
ref|XP_006988769.1|  PREDICTED: 60S ribosomal protein L12               234   5e-74    
ref|XP_009057640.1|  hypothetical protein LOTGIDRAFT_217320             234   5e-74    
ref|XP_003407493.1|  PREDICTED: 60S ribosomal protein L12               234   5e-74    
ref|XP_007529729.1|  PREDICTED: 60S ribosomal protein L12               234   5e-74    
emb|CAF90797.1|  unnamed protein product                                234   5e-74    
gb|EGT47985.1|  hypothetical protein CAEBREN_29616                      235   5e-74    
ref|XP_004404822.1|  PREDICTED: 60S ribosomal protein L12-like          234   6e-74    
emb|CCD50998.1|  similar to 60S ribosomal protein l12                   234   6e-74    
emb|CCD75279.1|  putative 60s ribosomal protein L12                     234   7e-74    
gb|AAA40066.1|  ribosomal protein L12                                   234   7e-74    
ref|XP_005087587.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    234   7e-74    
gb|KGB31616.1|  60S ribosomal protein L12                               233   7e-74    
ref|XP_011786742.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    235   7e-74    
ref|XP_012052551.1|  large subunit ribosomal protein L12                233   7e-74    
gb|EGE05201.1|  60S ribosomal protein L12                               233   7e-74    
gb|KJA27660.1|  hypothetical protein HYPSUDRAFT_156899                  233   8e-74    
ref|XP_009187400.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    235   8e-74    
ref|XP_569829.1|  hypothetical protein                                  233   8e-74    
ref|XP_004392692.1|  PREDICTED: 60S ribosomal protein L12               234   9e-74    
gb|KIO21363.1|  hypothetical protein M407DRAFT_245502                   233   9e-74    
ref|XP_004479816.1|  PREDICTED: 60S ribosomal protein L12 isoform 2     234   9e-74    
gb|AAL26576.1|AF429974_1  ribosomal protein L12                         233   9e-74    
gb|ABS57444.1|  ribosomal protein L12                                   233   1e-73    
ref|XP_004713414.1|  PREDICTED: 60S ribosomal protein L12               234   1e-73    
ref|XP_007856380.1|  ribosomal protein l12                              233   1e-73    
ref|XP_007645928.1|  PREDICTED: 60S ribosomal protein L12 isoform X1    233   1e-73    
gb|KIN06064.1|  hypothetical protein OIDMADRAFT_24401                   233   1e-73    
ref|XP_003264012.1|  PREDICTED: 60S ribosomal protein L12               235   1e-73    
gb|KIM45124.1|  hypothetical protein M413DRAFT_24378                    233   1e-73    
gb|ABW23167.1|  ribosomal protein rpl12                                 233   1e-73    
ref|XP_005292702.1|  PREDICTED: 60S ribosomal protein L12               233   1e-73    
ref|XP_006967748.1|  ribosomal protein L12, L11 family                  233   1e-73    
ref|XP_007528932.1|  PREDICTED: 60S ribosomal protein L12               238   2e-73    
gb|KIP01413.1|  hypothetical protein PHLGIDRAFT_131268                  233   2e-73    
ref|XP_003470809.1|  PREDICTED: 60S ribosomal protein L12               233   2e-73    
ref|XP_008974053.1|  PREDICTED: 60S ribosomal protein L12 isoform X2    234   2e-73    
gb|KIY65682.1|  ribosomal protein L12                                   233   2e-73    
ref|XP_006760170.1|  PREDICTED: 60S ribosomal protein L12-like          233   2e-73    
ref|NP_001269299.1|  60S ribosomal protein L12                          233   2e-73    
dbj|GAM38033.1|  60S ribosomal protein                                  233   2e-73    
gb|AAH90905.1|  Ribosomal protein L12                                   233   2e-73    
ref|XP_005140739.1|  PREDICTED: 60S ribosomal protein L12               233   2e-73    
ref|XP_009171688.1|  hypothetical protein T265_14389                    240   2e-73    
gb|EPS28059.1|  hypothetical protein PDE_03005                          233   2e-73    
ref|XP_001229121.1|  60S ribosomal protein L12                          233   2e-73    
gb|EJT50585.1|  hypothetical protein A1Q1_08287                         232   2e-73    
gb|KIM32244.1|  hypothetical protein M408DRAFT_326878                   232   2e-73    
emb|CCA69560.1|  probable 60S ribosomal protein L12                     232   2e-73    
ref|XP_007919044.1|  putative 60s ribosomal protein l12 protein         232   2e-73    
ref|XP_007309907.1|  hypothetical protein STEHIDRAFT_162239             232   3e-73    
ref|XP_004414939.1|  PREDICTED: 60S ribosomal protein L12-like          232   3e-73    
gb|EDM16652.1|  rCG64424                                                232   3e-73    
emb|CDP25219.1|  Putative cytosolic 60S ribosomal protein Rpl12         232   3e-73    
ref|XP_003969649.1|  PREDICTED: 60S ribosomal protein L12               232   3e-73    
ref|XP_002676317.1|  predicted protein                                  232   3e-73    
ref|XP_001830449.1|  60S ribosomal protein L12                          232   3e-73    
gb|EHJ64913.1|  ribosomal protein L12                                   232   3e-73    
ref|XP_002108622.1|  expressed hypothetical protein                     232   3e-73    
ref|XP_006669161.1|  60S ribosomal protein L12                          232   3e-73    
emb|CEJ94567.1|  Putative 60S ribosomal protein L12                     232   3e-73    
gb|KIN96175.1|  hypothetical protein M404DRAFT_16936                    232   4e-73    
ref|NP_001187041.1|  ribosomal protein L12                              232   4e-73    
ref|NP_963878.3|  60S ribosomal protein L12                             232   4e-73    
gb|EFQ26165.1|  hypothetical protein GLRG_01309                         231   4e-73    
ref|XP_011991395.1|  PREDICTED: 60S ribosomal protein L12               231   4e-73    
ref|XP_005564824.1|  PREDICTED: 60S ribosomal protein L12-like          231   4e-73    
gb|KIJ18644.1|  hypothetical protein PAXINDRAFT_167223                  231   4e-73    
ref|XP_005055426.1|  PREDICTED: 60S ribosomal protein L12 isoform X2    231   4e-73    
ref|XP_001746913.1|  hypothetical protein                               232   5e-73    
ref|XP_003017652.1|  hypothetical protein ARB_04534                     232   6e-73    
gb|AAW25904.1|  SJCHGC06254 protein                                     231   6e-73    
gb|EHL00631.1|  putative 60S ribosomal protein L12                      232   6e-73    
gb|KDN69342.1|  hypothetical protein CSUB01_05388                       231   6e-73    
ref|XP_003742346.1|  PREDICTED: 60S ribosomal protein L12-like          231   6e-73    
gb|KII92136.1|  hypothetical protein PLICRDRAFT_172272                  231   6e-73    
gb|KDN46141.1|  ribosomal protein L12                                   231   7e-73    
ref|XP_008600580.1|  60S ribosomal protein L12                          231   7e-73    
ref|XP_007922623.1|  hypothetical protein MYCFIDRAFT_59293              231   8e-73    
ref|XP_009222282.1|  60S ribosomal protein L12                          231   8e-73    
ref|XP_006768602.1|  PREDICTED: 60S ribosomal protein L12               231   8e-73    
gb|ACH70859.1|  ribosomal protein L12                                   231   8e-73    
ref|XP_007266443.1|  ribosomal protein L12                              231   1e-72    
ref|XP_005836621.1|  large subunit ribosomal protein L12e, cytopl...    231   1e-72    
ref|XP_004636380.1|  PREDICTED: 60S ribosomal protein L12-like          231   1e-72    
gb|AGT17875.1|  60S ribosomal protein L12                               231   1e-72    



>ref|XP_002281255.1| PREDICTED: 60S ribosomal protein L12 [Vitis vinifera]
 emb|CAN66258.1| hypothetical protein VITISV_001237 [Vitis vinifera]
Length=166

 Score =   324 bits (831),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+GSVKEILGTCVSVGCTVDGKDPKDLQQEIADG+VEIPQD
Sbjct  121  SMAKDLSGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPQD  166



>ref|XP_011077350.1| PREDICTED: 60S ribosomal protein L12-3 [Sesamum indicum]
Length=166

 Score =   323 bits (828),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIPQD
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD  166



>ref|XP_011089905.1| PREDICTED: 60S ribosomal protein L12 [Sesamum indicum]
Length=166

 Score =   323 bits (827),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VEIPQD
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEIPQD  166



>ref|XP_011089297.1| PREDICTED: 60S ribosomal protein L12-like [Sesamum indicum]
Length=166

 Score =   322 bits (826),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIPQD
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD  166



>ref|XP_004241274.1| PREDICTED: 60S ribosomal protein L12 [Solanum lycopersicum]
Length=166

 Score =   322 bits (824),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKET+KDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETSKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMQPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIPQD
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD  166



>ref|XP_011089299.1| PREDICTED: 60S ribosomal protein L12-like [Sesamum indicum]
Length=166

 Score =   322 bits (824),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VE+PQD
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPQD  166



>ref|XP_004137822.1| PREDICTED: 60S ribosomal protein L12-1 [Cucumis sativus]
 gb|KGN58958.1| hypothetical protein Csa_3G739040 [Cucumis sativus]
Length=166

 Score =   321 bits (823),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+GSVKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VEIPQD
Sbjct  121  SMAKDLSGSVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEIPQD  166



>ref|XP_010651161.1| PREDICTED: 60S ribosomal protein L12 [Vitis vinifera]
Length=166

 Score =   321 bits (822),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+GSVKEILGTCVSVGCTVDGKDPKDLQQEIADG+VEIP D
Sbjct  121  SMAKDLSGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPLD  166



>ref|XP_010098189.1| 60S ribosomal protein L12 [Morus notabilis]
 ref|XP_010107538.1| 60S ribosomal protein L12 [Morus notabilis]
 gb|EXB74645.1| 60S ribosomal protein L12 [Morus notabilis]
 gb|EXC16220.1| 60S ribosomal protein L12 [Morus notabilis]
Length=166

 Score =   321 bits (822),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIK+LKEPERDRKKTKNIKHNGNISLDDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKSLKEPERDRKKTKNIKHNGNISLDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQE+ DG+VEIPQD
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEVTDGDVEIPQD  166



>ref|XP_004143249.1| PREDICTED: 60S ribosomal protein L12-1-like [Cucumis sativus]
 ref|XP_008442680.1| PREDICTED: 60S ribosomal protein L12-1 [Cucumis melo]
 ref|XP_008449248.1| PREDICTED: 60S ribosomal protein L12-1 [Cucumis melo]
 gb|KGN48153.1| hypothetical protein Csa_6G445170 [Cucumis sativus]
Length=166

 Score =   320 bits (821),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+GSVKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIPQD
Sbjct  121  SMAKDLSGSVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD  166



>emb|CDP19832.1| unnamed protein product [Coffea canephora]
Length=166

 Score =   320 bits (820),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+VEIP++
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPEN  166



>ref|XP_009592198.1| PREDICTED: 60S ribosomal protein L12-like [Nicotiana tomentosiformis]
 ref|XP_009595122.1| PREDICTED: 60S ribosomal protein L12-like [Nicotiana tomentosiformis]
 ref|XP_009765550.1| PREDICTED: 60S ribosomal protein L12 [Nicotiana sylvestris]
 ref|XP_009771743.1| PREDICTED: 60S ribosomal protein L12 [Nicotiana sylvestris]
 ref|XP_009777832.1| PREDICTED: 60S ribosomal protein L12 [Nicotiana sylvestris]
Length=166

 Score =   320 bits (820),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDLTG+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP D
Sbjct  121  SMAKDLTGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVEIPLD  166



>ref|XP_002274407.1| PREDICTED: 60S ribosomal protein L12 [Vitis vinifera]
 emb|CAN75443.1| hypothetical protein VITISV_019658 [Vitis vinifera]
Length=166

 Score =   319 bits (818),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIK+LKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKSLKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+VE+P+D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEVPED  166



>ref|XP_004250933.1| PREDICTED: 60S ribosomal protein L12-like [Solanum lycopersicum]
 ref|XP_004251135.1| PREDICTED: 60S ribosomal protein L12 [Solanum lycopersicum]
Length=166

 Score =   319 bits (817),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKET+KDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETSKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMQPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VEIP++
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEIPEN  166



>ref|XP_011089298.1| PREDICTED: 60S ribosomal protein L12 [Sesamum indicum]
Length=166

 Score =   319 bits (817),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM PR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMSPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIPQD
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD  166



>ref|NP_001275600.1| 60S ribosomal protein L12-like [Solanum tuberosum]
 gb|AFX66983.1| 60S ribosomal protein L12 [Solanum tuberosum]
Length=166

 Score =   319 bits (817),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKET+KDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETSKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMQSR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIPQD
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD  166



>ref|XP_009596063.1| PREDICTED: 60S ribosomal protein L12 [Nicotiana tomentosiformis]
Length=166

 Score =   318 bits (816),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVEIPLD  166



>gb|AAR83868.1| 60S ribosomal protein L12 [Capsicum annuum]
Length=166

 Score =   318 bits (815),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKVDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMQPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+VEIP++
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPEN  166



>ref|XP_010046645.1| PREDICTED: 60S ribosomal protein L12 [Eucalyptus grandis]
 gb|KCW88814.1| hypothetical protein EUGRSUZ_A01152 [Eucalyptus grandis]
Length=166

 Score =   318 bits (814),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQ+EI+DG+VEIP D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQEEISDGDVEIPLD  166



>ref|XP_010535606.1| PREDICTED: 60S ribosomal protein L12-3 [Tarenaya hassleriana]
Length=166

 Score =   317 bits (813),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNG+ISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGDISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEV+IP D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGEVDIPSD  166



>ref|NP_001240945.1| uncharacterized protein LOC100811654 [Glycine max]
 gb|ACU24057.1| unknown [Glycine max]
Length=166

 Score =   317 bits (812),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+Q+V+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQIVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+GS+KEILGTCVSVGCTVDGKDPKDLQQEI DG+VE+P D
Sbjct  121  SMAKDLSGSIKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD  166



>ref|XP_006428784.1| hypothetical protein CICLE_v10012805mg [Citrus clementina]
 gb|ESR42024.1| hypothetical protein CICLE_v10012805mg [Citrus clementina]
Length=203

 Score =   318 bits (816),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  666  ATMPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLR  487
            A MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLR
Sbjct  36   AIMPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLR  95

Query  486  VTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMR  307
            VTVKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI+LDDVIEIAKVMR
Sbjct  96   VTVKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNITLDDVIEIAKVMR  155

Query  306  PRSMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            PRSMAKDL+G+VKEILGTCVSVGCTVDGKDP+DLQQEI DG+VEIP D
Sbjct  156  PRSMAKDLSGTVKEILGTCVSVGCTVDGKDPRDLQQEITDGDVEIPLD  203



>ref|XP_012082353.1| PREDICTED: 60S ribosomal protein L12 [Jatropha curcas]
 gb|KDP29112.1| hypothetical protein JCGZ_16501 [Jatropha curcas]
Length=166

 Score =   317 bits (811),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVE+P D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGEVEVPLD  166



>ref|XP_006340196.1| PREDICTED: 60S ribosomal protein L12-like [Solanum tuberosum]
Length=166

 Score =   316 bits (810),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKET+KDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETSKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMQSR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VEIP++
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEIPEN  166



>ref|XP_007132258.1| hypothetical protein PHAVU_011G079400g [Phaseolus vulgaris]
 gb|ESW04252.1| hypothetical protein PHAVU_011G079400g [Phaseolus vulgaris]
Length=166

 Score =   316 bits (810),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIK+LKEPERDRKKTKNIKHNGNISLDDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKSLKEPERDRKKTKNIKHNGNISLDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+GS+KEILGTCVSVGCTVDGKDPKDLQQEI DG+VE+P D
Sbjct  121  SMAKDLSGSIKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD  166



>gb|ADR71265.1| 60S ribosomal protein L12A [Hevea brasiliensis]
Length=166

 Score =   316 bits (810),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGK+PKDLQQEI DGEVE+P D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKNPKDLQQEITDGEVEVPLD  166



>gb|EYU42156.1| hypothetical protein MIMGU_mgv1a024330mg [Erythranthe guttata]
Length=166

 Score =   316 bits (809),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDV+EIAKVMR R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVVEIAKVMRTR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+PQD
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPQD  166



>ref|XP_010920408.1| PREDICTED: 60S ribosomal protein L12 [Elaeis guineensis]
Length=166

 Score =   316 bits (809),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP +
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPSE  166



>ref|XP_010253677.1| PREDICTED: 60S ribosomal protein L12-like [Nelumbo nucifera]
Length=166

 Score =   316 bits (809),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH GNISLDDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHTGNISLDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGK+PKDLQQEI DG+VE+PQD
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKNPKDLQQEITDGDVEVPQD  166



>gb|ABB29921.1| unknown [Solanum tuberosum]
Length=166

 Score =   315 bits (808),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKET+KDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETSKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMQSR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQE++DG+VEIP++
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEVSDGDVEIPEN  166



>ref|XP_007145216.1| hypothetical protein PHAVU_007G220300g [Phaseolus vulgaris]
 gb|ESW17210.1| hypothetical protein PHAVU_007G220300g [Phaseolus vulgaris]
Length=203

 Score =   317 bits (812),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  669  SATMPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGL  490
            S  MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGL
Sbjct  35   SGPMPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGL  94

Query  489  RVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM  310
            RVTVKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI+LDDVIEIA+VM
Sbjct  95   RVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNIALDDVIEIARVM  154

Query  309  RPRSMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            RPRSMAKDL+GS+KEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P
Sbjct  155  RPRSMAKDLSGSIKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVP  201



>ref|XP_006481460.1| PREDICTED: 60S ribosomal protein L12-like [Citrus sinensis]
 gb|KDO45146.1| hypothetical protein CISIN_1g031086mg [Citrus sinensis]
Length=166

 Score =   315 bits (808),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI+LDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNITLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDP+DLQQEI DG+VEIP D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPRDLQQEITDGDVEIPLD  166



>ref|XP_012064820.1| PREDICTED: 60S ribosomal protein L12 [Jatropha curcas]
 gb|KDP44051.1| hypothetical protein JCGZ_05518 [Jatropha curcas]
Length=166

 Score =   315 bits (807),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VE+P D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD  166



>ref|XP_002530279.1| 60S ribosomal protein L12, putative [Ricinus communis]
 gb|EEF32086.1| 60S ribosomal protein L12, putative [Ricinus communis]
Length=166

 Score =   315 bits (807),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VE+P D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD  166



>ref|XP_010927173.1| PREDICTED: 60S ribosomal protein L12-like [Elaeis guineensis]
Length=166

 Score =   315 bits (807),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGN+SLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNLSLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP +
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPSE  166



>gb|EYU36188.1| hypothetical protein MIMGU_mgv1a015152mg [Erythranthe guttata]
Length=166

 Score =   315 bits (806),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMR R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+VE+P D
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEVPMD  166



>ref|XP_010264684.1| PREDICTED: 60S ribosomal protein L12 [Nelumbo nucifera]
Length=166

 Score =   315 bits (806),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH GNISLDDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHTGNISLDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGK+PKDLQQEI DG+V+IPQD
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKNPKDLQQEITDGDVDIPQD  166



>ref|XP_008798177.1| PREDICTED: 60S ribosomal protein L12 [Phoenix dactylifera]
Length=166

 Score =   315 bits (806),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKD+QQEI DG+VEIP +
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDMQQEITDGDVEIPSE  166



>ref|XP_004505994.1| PREDICTED: 60S ribosomal protein L12-3-like [Cicer arietinum]
Length=166

 Score =   314 bits (805),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEV VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIK+LKEPERDRKKTKNIKHNGNISLDDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKSLKEPERDRKKTKNIKHNGNISLDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIPQD
Sbjct  121  SMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPQD  166



>ref|XP_003606385.1| 60S ribosomal protein L12 [Medicago truncatula]
 gb|ACJ84120.1| unknown [Medicago truncatula]
 gb|ACJ85955.1| unknown [Medicago truncatula]
 gb|AES88582.1| 60S ribosomal L12-like protein [Medicago truncatula]
 gb|AFK45063.1| unknown [Medicago truncatula]
Length=166

 Score =   314 bits (805),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAK+M+PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKIMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIPQD
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPQD  166



>ref|NP_001238575.1| uncharacterized protein LOC100527860 [Glycine max]
 gb|ACU17053.1| unknown [Glycine max]
Length=166

 Score =   314 bits (805),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+Q+V+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQIVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTV NRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVPNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+GS+KEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P D
Sbjct  121  SMAKDLSGSIKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLD  166



>ref|XP_006652746.1| PREDICTED: 60S ribosomal protein L12-1-like [Oryza brachyantha]
Length=166

 Score =   314 bits (805),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKHNGNISLDDVIEIA+ MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHNGNISLDDVIEIARTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKD++G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKDMSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGEVEIP  164



>ref|XP_010929416.1| PREDICTED: 60S ribosomal protein L12-3 [Elaeis guineensis]
Length=166

 Score =   314 bits (805),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP +
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPSE  166



>gb|KJB36604.1| hypothetical protein B456_006G166700 [Gossypium raimondii]
Length=166

 Score =   314 bits (804),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQ+EI++GEV++P
Sbjct  121  SMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQEEISEGEVDVP  164



>ref|XP_009419991.1| PREDICTED: 60S ribosomal protein L12 [Musa acuminata subsp. malaccensis]
Length=166

 Score =   314 bits (804),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDV+EIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVVEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVP  164



>gb|KJB78968.1| hypothetical protein B456_013G027300 [Gossypium raimondii]
Length=166

 Score =   314 bits (804),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DGE+++P
Sbjct  121  SMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGEIDVP  164



>ref|XP_006424575.1| hypothetical protein CICLE_v10029416mg [Citrus clementina]
 ref|XP_006488094.1| PREDICTED: 60S ribosomal protein L12-like [Citrus sinensis]
 gb|ESR37815.1| hypothetical protein CICLE_v10029416mg [Citrus clementina]
 gb|KDO73276.1| hypothetical protein CISIN_1g031095mg [Citrus sinensis]
Length=166

 Score =   313 bits (803),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI+LDDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNITLDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP D
Sbjct  121  SMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPLD  166



>gb|KJB83758.1| hypothetical protein B456_013G266700 [Gossypium raimondii]
Length=166

 Score =   313 bits (803),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQV++VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVIDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+V++P D
Sbjct  121  SMAKDLKGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVDVPLD  166



>ref|XP_010541327.1| PREDICTED: 60S ribosomal protein L12-3 [Tarenaya hassleriana]
Length=166

 Score =   313 bits (803),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMR R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRGR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQ+EI+DGEV+IP +
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQEEISDGEVDIPSE  166



>ref|XP_009410228.1| PREDICTED: 60S ribosomal protein L12-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   313 bits (803),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDV+EIA+VM PR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVVEIARVMSPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVP  164



>ref|XP_006846773.1| PREDICTED: 60S ribosomal protein L12 [Amborella trichopoda]
 ref|XP_011624261.1| PREDICTED: 60S ribosomal protein L12 [Amborella trichopoda]
 ref|XP_011624262.1| PREDICTED: 60S ribosomal protein L12 [Amborella trichopoda]
 gb|ERN08354.1| hypothetical protein AMTR_s00148p00026900 [Amborella trichopoda]
Length=166

 Score =   313 bits (802),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+GN+SLDDVIEIA+VM+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGNVSLDDVIEIARVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDLTG+VKEILGTCVSVGCTVDGKDPKDLQ+EI+DG+VE+P D
Sbjct  121  SMAKDLTGTVKEILGTCVSVGCTVDGKDPKDLQKEISDGDVEVPLD  166



>ref|XP_006647736.1| PREDICTED: 60S ribosomal protein L12-1-like [Oryza brachyantha]
Length=166

 Score =   313 bits (802),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKHNGNISLDDVIEIA+ MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHNGNISLDDVIEIARTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKD+ G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKDMFGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGEVEIP  164



>ref|XP_009395874.1| PREDICTED: 60S ribosomal protein L12-1 [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   313 bits (802),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDV+EIA+VMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVVEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVP  164



>ref|XP_010553323.1| PREDICTED: 60S ribosomal protein L12-1 [Tarenaya hassleriana]
Length=166

 Score =   313 bits (802),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VM+ R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMKVR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP++
Sbjct  121  SMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGEVEIPEN  166



>ref|XP_003542515.1| PREDICTED: 60S ribosomal protein L12-like [Glycine max]
Length=166

 Score =   313 bits (801),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDV+EIA+VM PR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVVEIARVMSPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL+G++KEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P
Sbjct  121  SMAKDLSGTIKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVP  164



>gb|EPS61110.1| hypothetical protein M569_13690 [Genlisea aurea]
Length=166

 Score =   313 bits (801),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIG+DIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGDDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIK+LKEPERDRKKTKNIKH+GNISLDDVIEIA+VMR R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKSLKEPERDRKKTKNIKHSGNISLDDVIEIARVMRHR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDLTG+VKEILGTCVSVGCTVDGKDPK+LQQ+IADG+VEIPQD
Sbjct  121  SMAKDLTGTVKEILGTCVSVGCTVDGKDPKNLQQDIADGDVEIPQD  166



>ref|XP_004291576.1| PREDICTED: 60S ribosomal protein L12 [Fragaria vesca subsp. vesca]
Length=166

 Score =   313 bits (801),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH GNISLDDVIEIAK+M+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHTGNISLDDVIEIAKIMKNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLD  166



>ref|XP_008387661.1| PREDICTED: 60S ribosomal protein L12 [Malus domestica]
 ref|XP_008355183.1| PREDICTED: 60S ribosomal protein L12 [Malus domestica]
 ref|XP_008367237.1| PREDICTED: 60S ribosomal protein L12 [Malus domestica]
 ref|XP_009342875.1| PREDICTED: 60S ribosomal protein L12 [Pyrus x bretschneideri]
 ref|XP_009367073.1| PREDICTED: 60S ribosomal protein L12 [Pyrus x bretschneideri]
 ref|XP_009345767.1| PREDICTED: 60S ribosomal protein L12 [Pyrus x bretschneideri]
Length=166

 Score =   313 bits (801),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAKVMR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKVMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+VEIP D
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPLD  166



>gb|EYU34446.1| hypothetical protein MIMGU_mgv1a015171mg [Erythranthe guttata]
Length=166

 Score =   313 bits (801),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI+LDDV+EIAK+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNIALDDVVEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P D
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLD  166



>ref|XP_004487110.1| PREDICTED: 60S ribosomal protein L12-like [Cicer arietinum]
Length=166

 Score =   312 bits (800),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP
Sbjct  121  SMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIP  164



>ref|XP_004497502.1| PREDICTED: 60S ribosomal protein L12-like [Cicer arietinum]
Length=166

 Score =   312 bits (800),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP
Sbjct  121  SMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIP  164



>ref|XP_004304429.1| PREDICTED: 60S ribosomal protein L12 [Fragaria vesca subsp. vesca]
Length=166

 Score =   312 bits (800),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH GNISLDDVIEIAK+M+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHTGNISLDDVIEIAKIMKNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VE+P D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD  166



>ref|XP_007027331.1| Ribosomal protein L11 family protein [Theobroma cacao]
 gb|EOY07833.1| Ribosomal protein L11 family protein [Theobroma cacao]
Length=166

 Score =   312 bits (800),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGC VDGKDPKDLQ+EI++GEV++P
Sbjct  121  SMAKDLRGTVKEILGTCVSVGCMVDGKDPKDLQEEISEGEVDVP  164



>ref|XP_007016741.1| Ribosomal protein L11 family protein [Theobroma cacao]
 gb|EOY34360.1| Ribosomal protein L11 family protein [Theobroma cacao]
Length=166

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQV++VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPTQVIDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNG+ISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGSISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+V++P
Sbjct  121  SMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVDVP  164



>ref|XP_008791537.1| PREDICTED: 60S ribosomal protein L12-3 [Phoenix dactylifera]
Length=166

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVMVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKD+QQEI DG+VEIP +
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDMQQEITDGDVEIPSE  166



>ref|XP_010037962.1| PREDICTED: 60S ribosomal protein L12-1 [Eucalyptus grandis]
 gb|KCW49754.1| hypothetical protein EUGRSUZ_K03247 [Eucalyptus grandis]
Length=166

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA+VM PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMSPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L+G+VKEILGTCVSVGCTVDGKDPKDLQ+EI+DG+VE+P++
Sbjct  121  SMAKNLSGTVKEILGTCVSVGCTVDGKDPKDLQEEISDGDVEVPEN  166



>ref|XP_006837179.1| PREDICTED: 60S ribosomal protein L12 [Amborella trichopoda]
 gb|ERN00033.1| hypothetical protein AMTR_s00105p00048810 [Amborella trichopoda]
Length=166

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIA+VM+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIARVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQ+EI DG+VE+P D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQKEITDGDVEVPLD  166



>ref|NP_001047832.1| Os02g0699600 [Oryza sativa Japonica Group]
 dbj|BAD07879.1| putative 60S ribosomal protein L12 [Oryza sativa Japonica Group]
 dbj|BAF09746.1| Os02g0699600 [Oryza sativa Japonica Group]
 gb|EAY87181.1| hypothetical protein OsI_08582 [Oryza sativa Indica Group]
 gb|EAZ24290.1| hypothetical protein OsJ_08042 [Oryza sativa Japonica Group]
 dbj|BAH00618.1| unnamed protein product [Oryza sativa Japonica Group]
Length=166

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGEVEIP  164



>ref|XP_009413975.1| PREDICTED: 60S ribosomal protein L12-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDV+EIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVVEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQ EI+DG+VE+P
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDLQTEISDGDVEVP  164



>gb|KJB56130.1| hypothetical protein B456_009G107300 [Gossypium raimondii]
Length=166

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI+LDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNINLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+V++P
Sbjct  121  SMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVDVP  164



>ref|XP_009403298.1| PREDICTED: 60S ribosomal protein L12-3-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   311 bits (797),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDV+EIA+VMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVVEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL+G++KEILGTCVSVGCTVDGKDPKDLQ EI+DG+VE+P
Sbjct  121  SMAKDLSGTIKEILGTCVSVGCTVDGKDPKDLQTEISDGDVEVP  164



>ref|XP_010934342.1| PREDICTED: 60S ribosomal protein L12-like [Elaeis guineensis]
Length=166

 Score =   311 bits (797),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNG+IS+DDVIEIA+VMRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGSISVDDVIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKD+QQEI DG+VEIP D
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDIQQEITDGDVEIPSD  166



>gb|ACG35173.1| 60S ribosomal protein L12 [Zea mays]
Length=166

 Score =   311 bits (797),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIA+ MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+++GSVKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKEMSGSVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>ref|XP_007206032.1| hypothetical protein PRUPE_ppa012511mg [Prunus persica]
 ref|XP_007206036.1| hypothetical protein PRUPE_ppa012524mg [Prunus persica]
 ref|XP_008225660.1| PREDICTED: 60S ribosomal protein L12 [Prunus mume]
 ref|XP_008243936.1| PREDICTED: 60S ribosomal protein L12 [Prunus mume]
 gb|EMJ07231.1| hypothetical protein PRUPE_ppa012511mg [Prunus persica]
 gb|EMJ07235.1| hypothetical protein PRUPE_ppa012524mg [Prunus persica]
Length=166

 Score =   311 bits (797),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAK+M+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKIMKHR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+VEIP D
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPLD  166



>ref|XP_008385312.1| PREDICTED: 60S ribosomal protein L12-like [Malus domestica]
Length=166

 Score =   311 bits (796),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAKVMR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKVMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTV+GKDPKDLQQEIADG+VEIP D
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVNGKDPKDLQQEIADGDVEIPLD  166



>ref|XP_003537293.1| PREDICTED: 60S ribosomal protein L12-like [Glycine max]
Length=166

 Score =   311 bits (796),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDV+EIA+VM PR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVVEIARVMSPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL+G++KEILGTCVSVGCTVDGKDPKDLQQEI+DG+VE+P
Sbjct  121  SMAKDLSGTIKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVP  164



>gb|KJB26183.1| hypothetical protein B456_004G229100 [Gossypium raimondii]
Length=166

 Score =   311 bits (796),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI LDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNIGLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+V++P
Sbjct  121  SMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVDVP  164



>ref|XP_002519537.1| 60S ribosomal protein L12, putative [Ricinus communis]
 gb|EEF42951.1| 60S ribosomal protein L12, putative [Ricinus communis]
Length=166

 Score =   310 bits (795),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKH+GNISLD+VIEIAKVM+PR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDNVIEIAKVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVD KDPKDLQQEI DG+VEIP D
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDSKDPKDLQQEITDGDVEIPLD  166



>gb|EPS62643.1| hypothetical protein M569_12145, partial [Genlisea aurea]
Length=164

 Score =   310 bits (793),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGE GA SSLAPKIGPLGLSPKKIG+DIAKETAKDWKGLR+T
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEAGAVSSLAPKIGPLGLSPKKIGDDIAKETAKDWKGLRIT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDV+EIA+VMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVMEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKD TG+VKEILGTCVSVGCTVDGKDPKDLQQE++DG+VE+P
Sbjct  121  SMAKDFTGTVKEILGTCVSVGCTVDGKDPKDLQQEVSDGDVEVP  164



>gb|AFK45138.1| unknown [Medicago truncatula]
 gb|KEH42237.1| 60S ribosomal L12-like protein [Medicago truncatula]
Length=166

 Score =   310 bits (793),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAK+M+PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKIMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEIP
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVEIP  164



>ref|XP_002454433.1| hypothetical protein SORBIDRAFT_04g030890 [Sorghum bicolor]
 ref|XP_002446345.1| hypothetical protein SORBIDRAFT_06g014530 [Sorghum bicolor]
 gb|EES07409.1| hypothetical protein SORBIDRAFT_04g030890 [Sorghum bicolor]
 gb|EES10673.1| hypothetical protein SORBIDRAFT_06g014530 [Sorghum bicolor]
Length=166

 Score =   310 bits (793),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDV+EIAK MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVVEIAKTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>ref|XP_006372196.1| hypothetical protein POPTR_0018s14210g [Populus trichocarpa]
 ref|XP_006372197.1| 60S ribosomal protein L12 [Populus trichocarpa]
 ref|XP_006387864.1| ribosomal protein L12 [Populus trichocarpa]
 ref|XP_011017624.1| PREDICTED: 60S ribosomal protein L12 [Populus euphratica]
 gb|ABK93863.1| unknown [Populus trichocarpa]
 gb|ABK94167.1| unknown [Populus trichocarpa]
 gb|ABK96277.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP46778.1| ribosomal protein L12 [Populus trichocarpa]
 gb|ERP49993.1| hypothetical protein POPTR_0018s14210g [Populus trichocarpa]
 gb|ERP49994.1| 60S ribosomal protein L12 [Populus trichocarpa]
Length=165

 Score =   309 bits (792),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM  R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMSVR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VEI +
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEISE  165



>ref|XP_002447035.1| hypothetical protein SORBIDRAFT_06g027330 [Sorghum bicolor]
 gb|EES11363.1| hypothetical protein SORBIDRAFT_06g027330 [Sorghum bicolor]
Length=166

 Score =   309 bits (791),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDD++EIAK MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDIVEIAKTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>gb|EAY95398.1| hypothetical protein OsI_17237 [Oryza sativa Indica Group]
Length=179

 Score =   309 bits (792),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIA++MR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARIMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD*ENLRFQ  142
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DGEVEIP   +   +Q
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGEVEIPSAYKVYMYQ  173



>ref|XP_008385313.1| PREDICTED: 60S ribosomal protein L12-like isoform X1 [Malus domestica]
Length=215

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAKVMR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKVMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+VEI
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEI  163



>ref|XP_008681298.1| PREDICTED: uncharacterized protein LOC100216970 isoform X1 [Zea 
mays]
 gb|ACF83512.1| unknown [Zea mays]
 gb|AFW72941.1| putative ribosomal protein L11 family protein isoform 1 [Zea 
mays]
 gb|AFW72942.1| putative ribosomal protein L11 family protein isoform 2 [Zea 
mays]
Length=166

 Score =   308 bits (790),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIA+ MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+++G VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKEMSGCVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>ref|XP_008385314.1| PREDICTED: 60S ribosomal protein L12-like isoform X2 [Malus domestica]
Length=188

 Score =   309 bits (792),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAKVMR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKVMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+VEI
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEI  163



>gb|KHG10663.1| 60S ribosomal L12-3 -like protein [Gossypium arboreum]
Length=240

 Score =   311 bits (797),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVE  175
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQ+EI++GEV+
Sbjct  121  SMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQEEISEGEVD  162



>ref|NP_001053741.1| Os04g0598200 [Oryza sativa Japonica Group]
 pdb|3J61|K Chain K, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 emb|CAE03942.3| OSJNba0093F12.16 [Oryza sativa Japonica Group]
 dbj|BAF15655.1| Os04g0598200 [Oryza sativa Japonica Group]
 gb|EAZ31852.1| hypothetical protein OsJ_16016 [Oryza sativa Japonica Group]
Length=166

 Score =   308 bits (789),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIA++MR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARIMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGEVEIP  164



>gb|AGT16537.1| 60S ribosomal protein L12 [Saccharum hybrid cultivar R570]
Length=166

 Score =   308 bits (789),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDV+EIAK MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVVEIAKTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGK+PKDLQQEI DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKNPKDLQQEIDDGEVEIP  164



>gb|KHG20688.1| 60S ribosomal L12-3 -like protein [Gossypium arboreum]
Length=190

 Score =   309 bits (791),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPTQVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV VVPSAAALVIKALKEPERDRKKTKNIKHNGNI LDDVIEIAKVMRPR
Sbjct  61   VKLTVQNRQAKVMVVPSAAALVIKALKEPERDRKKTKNIKHNGNIGLDDVIEIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+V++P
Sbjct  121  SMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVDVP  164



>ref|NP_001150452.1| 60S ribosomal protein L12 [Zea mays]
 gb|ACF84770.1| unknown [Zea mays]
 gb|ACG33825.1| 60S ribosomal protein L12 [Zea mays]
 gb|ACG38266.1| 60S ribosomal protein L12 [Zea mays]
 gb|ACG39151.1| 60S ribosomal protein L12 [Zea mays]
 gb|ACN31628.1| unknown [Zea mays]
 tpg|DAA36210.1| TPA: putative ribosomal protein L11 family protein [Zea mays]
Length=166

 Score =   307 bits (787),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIAK MR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIAKTMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>ref|XP_010689548.1| PREDICTED: 60S ribosomal protein L12-1-like [Beta vulgaris subsp. 
vulgaris]
Length=166

 Score =   307 bits (787),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKIDPSQIVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH GNISLDDVIEIA++M+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHTGNISLDDVIEIARIMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQE+ DGEVEIP +
Sbjct  121  SMAKELKGTVKEILGTCVSVGCTVDGKDPKDLQQEVEDGEVEIPDN  166



>gb|EMT00997.1| 60S ribosomal protein L12-1 [Aegilops tauschii]
Length=166

 Score =   307 bits (787),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIK+LKEPERDRKK KNIKHNGNISLDDVIEIAK+M+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKSLKEPERDRKKVKNIKHNGNISLDDVIEIAKIMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQ EI DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQTEIDDGEVEIP  164



>ref|XP_004953540.1| PREDICTED: 60S ribosomal protein L12-1-like [Setaria italica]
 ref|XP_004975448.1| PREDICTED: 60S ribosomal protein L12-1-like [Setaria italica]
 ref|XP_004976674.1| PREDICTED: 60S ribosomal protein L12-1-like [Setaria italica]
Length=166

 Score =   307 bits (787),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIA+ MR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARTMRSR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>ref|NP_001148350.1| 60S ribosomal protein L12 [Zea mays]
 gb|ACG30958.1| 60S ribosomal protein L12 [Zea mays]
 gb|ACG31467.1| 60S ribosomal protein L12 [Zea mays]
 gb|ACN36842.1| unknown [Zea mays]
 gb|AFW63491.1| putative ribosomal protein L11 family protein isoform 1 [Zea 
mays]
 gb|AFW63492.1| putative ribosomal protein L11 family protein isoform 2 [Zea 
mays]
Length=166

 Score =   307 bits (786),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIA+ MR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARTMRHR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>ref|XP_002308123.1| ribosomal protein L12 [Populus trichocarpa]
 ref|XP_011019977.1| PREDICTED: 60S ribosomal protein L12-like [Populus euphratica]
 gb|ABK93763.1| unknown [Populus trichocarpa]
 gb|EEE91646.1| ribosomal protein L12 [Populus trichocarpa]
Length=165

 Score =   306 bits (785),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI+LDDVIEIAKVM  R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNIALDDVIEIAKVMSSR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+V I +
Sbjct  121  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVVISE  165



>ref|XP_010240357.1| PREDICTED: 60S ribosomal protein L12-3 [Brachypodium distachyon]
Length=166

 Score =   306 bits (783),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIAK+M+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIAKIMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++TG+VKEILGTCVSVGCTVD KDPKDLQ EI DGEVEIP
Sbjct  121  SMAKEMTGTVKEILGTCVSVGCTVDSKDPKDLQTEIDDGEVEIP  164



>gb|ABK26190.1| unknown [Picea sitchensis]
Length=166

 Score =   305 bits (781),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNI+LDDVIEIA+VM+PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNIALDDVIEIARVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTC+SVGCTVDGKDPKD+Q EI +GEVEIP++
Sbjct  121  SMAKELAGTVKEILGTCLSVGCTVDGKDPKDVQTEIDEGEVEIPEE  166



>ref|XP_009345771.1| PREDICTED: 60S ribosomal protein L12-like [Pyrus x bretschneideri]
Length=198

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/161 (94%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+GNISLDDVIEIAKVMR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGNISLDDVIEIAKVMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEV  178
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+V
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDV  161



>gb|EMS60074.1| 60S ribosomal protein L12 [Triticum urartu]
Length=165

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKHNGNISLDDVIEIAK+M+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHNGNISLDDVIEIAKIMKVR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQ EI DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQTEIDDGEVEIP  164



>ref|XP_010684100.1| PREDICTED: 60S ribosomal protein L12-1 [Beta vulgaris subsp. 
vulgaris]
Length=166

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKIDPSQIVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKH GNISLDDVIEIA+VM+PR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHTGNISLDDVIEIARVMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEILGTCVSVGCTVDG DPKDLQQE+ DGEVEIP++
Sbjct  121  SMAKELKGTVKEILGTCVSVGCTVDGSDPKDLQQEVEDGEVEIPEN  166



>sp|O50003.1|RL12_PRUAR RecName: Full=60S ribosomal protein L12 [Prunus armeniaca]
 gb|AAB97143.1| ribosomal protein L12 [Prunus armeniaca]
Length=166

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETA DWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETANDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKH+G+ISLDDVIEIAK+M+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGHISLDDVIEIAKIMKHR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G+VKEIL TCVSVGCTVDGKDPKDLQQEIADG+VEIP D
Sbjct  121  SMAKELAGTVKEILRTCVSVGCTVDGKDPKDLQQEIADGDVEIPLD  166



>dbj|BAK06704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=166

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIK+LKEPERDRKK KNIKHNGNISLDDVIEIAK+M+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKSLKEPERDRKKVKNIKHNGNISLDDVIEIAKIMKTR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQ EI DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQTEIDDGEVEIP  164



>ref|XP_008785284.1| PREDICTED: 60S ribosomal protein L12-3-like [Phoenix dactylifera]
Length=166

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+++VRVTGGEVGAASSLAPKIGP+GLSPKK+GEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVDIYVRVTGGEVGAASSLAPKIGPIGLSPKKVGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTV+NRQAKVSVVPSA ALVIKALKEPERDRKKTKNIKHNGNISLDDVIEI  +MRPR
Sbjct  61   VKLTVENRQAKVSVVPSATALVIKALKEPERDRKKTKNIKHNGNISLDDVIEITCMMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKD+QQEI+DG+VEIP +
Sbjct  121  SMAKDLAGTVKEILGTCVSVGCTVDGKDPKDMQQEISDGDVEIPSE  166



>ref|NP_001148735.1| LOC100282351 [Zea mays]
 gb|ACG32694.1| 60S ribosomal protein L12 [Zea mays]
 tpg|DAA38065.1| TPA: putative ribosomal protein L11 family protein [Zea mays]
Length=166

 Score =   304 bits (778),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNI LDDV+EIA+ MR R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNIGLDDVVEIARTMRNR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>gb|EMS58010.1| 60S ribosomal protein L12-1 [Triticum urartu]
Length=166

 Score =   304 bits (778),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIK+LKEPERDRKK KNIKHNGNISLDDVI IAK+M+PR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKSLKEPERDRKKVKNIKHNGNISLDDVIVIAKIMKPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQ EI DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQTEIDDGEVEIP  164



>ref|XP_001754545.1| predicted protein [Physcomitrella patens]
 gb|EDQ80515.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   303 bits (777),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNISLDDVIEIAK+M PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKVKNIKHNGNISLDDVIEIAKIMAPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMAK+L G+VKEILGTCVSVGCTVDGKDPKDLQ EI DGEVEI
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQSEIDDGEVEI  163



>ref|XP_002881494.1| 60S ribosomal protein L12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57753.1| 60S ribosomal protein L12 [Arabidopsis lyrata subsp. lyrata]
Length=166

 Score =   303 bits (775),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+QQEI DGEVEIP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQDGEVEIPEN  166



>gb|EMT00865.1| 60S ribosomal protein L12 [Aegilops tauschii]
Length=165

 Score =   302 bits (774),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIAK+M+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIAKIMKVR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK++ G+VKEILGTCVSVGCTVDGKDPKDLQ EI DGEVEIP
Sbjct  121  SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQTEIDDGEVEIP  164



>ref|XP_009139412.1| PREDICTED: 60S ribosomal protein L12-2 [Brassica rapa]
 ref|XP_009139418.1| PREDICTED: 60S ribosomal protein L12-2 [Brassica rapa]
 emb|CDY30876.1| BnaC04g27310D [Brassica napus]
 emb|CDX76214.1| BnaA04g04780D [Brassica napus]
Length=166

 Score =   302 bits (773),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQQEI +GE+EIP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIEIPEN  166



>ref|XP_009133126.1| PREDICTED: 60S ribosomal protein L12-2 [Brassica rapa]
 ref|XP_009141636.1| PREDICTED: 60S ribosomal protein L12-2-like [Brassica rapa]
 emb|CDY70392.1| BnaC03g72020D [Brassica napus]
 emb|CDY46760.1| BnaA03g17040D [Brassica napus]
Length=166

 Score =   301 bits (772),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+QQEI +GEVEIP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQEGEVEIPEN  166



>ref|XP_001780484.1| predicted protein [Physcomitrella patens]
 ref|XP_001780487.1| predicted protein [Physcomitrella patens]
 gb|EDQ54685.1| predicted protein [Physcomitrella patens]
 gb|EDQ54688.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   301 bits (771),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETA+DWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETARDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNISLDDVIEIAK+M PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKVKNIKHNGNISLDDVIEIAKIMAPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMAK+L G+VKEILGTCVSVGC+VDGKDPKDLQ EI DGEVEI
Sbjct  121  SMAKELAGTVKEILGTCVSVGCSVDGKDPKDLQAEIDDGEVEI  163



>ref|XP_006410898.1| hypothetical protein EUTSA_v10017332mg [Eutrema salsugineum]
 gb|ESQ52351.1| hypothetical protein EUTSA_v10017332mg [Eutrema salsugineum]
Length=166

 Score =   301 bits (771),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+QQEI DG+VEIP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQDGDVEIPEN  166



>ref|NP_181256.1| ribosomal protein L11 family protein [Arabidopsis thaliana]
 sp|P50883.2|RL121_ARATH RecName: Full=60S ribosomal protein L12-1 [Arabidopsis thaliana]
 gb|AAK49612.1|AF372896_1 At2g37190/T2N18.5 [Arabidopsis thaliana]
 gb|AAD18140.1| 60S ribosomal protein L12 [Arabidopsis thaliana]
 gb|AAM64365.1| 60S ribosomal protein L12 [Arabidopsis thaliana]
 gb|AAO11589.1| At2g37190/T2N18.5 [Arabidopsis thaliana]
 gb|AEC09364.1| ribosomal protein L11 family protein [Arabidopsis thaliana]
Length=166

 Score =   301 bits (770),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDV EIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+QQEI DGEVEIP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQDGEVEIPEN  166



>ref|XP_006296028.1| hypothetical protein CARUB_v10025173mg [Capsella rubella]
 gb|EOA28926.1| hypothetical protein CARUB_v10025173mg [Capsella rubella]
Length=166

 Score =   300 bits (769),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+QQEI +GEVE+P++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQEGEVELPEN  166



>ref|NP_001136822.1| uncharacterized protein LOC100216970 [Zea mays]
 gb|ACF82708.1| unknown [Zea mays]
 gb|AFW72940.1| putative ribosomal protein L11 family protein [Zea mays]
Length=170

 Score =   300 bits (769),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIA+ MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGE  181
            SMAK+++G VKEILGTCVSVGCTVDGKDPKDLQQEI DGE
Sbjct  121  SMAKEMSGCVKEILGTCVSVGCTVDGKDPKDLQQEIDDGE  160



>ref|XP_002877919.1| 60S ribosomal protein L12 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010504106.1| PREDICTED: 60S ribosomal protein L12-2 [Camelina sativa]
 ref|XP_010515833.1| PREDICTED: 60S ribosomal protein L12-2 [Camelina sativa]
 ref|XP_010426990.1| PREDICTED: 60S ribosomal protein L12-2 [Camelina sativa]
 gb|EFH54178.1| 60S ribosomal protein L12 [Arabidopsis lyrata subsp. lyrata]
 emb|CDY56698.1| BnaCnng31050D [Brassica napus]
 emb|CDY52760.1| BnaA07g37750D [Brassica napus]
 emb|CDY13296.1| BnaC06g14610D [Brassica napus]
Length=166

 Score =   300 bits (769),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQQEI +GE++IP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIDIPEN  166



>ref|XP_001768595.1| predicted protein [Physcomitrella patens]
 gb|EDQ66533.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   300 bits (769),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETA+DWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETARDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNISLDDVIEIAK+M PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKVKNIKHNGNISLDDVIEIAKIMAPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMAK+L G+VKEILGTCVSVGCTVD KDPKDLQ EI DGEVEI
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDNKDPKDLQTEIDDGEVEI  163



>ref|NP_190911.1| 60S ribosomal protein L12-2 [Arabidopsis thaliana]
 sp|Q9LFH5.1|RL122_ARATH RecName: Full=60S ribosomal protein L12-2; AltName: Full=ABI1-binding 
protein 11 [Arabidopsis thaliana]
 emb|CAB67650.1| 60S RIBOSOMAL PROTEIN L12-like [Arabidopsis thaliana]
 gb|AAM98243.1| 60S ribosomal protein L12-like protein [Arabidopsis thaliana]
 gb|AAO00950.1| 60S ribosomal protein L12-like protein [Arabidopsis thaliana]
 dbj|BAE98626.1| 60S ribosomal Protein L12 -like [Arabidopsis thaliana]
 gb|AEE79085.1| 60S ribosomal protein L12-2 [Arabidopsis thaliana]
Length=166

 Score =   300 bits (768),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDV EIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQQEI +GE+EIP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIEIPEN  166



>ref|XP_001778620.1| predicted protein [Physcomitrella patens]
 gb|EDQ56515.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   300 bits (767),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETA+DWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETARDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNISLDDVIEIAK+M PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKVKNIKHNGNISLDDVIEIAKIMAPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMAK+L G+VKEILGTCVSVGCTVD KDPKDLQ EI DGEVEI
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDHKDPKDLQSEIDDGEVEI  163



>ref|XP_001765722.1| predicted protein [Physcomitrella patens]
 gb|EDQ69561.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   300 bits (767),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETA+DWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETARDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNISLDDVIEIAK+M PR
Sbjct  61   VKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKVKNIKHNGNISLDDVIEIAKIMAPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMAK+L G+VKEILGTCVSVGCTVD KDPKDLQ EI DGEVEI
Sbjct  121  SMAKELAGTVKEILGTCVSVGCTVDQKDPKDLQTEIDDGEVEI  163



>ref|XP_010505296.1| PREDICTED: 60S ribosomal protein L12-2-like [Camelina sativa]
 ref|XP_010516977.1| PREDICTED: 60S ribosomal protein L12-2-like [Camelina sativa]
Length=166

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS +DVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFEDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+QQEI +GEVE+P++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQEGEVEVPEN  166



>ref|XP_003570163.1| PREDICTED: 60S ribosomal protein L12-3-like [Brachypodium distachyon]
Length=166

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVIEIAK+M+ R
Sbjct  61   VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIAKIMKVR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+++G+VKEILGTCVSVGCTVD KDPKDLQ EI +GEVEIP
Sbjct  121  SMAKEMSGTVKEILGTCVSVGCTVDNKDPKDLQTEIDEGEVEIP  164



>ref|XP_006403690.1| hypothetical protein EUTSA_v10010772mg [Eutrema salsugineum]
 gb|ESQ45143.1| hypothetical protein EUTSA_v10010772mg [Eutrema salsugineum]
Length=166

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEI+++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEISRIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQQEI +GE++IP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIDIPEN  166



>ref|XP_009116035.1| PREDICTED: 60S ribosomal protein L12-2-like [Brassica rapa]
Length=166

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPT +V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPTAIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQQEI +GE++IP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIDIPEN  166



>gb|KFK36607.1| hypothetical protein AALP_AA4G145600 [Arabis alpina]
Length=166

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+ +V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSAIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+QQEI DGEV+IP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQDGEVDIPEN  166



>ref|XP_006291953.1| hypothetical protein CARUB_v10018141mg [Capsella rubella]
 gb|EOA24851.1| hypothetical protein CARUB_v10018141mg [Capsella rubella]
Length=166

 Score =   298 bits (763),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQQEI +G+++IP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGDLDIPEN  166



>gb|KFK34593.1| hypothetical protein AALP_AA5G165900 [Arabis alpina]
Length=166

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+Q+EI +GEV+IP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQEEIQNGEVDIPEN  166



>emb|CDX78178.1| BnaA09g33730D [Brassica napus]
Length=166

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+ +V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSAIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQQEI +GE++IP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIDIPEN  166



>ref|XP_009103861.1| PREDICTED: 60S ribosomal protein L12-2-like [Brassica rapa]
Length=166

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDI KETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIDKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQQEI +GE++IP++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIDIPEN  166



>ref|XP_009120601.1| PREDICTED: 60S ribosomal protein L12-3 [Brassica rapa]
 emb|CDY31522.1| BnaA10g13490D [Brassica napus]
Length=166

 Score =   297 bits (761),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDG+DPKDLQ+EI  G++E+P +
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGRDPKDLQEEIVSGDIEVPNE  166



>ref|NP_200875.1| 60S ribosomal protein L12-3 [Arabidopsis thaliana]
 sp|Q9FF52.1|RL123_ARATH RecName: Full=60S ribosomal protein L12-3 [Arabidopsis thaliana]
 dbj|BAB09840.1| 60S ribosomal protein L12 [Arabidopsis thaliana]
 gb|AAK62669.1| AT5g60670/mup24_80 [Arabidopsis thaliana]
 gb|AAL77726.1| AT5g60670/mup24_80 [Arabidopsis thaliana]
 gb|AAM65708.1| 60S ribosomal protein L12-like [Arabidopsis thaliana]
 gb|AED97365.1| 60S ribosomal protein L12-3 [Arabidopsis thaliana]
Length=166

 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+VKEILGTCVSVGCTVDGKDPKDLQ+EI  G+++IP +
Sbjct  121  SIAKELSGTVKEILGTCVSVGCTVDGKDPKDLQEEINSGDIDIPNE  166



>ref|XP_010456654.1| PREDICTED: 60S ribosomal protein L12-3 [Camelina sativa]
 ref|XP_010456661.1| PREDICTED: 60S ribosomal protein L12-3 [Camelina sativa]
 ref|XP_010443869.1| PREDICTED: 60S ribosomal protein L12-3 [Camelina sativa]
 ref|XP_010483716.1| PREDICTED: 60S ribosomal protein L12-3 [Camelina sativa]
 ref|XP_010483717.1| PREDICTED: 60S ribosomal protein L12-3 [Camelina sativa]
Length=166

 Score =   296 bits (759),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+VKEILGTCVSVGCTVDGKDPKDLQ+EI  G++++P +
Sbjct  121  SIAKELSGTVKEILGTCVSVGCTVDGKDPKDLQEEINSGDIDVPNE  166



>ref|XP_006400823.1| hypothetical protein EUTSA_v10014862mg [Eutrema salsugineum]
 gb|ESQ42276.1| hypothetical protein EUTSA_v10014862mg [Eutrema salsugineum]
Length=166

 Score =   296 bits (759),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEI+K+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEISKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDG+DPKDLQ+EI +G++E+P +
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGRDPKDLQEEIVNGDIEVPNE  166



>ref|XP_010509370.1| PREDICTED: 60S ribosomal protein L12-2-like [Camelina sativa]
Length=166

 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS +DVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFEDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKD+QQ I +GEVE+P++
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQGIQEGEVEVPEN  166



>emb|CDY53628.1| BnaC09g53910D [Brassica napus]
Length=166

 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDG+DPKDLQ+EI +G++++P +
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGRDPKDLQEEIVNGDIDVPHE  166



>ref|XP_006281217.1| hypothetical protein CARUB_v10027257mg [Capsella rubella]
 gb|EOA14115.1| hypothetical protein CARUB_v10027257mg [Capsella rubella]
Length=166

 Score =   296 bits (757),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+VKEILGTCVSVGCTVDG+DPKDLQ+EI  G++++P +
Sbjct  121  SIAKELSGTVKEILGTCVSVGCTVDGRDPKDLQEEINSGDIDVPNE  166



>gb|KFK27593.1| hypothetical protein AALP_AA8G403900 [Arabis alpina]
Length=166

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+V+EILGTCVSVGCTVDG+DPK+LQ+EI +G++++P +
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGRDPKELQEEICNGDIDVPNE  166



>ref|XP_004293618.1| PREDICTED: 60S ribosomal protein L12-like [Fragaria vesca subsp. 
vesca]
Length=162

 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 156/166 (94%), Gaps = 4/166 (2%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVVEV+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAK    DWKG+RVT
Sbjct  1    MPPKFDPSQVVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAK----DWKGIRVT  56

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSA+ALVIKALKEPER RKKTKNI H GNISLDDVIEIAK+M+ R
Sbjct  57   VKLTVQNRQAKVSVVPSASALVIKALKEPERHRKKTKNITHTGNISLDDVIEIAKIMKNR  116

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL+G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+VE+P D
Sbjct  117  SMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD  162



>ref|XP_008663151.1| PREDICTED: 60S ribosomal protein L12-like [Zea mays]
 tpg|DAA47857.1| TPA: putative ribosomal protein L11 family protein [Zea mays]
Length=166

 Score =   286 bits (732),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            M PK DP+QVVEVFVRVTGGEV AASSLAPKIGPL LS +KIGEDIAKETAKDWKGLRVT
Sbjct  1    MSPKLDPSQVVEVFVRVTGGEVSAASSLAPKIGPLCLSSRKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQAKVSVVPSAAALVIKA KEPERDRKK KNIKHNG+ISLDDVIEI K MR R
Sbjct  61   VKLTMQNRQAKVSVVPSAAALVIKAPKEPERDRKKVKNIKHNGSISLDDVIEITKTMRHR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L G+VKEILGT VSVGCTVDGKDPKDLQQEI DGEVEIP
Sbjct  121  SMAKELAGTVKEILGTYVSVGCTVDGKDPKDLQQEIDDGEVEIP  164



>emb|CDY27019.1| BnaA02g10390D [Brassica napus]
Length=167

 Score =   285 bits (728),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQ  199
            S+AK+L+G+V+EILGTCVSVGCTVDGKDPKDLQ 
Sbjct  121  SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQH  154



>ref|XP_001759613.1| predicted protein [Physcomitrella patens]
 gb|EDQ75525.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   284 bits (727),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+VEV+VRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAKDWKGLRVT
Sbjct  1    MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRK+ KNIKHNGNISLDDVIEIAK++   
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKRVKNIKHNGNISLDDVIEIAKIIIQW  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            SMAK   G+VKEILGTCVSVGCTVD KDPK++Q+ I DGEVEIP+
Sbjct  121  SMAKHAAGTVKEILGTCVSVGCTVDVKDPKEVQEGIDDGEVEIPE  165



>ref|XP_002963454.1| hypothetical protein SELMODRAFT_227409 [Selaginella moellendorffii]
 gb|EFJ35325.1| hypothetical protein SELMODRAFT_227409 [Selaginella moellendorffii]
Length=166

 Score =   283 bits (724),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            M PK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKET KDWKGLR+T
Sbjct  1    MAPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETVKDWKGLRIT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL VQNRQAKV VVPSAAALVIKALKEPERDRKK KNIKH+GNISL+DVI+IAK+M+ R
Sbjct  61   VKLIVQNRQAKVEVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLEDVIDIAKIMKHR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            SMAK+  G+VKEILGTCV+VGCTVDGK PKDLQ EI DGEV+I +
Sbjct  121  SMAKEFKGTVKEILGTCVAVGCTVDGKSPKDLQTEIDDGEVDIAE  165



>ref|XP_002988167.1| hypothetical protein SELMODRAFT_183633 [Selaginella moellendorffii]
 gb|EFJ10586.1| hypothetical protein SELMODRAFT_183633 [Selaginella moellendorffii]
Length=166

 Score =   281 bits (720),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            M PK DP+QVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKK+GEDIAKET KDWKGLR+T
Sbjct  1    MAPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETVKDWKGLRIT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL VQNRQAKV VVPSAAALVIKALKEPERDRKK KNIKH+GNISL+DVI+IAK+M+ R
Sbjct  61   VKLIVQNRQAKVEVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLEDVIDIAKIMKHR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            SMAK+  G+VKEILGTCV+VGCTVDGK PKDLQ EI +GEV+I +
Sbjct  121  SMAKEFKGTVKEILGTCVAVGCTVDGKSPKDLQTEIDEGEVDIAE  165



>ref|XP_002507299.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68557.1| predicted protein [Micromonas sp. RCC299]
Length=166

 Score =   280 bits (716),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+ V+EVF+R TGGEVGAASSLAPKIGPLGLSPKK+GEDIAKET KDW GLRVT
Sbjct  1    MPPKFDPSSVIEVFLRATGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETKKDWNGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSA+ALVIKALKEP RDRKK K++KH+GNISLDDVIEIA++MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSASALVIKALKEPPRDRKKVKHVKHSGNISLDDVIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK+L G+VKEILGT  S GCTV+G+DP+D+QQ I DG++EIP
Sbjct  121  SMAKELKGTVKEILGTAKSTGCTVEGEDPQDVQQSIQDGDIEIP  164



>ref|XP_002866390.1| hypothetical protein ARALYDRAFT_496216 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42649.1| hypothetical protein ARALYDRAFT_496216, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=155

 Score =   279 bits (713),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 9/164 (5%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+Q+V+V+VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKK KNIKHNGNIS DDVIEIAK+MRPR
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SM         EILGTCVSVGCTVDGKDPKDLQ+EI +G+++IP
Sbjct  121  SM---------EILGTCVSVGCTVDGKDPKDLQEEINNGDIDIP  155



>ref|XP_003597238.1| 60S ribosomal Protein L12-like protein [Medicago truncatula]
 gb|AES67489.1| 60S ribosomal L12-like protein [Medicago truncatula]
Length=166

 Score =   276 bits (705),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP+QV EV VR+TGGEVGAASSLAPKIGPLGLSPKKIGEDIAK TAKDWKG+RVT
Sbjct  1    MPPKLDPSQVTEVKVRITGGEVGAASSLAPKIGPLGLSPKKIGEDIAKVTAKDWKGIRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
             KL VQNRQA++ VVPSA+ALVIKALKEPERDRKKTK+I HNGNISL+DVI+IA+VM PR
Sbjct  61   AKLIVQNRQAEIEVVPSASALVIKALKEPERDRKKTKHINHNGNISLEDVIDIARVMSPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK L+G+V E+LGTCVSVGCTVDGK PKDLQQEI  G VEIP
Sbjct  121  SMAKKLSGTVNEVLGTCVSVGCTVDGKAPKDLQQEINGGVVEIP  164



>ref|XP_003054831.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60083.1| predicted protein [Micromonas pusilla CCMP1545]
Length=166

 Score =   270 bits (689),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP  ++EVF+R TGGEVGAASSLAPKIGPLGLSPKK+GEDIAKET KDW GLRVT
Sbjct  1    MPPKMDPNAIIEVFLRATGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETKKDWNGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVPSA+ALVIKALKEP RDRKK K++KH+GNISLDD IEIA++MRPR
Sbjct  61   VKLTVQNRQAKVSVVPSASALVIKALKEPPRDRKKVKHVKHSGNISLDDCIEIARIMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S AK L G+VKEILGT  S GCTV+G+DP+D+QQ I DG++EIP
Sbjct  121  SKAKKLAGTVKEILGTAKSTGCTVEGQDPQDVQQAIEDGDIEIP  164



>ref|XP_005642636.1| hypothetical protein COCSUDRAFT_55030 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18092.1| hypothetical protein COCSUDRAFT_55030 [Coccomyxa subellipsoidea 
C-169]
Length=166

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            M PKFDP+Q+VEV+VR TGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MAPKFDPSQLVEVYVRATGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL+VQNR AKVSV+PSA ALVIKALKEP RDRKK KNIKH+GN+ LD+VIEIA+VMR R
Sbjct  61   VKLSVQNRIAKVSVIPSAGALVIKALKEPIRDRKKEKNIKHSGNLELDEVIEIARVMRDR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S A+ L G+VKEILGTCVSVGCTVD +DP+++Q +I +GEV+IP++
Sbjct  121  SCARKLAGTVKEILGTCVSVGCTVDHEDPREIQSKIDEGEVDIPEE  166



>ref|XP_002953500.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45473.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=166

 Score =   268 bits (685),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP  VVEV VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLR+T
Sbjct  1    MPPKFDPNDVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRIT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAK+SV+PSAAALVIKALKEP RDRKK KNIKH+G++++ D+IEIA+VMRPR
Sbjct  61   VKLTVQNRQAKISVIPSAAALVIKALKEPPRDRKKEKNIKHSGSVTMSDIIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S AKDL    KEILGT VSVGC VDGKDP+D+   I DG +E+P
Sbjct  121  SCAKDLANGCKEILGTAVSVGCKVDGKDPRDVIAAINDGSLEVP  164



>ref|XP_001696972.1| ribosomal protein L12, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP00664.1| ribosomal protein L12 [Chlamydomonas reinhardtii]
Length=166

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+ VVEV VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKET KDWKGLR+T
Sbjct  1    MPPKFDPSDVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRIT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAK+SV+PSAAALVIKALKEP RDRKK KNIKH G++++ D+IEIA+VMRPR
Sbjct  61   VKLTVQNRQAKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S AKDL    KEILGT VSVGC VDGKDP+D+   I DG +EIP
Sbjct  121  SCAKDLANGCKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIP  164



>gb|AAC84136.1| ribosomal protein L12 [Cichorium intybus]
Length=142

 Score =   266 bits (680),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTV NRQAKVSVVPSAAALVIKALKEPERDRKK KNIKH+GNISLDDVI IAKVMRPR
Sbjct  61   VKLTVXNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIXIAKVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGC  235
            SMAK+L G+VKEILGTCVSVGC
Sbjct  121  SMAKELQGTVKEILGTCVSVGC  142



>ref|XP_001416788.1| Ribosomal protein L12, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO95081.1| Ribosomal protein L12, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=166

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP  V+E+F+R TGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPNSVLEIFMRATGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSVVP+A+ALVIKALKEP +DRKK K I H GN SLDD+IE+A+ MRPR
Sbjct  61   VKLTVQNRQAKVSVVPTASALVIKALKEPFQDRKKVKGILHTGNCSLDDIIEVARTMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            S AK L G+VKEILGT  SVGCTV+G+DP D+Q+ I  G++EIP+
Sbjct  121  SCAKSLAGTVKEILGTAKSVGCTVEGEDPSDVQESIDSGDIEIPE  165



>emb|CEF97341.1| Ribosomal protein L11 [Ostreococcus tauri]
Length=211

 Score =   266 bits (680),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  678  NSVSATMPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDW  499
            ++ +  MPPKFDP   +E+F+R TGGEVGAASSLAPKIGPLGLSPKK+GEDIAKETAKDW
Sbjct  40   STATGKMPPKFDPNATLEIFMRATGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKDW  99

Query  498  KGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIA  319
            KGLRVTVKLTVQNRQAKVSVVP+A+ALVIKALKEP +DRKK K I H GN SLDD+IE+A
Sbjct  100  KGLRVTVKLTVQNRQAKVSVVPTASALVIKALKEPFQDRKKVKGITHTGNCSLDDIIEVA  159

Query  318  KVMRPRSMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            +VMRP+S AK+L G+VKEILGT  SVGCTV+G+DP D+Q+ I  G++EIP+
Sbjct  160  RVMRPKSCAKNLAGTVKEILGTAKSVGCTVEGEDPSDVQESIDAGDIEIPE  210



>gb|KDD76983.1| hypothetical protein H632_c48p1 [Helicosporidium sp. ATCC 50920]
Length=166

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP  VVEVFVR TGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPNAVVEVFVRATGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL+VQNRQAKVSV+PSAAALVIKALKEP RDRKK KN+ HNG++ L+++ +IA++MR R
Sbjct  61   VKLSVQNRQAKVSVIPSAAALVIKALKEPPRDRKKEKNVPHNGSVPLEEIYQIARIMRDR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S A    GSVKEILGTCVSVGC V+G+DP+DLQ++I +GE+ +P
Sbjct  121  SCAASFKGSVKEILGTCVSVGCKVEGEDPRDLQEQIDNGELVVP  164



>ref|XP_011018204.1| PREDICTED: 60S ribosomal protein L12-like [Populus euphratica]
Length=272

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 152/172 (88%), Gaps = 6/172 (3%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM  R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMSVR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD*ENLRF  145
            SMAKDL+G+VKEILGTCV +G    G  PK + ++IA    E  +D + LR 
Sbjct  121  SMAKDLSGTVKEILGTCV-IGAL--GLSPKKIGEDIAK---ETAKDWKGLRV  166


 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = -3

Query  567  IGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPER  388
            IG LGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKV+VVPSAAALVIKALKEPER
Sbjct  139  IGALGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPER  198

Query  387  DRKKTKNIKHNGNISLDDVIEIAKVMRPRSMAKDLTGSVKEILGTCVSVGCTVDGKDPKD  208
            DRKKTKNIKHNGNISLDDVIEIAKVM  RSMAKDL+G+VKEILGTCVSVGCTVDGKDPKD
Sbjct  199  DRKKTKNIKHNGNISLDDVIEIAKVMSVRSMAKDLSGTVKEILGTCVSVGCTVDGKDPKD  258

Query  207  LQQEIADGEVEIPQ  166
            LQQEI DG+VEI +
Sbjct  259  LQQEITDGDVEISE  272



>gb|KIY92888.1| 60S ribosomal protein L12-3 [Monoraphidium neglectum]
Length=166

 Score =   262 bits (669),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            M PKFDP +V+EVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDW+GLRVT
Sbjct  1    MAPKFDPNEVIEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWRGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL VQNRQAKVSVVPSAAALVIKALKEP RDRKK KNIKH GNI+ DD+IEIA+VMRPR
Sbjct  61   VKLAVQNRQAKVSVVPSAAALVIKALKEPVRDRKKEKNIKHTGNITFDDIIEIARVMRPR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S+AK L G+ KE+LGT  SVGCT+D   P+++  +I  GE+ +P
Sbjct  121  SVAKSLAGTCKEMLGTAQSVGCTIDHMHPQEVMGKIDSGELAVP  164



>ref|XP_005848435.1| hypothetical protein CHLNCDRAFT_35072 [Chlorella variabilis]
 gb|EFN56333.1| hypothetical protein CHLNCDRAFT_35072 [Chlorella variabilis]
Length=166

 Score =   261 bits (668),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++++EV+VR TGGE+GAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSEIIEVYVRATGGEIGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
             KLTVQNRQAKV+V+PSAAALVIKALKEP RDRKK KNI HNGN++++DV E+A+VM  R
Sbjct  61   CKLTVQNRQAKVTVIPSAAALVIKALKEPVRDRKKEKNIVHNGNLTIEDVYEVARVMADR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            S A    G+VKE+LGTCVSVGCTV+ +DP+D+Q++I DGE+  P+
Sbjct  121  SCAATFAGTVKEMLGTCVSVGCTVEHEDPRDIQKKIDDGEIVCPE  165



>ref|XP_007512325.1| 60S ribosomal protein L12 [Bathycoccus prasinos]
 emb|CCO66413.1| 60S ribosomal protein L12 [Bathycoccus prasinos]
Length=166

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP  V+EVF+R TGGEVGAASSLAPKIGPLGLSPKK+GEDIAKET KDWKGLRVT
Sbjct  1    MPPKFDPNAVIEVFLRATGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETGKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL+V NRQAKVSVVP+A+ALVI+ALKEP RDRKK K++ H+GN++LD++IEIA+ MRP+
Sbjct  61   VKLSVANRQAKVSVVPTASALVIRALKEPFRDRKKEKDVPHDGNVALDEIIEIARQMRPK  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            S AK L+G+VKEILGT  SVGCTV+G+DP+D+QQ I DG++ IP+
Sbjct  121  SRAKTLSGTVKEILGTAKSVGCTVEGEDPQDVQQSIDDGDIVIPE  165



>ref|XP_011400372.1| 60S ribosomal protein L12-1 [Auxenochlorella protothecoides]
 gb|KFM27405.1| 60S ribosomal protein L12-1 [Auxenochlorella protothecoides]
Length=157

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP  ++EV+VR TGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPNSIIEVYVRATGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKVSV+PSAA+LVIKALKEP RDRKK KNI H+GN++L+DV EIA++MR R
Sbjct  61   VKLTVQNRQAKVSVIPSAASLVIKALKEPVRDRKKEKNIVHSGNLALEDVYEIARIMRDR  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEI  193
            S A    G+VKEILGTCVSVGC VD +DP+D+QQ++
Sbjct  121  SCAAGFAGTVKEILGTCVSVGCQVDNEDPRDIQQKV  156



>emb|CEG72388.1| Putative 60S ribosomal protein L12 [Rhizopus microsporus]
 emb|CEG66402.1| Putative 60S ribosomal protein L12 [Rhizopus microsporus]
 emb|CEG64797.1| Putative 60S ribosomal protein L12 [Rhizopus microsporus]
 emb|CEJ03151.1| Putative 60S ribosomal protein L12 [Rhizopus microsporus]
 emb|CEJ00223.1| Putative 60S ribosomal protein L12 [Rhizopus microsporus]
 emb|CEI93620.1| Putative 60S ribosomal protein L12 [Rhizopus microsporus]
 emb|CEI93378.1| Putative 60S ribosomal protein L12 [Rhizopus microsporus]
 emb|CEI92633.1| Putative 60S ribosomal protein L12 [Rhizopus microsporus]
Length=165

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA+VSVVPSA++LVIKALKEP RDRKK KNIKH+GNISLDDVIEIA+ MR +
Sbjct  60   VQLTIQNRQAQVSVVPSASSLVIKALKEPVRDRKKEKNIKHSGNISLDDVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            S+A++L G+VKEILGT  SVGCTVDG+ PKD+Q  I  GE+EIP+
Sbjct  120  SLARELKGTVKEILGTAFSVGCTVDGQSPKDIQDAIDAGEIEIPE  164



>ref|NP_587897.1| 60S ribosomal protein L12 [Schizosaccharomyces pombe 972h-]
 ref|NP_587923.1| 60S ribosomal protein L12 [Schizosaccharomyces pombe 972h-]
 sp|O75000.1|RL12_SCHPO RecName: Full=60S ribosomal protein L12 [Schizosaccharomyces 
pombe 972h-]
 emb|CAA20752.1| 60S ribosomal protein L12.1/L12A [Schizosaccharomyces pombe]
 emb|CAA21221.1| 60S ribosomal protein L12.1/L12A [Schizosaccharomyces pombe]
Length=165

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  +F+R  GGEV   S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPNEVKTIFMRAVGGEVAGGSTLAPKIGPLGLSPKKVGEDIAKAT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVPSA+ALVIKALKEP RDRKK KN+ H+GN+SLD++IE+A+ MR +
Sbjct  60   VKLTIQNRQAAVSVVPSASALVIKALKEPARDRKKDKNVAHSGNVSLDEIIEVARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+VKEILGT  SVGCTVDGK+P D+Q+EI +GE+EIPQ+
Sbjct  120  SLAKELSGTVKEILGTAFSVGCTVDGKNPHDVQKEIDNGEIEIPQE  165



>gb|KJB20286.1| hypothetical protein B456_003G141700 [Gossypium raimondii]
Length=142

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 138/164 (84%), Gaps = 24/164 (15%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+VFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAK+WKGLRVT
Sbjct  1    MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKEWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
                                    ALKEPERDRKKTKNIKHNGNI+LDDVIEIAKVMRPR
Sbjct  61   ------------------------ALKEPERDRKKTKNIKHNGNIALDDVIEIAKVMRPR  96

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+V++P
Sbjct  97   SMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVDVP  140



>gb|KFH64665.1| 60S ribosomal protein L12 [Mortierella verticillata NRRL 6337]
 gb|KFH72740.1| 60S ribosomal protein L12 [Mortierella verticillata NRRL 6337]
Length=165

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DP ++  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T +DWKGLRVT
Sbjct  1    MPPKLDPNEIKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKAT-QDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKE  RDRKK KNIKHNGNISLDDVIEIA++MRP+
Sbjct  60   VQLTIQNRQAAVSVVPSASSLVIKALKEAPRDRKKEKNIKHNGNISLDDVIEIARIMRPK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            S+A++L+G+VKEILGT  SVGCTVDG++PKDL   I  GEVEIP+
Sbjct  120  SLARELSGTVKEILGTAFSVGCTVDGQNPKDLGDAIDAGEVEIPE  164



>ref|XP_002173065.1| 60S ribosomal protein/L12A [Schizosaccharomyces japonicus yFS275]
 gb|EEB06772.1| 60S ribosomal protein/L12A [Schizosaccharomyces japonicus yFS275]
Length=165

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  + +R  GGEV   S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPSEVKILLMRAVGGEVAGGSTLAPKIGPLGLSPKKVGEDIAKAT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVP+A++LVIKALKEP RDRKK KNI H+GN+SLD+VIEIA+ MR +
Sbjct  60   VKLTIQNRQATVSVVPAASSLVIKALKEPARDRKKDKNIIHSGNLSLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+VKEILGTC SVGCTVDGK+P DLQ+EI +G+VEIPQ+
Sbjct  120  SLAKELSGTVKEILGTCFSVGCTVDGKNPHDLQKEIDNGDVEIPQE  165



>ref|XP_002173743.1| 60S ribosomal protein/L12A [Schizosaccharomyces japonicus yFS275]
 gb|EEB07450.1| 60S ribosomal protein/L12A [Schizosaccharomyces japonicus yFS275]
Length=165

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  + +R  GGEV   S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPNEVKILLMRAVGGEVAGGSTLAPKIGPLGLSPKKVGEDIAKAT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVP+A++LVIKALKEP RDRKK KNI H+GN+SLD+VIEIA+ MR +
Sbjct  60   VKLTIQNRQATVSVVPAASSLVIKALKEPARDRKKDKNIIHSGNLSLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+VKEILGTC SVGCTVDGK+P DLQ+EI  GEVEIPQ+
Sbjct  120  SLAKELSGTVKEILGTCFSVGCTVDGKNPHDLQKEIDAGEVEIPQE  165



>emb|CEP15404.1| hypothetical protein [Parasitella parasitica]
 emb|CEP08182.1| hypothetical protein [Parasitella parasitica]
Length=165

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA+VSVVPSA++LVIKALKEP RDRKK KNIKH+GN+SL+D+IEIA+ MR +
Sbjct  60   VQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIKHSGNVSLEDIIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            S+A++L+G+VKEILGT  SVGCTVDG++PKDL   I  GEVEIP+
Sbjct  120  SLARELSGTVKEILGTAFSVGCTVDGQNPKDLCAAIDAGEVEIPE  164



>gb|EIE75752.1| 60S ribosomal protein L12 [Rhizopus delemar RA 99-880]
 gb|EIE76861.1| 60S ribosomal protein L12 [Rhizopus delemar RA 99-880]
 gb|EIE81577.1| 60S ribosomal protein L12 [Rhizopus delemar RA 99-880]
 gb|EIE85976.1| 60S ribosomal protein L12 [Rhizopus delemar RA 99-880]
 gb|EIE90135.1| 60S ribosomal protein L12 [Rhizopus delemar RA 99-880]
Length=165

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA+VSVVPSA++LVIKALKEP RDRKK KNIKH+GNISLDDVIEIA+ MR +
Sbjct  60   VQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIKHSGNISLDDVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            S+A++L G+VKEILGT  SVGCTV+G++PKDL   I  GEVEIP+
Sbjct  120  SLARELKGTVKEILGTAFSVGCTVEGQNPKDLCDAIDAGEVEIPE  164



>gb|ABC67745.1| ribosomal protein L12 [Anthopleura elegantissima]
Length=166

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++  V++R TGGEVGA +SLAPKIGPLGLSPKK+G+DIAK T +DWKGLR+T
Sbjct  1    MPPKFDPNEIKIVYLRCTGGEVGATASLAPKIGPLGLSPKKVGDDIAKGT-QDWKGLRIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQAKVSV+PSA++L+IKALKEP RDRKK KNIKHNGNIS++ +I+IAK MRPR
Sbjct  60   VQLTIQNRQAKVSVIPSASSLIIKALKEPPRDRKKVKNIKHNGNISMEQLIDIAKTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMA+ L+G+VKEILGTC SVGCTVDG+ P D+  +I DGEVEI
Sbjct  120  SMARKLSGTVKEILGTCQSVGCTVDGQPPHDIIDKIDDGEVEI  162



>gb|ABK94455.1| unknown [Populus trichocarpa]
Length=166

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V+VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
Sbjct  1    MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQAKV+VVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM  R
Sbjct  61   VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMSVR  120

Query  300  SMAKDLTGSVKEI  262
            SMAKDL+G+VKEI
Sbjct  121  SMAKDLSGTVKEI  133



>ref|XP_003382502.1| PREDICTED: 60S ribosomal protein L12-like [Amphimedon queenslandica]
 ref|XP_011408962.1| PREDICTED: 60S ribosomal protein L12-like [Amphimedon queenslandica]
Length=165

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +++ V++RV GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T  DWKGLR+T
Sbjct  1    MPPKFDPNEIITVYLRVVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATG-DWKGLRIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL VQNRQAK+ VVPSAAAL+IKALKEP RDRKK KNIKH+GNI+++ VIEIAK MRPR
Sbjct  60   VKLVVQNRQAKIEVVPSAAALIIKALKEPPRDRKKVKNIKHSGNITMEQVIEIAKTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L+G+V+EILGTC SVGCTVDG  P D   EI  G + IP++
Sbjct  120  SMSRYLSGTVREILGTCQSVGCTVDGSHPHDKIDEIKSGAITIPEE  165



>gb|EPB83569.1| 60S ribosomal protein L12 [Mucor circinelloides f. circinelloides 
1006PhL]
 gb|EPB88499.1| 60S ribosomal protein L12 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=165

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA+VSVVPSA++LVIKALKEP RDRKK KNIKH+GN++L+D+IEIA+ MR +
Sbjct  60   VQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIKHSGNVALEDIIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S+A++L+G+VKEILGT  SVGCTVDG++PKDL   I  GEVEIP
Sbjct  120  SLARELSGTVKEILGTAFSVGCTVDGQNPKDLCAAIDAGEVEIP  163



>dbj|GAN08145.1| 60S ribosomal protein L12 [Mucor ambiguus]
Length=175

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA+VSVVPSA++LVIKALKEP RDRKK KNIKH+GN++L+D+IEIA+ MR +
Sbjct  60   VQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIKHSGNVALEDIIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S+A++L+G+VKEILGT  SVGCTVDG++PKDL   I  GEVEIP
Sbjct  120  SLARELSGTVKEILGTAFSVGCTVDGQNPKDLCAAIDAGEVEIP  163



>gb|EPB84410.1| 60S ribosomal protein L12 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=166

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA+VSVVPSA++LVIKALKEP RDRKK KNIKH+GN++L+D+IEIA+ MR +
Sbjct  60   VQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIKHSGNVALEDIIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S+A++L+G+VKEILGT  SVGCTVDG++PKDL   I  GEVEIP
Sbjct  120  SLARELSGTVKEILGTAFSVGCTVDGQNPKDLCAAIDAGEVEIP  163



>ref|XP_002741477.1| PREDICTED: 60S ribosomal protein L12-like [Saccoglossus kowalevskii]
Length=165

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT + EVF+RVTGGEVGA SSLAPKIGPLGLSPKK+G+DI K T  DWKGLR+T
Sbjct  1    MPPKFDPTAITEVFLRVTGGEVGATSSLAPKIGPLGLSPKKVGDDICKATG-DWKGLRIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL +QNRQAKV VVPSA++LVIKALKEP RDRKK KNI H+GN+SL+ VIEIA++MRPR
Sbjct  60   VKLIIQNRQAKVEVVPSASSLVIKALKEPPRDRKKQKNIIHSGNVSLEQVIEIARIMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA+ L+G+VKEILGT  SVGCTV+GK P D+ + I +G+ EIP++
Sbjct  120  SMARQLSGTVKEILGTAQSVGCTVEGKHPHDVIEGIDEGDYEIPEE  165



>ref|XP_001642047.1| predicted protein [Nematostella vectensis]
 gb|EDO49984.1| predicted protein [Nematostella vectensis]
Length=166

 Score =   249 bits (637),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++  V++R TGGEVGA +SLAPKIGPLGLSPKK+G+DIAK T +DWKGL++T
Sbjct  1    MPPKFDPNEIQYVYLRCTGGEVGATASLAPKIGPLGLSPKKVGDDIAKAT-QDWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQAKVSVVPSA++L+IKALKEP RDRKK KNIKHNGNI+LDDV  +AKVMRPR
Sbjct  60   VCLTIQNRQAKVSVVPSASSLIIKALKEPPRDRKKVKNIKHNGNITLDDVTNVAKVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMA+ L+G+VKEILGTC SVGCTVDG  P D+  +I  GE+EI
Sbjct  120  SMARHLSGTVKEILGTCQSVGCTVDGMAPHDVIDKINSGEIEI  162



>emb|CBY39335.1| unnamed protein product [Oikopleura dioica]
 emb|CBY13122.1| unnamed protein product [Oikopleura dioica]
Length=165

 Score =   249 bits (637),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT +VEV++RV GGEVGA S+LAPKIGPLGLSPKKIG+DI K TA DWKGL++T
Sbjct  1    MPPKFDPTAIVEVYLRVVGGEVGATSALAPKIGPLGLSPKKIGDDICKSTA-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA+VSVVPSA++++IKALKEP RDRKK KNI+HNGNI++DD+I  A+ MRPR
Sbjct  60   VKLTIQNRQAQVSVVPSASSIIIKALKEPIRDRKKVKNIQHNGNITMDDIISCARTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S A+DL+G+++EILGT  SVGCTVDG DP DL  +I  GE+++P
Sbjct  120  SGARDLSGTIREILGTAQSVGCTVDGSDPHDLIDQIKAGELDVP  163



>ref|XP_003403428.1| PREDICTED: 60S ribosomal protein L12-like [Bombus terrestris]
Length=165

 Score =   249 bits (637),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKIVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA ++VVPSAA+L+IKALKEP RDRKK KNIKHNGN+S DD+I IA+ MRPR
Sbjct  60   VQLTIQNRQATITVVPSAASLIIKALKEPPRDRKKQKNIKHNGNLSFDDIISIARSMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK L+G+VKEILGTC SVGCTVDGK P+D+ +EI DG++++P +
Sbjct  120  SVAKYLSGTVKEILGTCQSVGCTVDGKPPRDIIEEINDGKLQVPDE  165



>gb|ESA16310.1| hypothetical protein GLOINDRAFT_345643 [Rhizophagus irregularis 
DAOM 181602]
Length=165

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            M PK DP +V  +++R TGGEVGA+SSLAPKIGPLGL+PKK+GEDIAK TA DWKGLRVT
Sbjct  1    MAPKIDPNEVKIIYLRATGGEVGASSSLAPKIGPLGLAPKKVGEDIAKATA-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVPSA++L+I+ALKEP RDRKK KNIKH+GNISLD+VIEIA+ M P+
Sbjct  60   VKLTIQNRQAAVSVVPSASSLIIRALKEPPRDRKKEKNIKHSGNISLDEVIEIARQMHPK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S AK L G+VKEILGTC SVGCTVDG+ PKDL   +  GE+E+P +
Sbjct  120  SFAKSLKGTVKEILGTCNSVGCTVDGQSPKDLSDSVESGEIEVPDE  165



>sp|P50884.1|RL12_CHLRE RecName: Full=60S ribosomal protein L12, partial [Chlamydomonas 
reinhardtii]
 emb|CAA64626.1| 60S ribosomal protein L12 [Chlamydomonas reinhardtii]
Length=157

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  633  VVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQ  454
            VVEV VRVTGGEVG ASSLAPKIGPLGLSPKKIGEDIAKET KDWKGLR+TVKLTVQNRQ
Sbjct  1    VVEVCVRVTGGEVGDASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRITVKLTVQNRQ  60

Query  453  AKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPRSMAKDLTGS  274
            AK+SV+PSAAALVIKALKEP RDRKK KNIKH G++++ D+IEIA+VMRPRS AKDL   
Sbjct  61   AKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPRSCAKDLANG  120

Query  273  VKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
             KEILGT VSVGC VDGKDP+D+   I DG +EIP
Sbjct  121  CKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIP  155



>ref|XP_008556549.1| PREDICTED: 60S ribosomal protein L12 [Microplitis demolitor]
Length=165

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V +VF+R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKKVFLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+LVIKALKEP RDRKK KNIKH+GN+S+DD+I IA+ MRPR
Sbjct  60   VQLTIQNRQATISVVPSAASLVIKALKEPPRDRKKQKNIKHSGNLSIDDIIAIARTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SM++ L+G+VKEILGTC SVGCT++G+ P DL  +I  GE+EI
Sbjct  120  SMSRQLSGTVKEILGTCQSVGCTIEGRPPHDLIDDINAGEMEI  162



>gb|AEE63592.1| unknown [Dendroctonus ponderosae]
 gb|ENN80101.1| hypothetical protein YQE_03460, partial [Dendroctonus ponderosae]
 gb|ERL87607.1| hypothetical protein D910_04998 [Dendroctonus ponderosae]
Length=165

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK TA DWKGL++T
Sbjct  1    MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKGTA-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+L +QNRQA +SVVPSAA+++IKALKEP RDRKK KNIKH+GNIS DDV++IA+ MRPR
Sbjct  60   VQLKIQNRQATISVVPSAASMIIKALKEPPRDRKKQKNIKHSGNISFDDVVDIARQMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L+G+V+EILGT  SVGCT+DGK P D+  E+ DG +E+P++
Sbjct  120  SMAKNLSGTVREILGTAQSVGCTIDGKAPHDVIDEVNDGSIEVPEE  165



>gb|EFX76123.1| hypothetical protein DAPPUDRAFT_306294 [Daphnia pulex]
Length=165

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  +++R  GGE+GA SSLAPKIGPLGLSPKK+GEDIAK T +DWKGL++T
Sbjct  1    MPPKFDPSEVKIIYLRAVGGEIGATSSLAPKIGPLGLSPKKVGEDIAKGT-QDWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKHNGNI+ D+VI IA++MR R
Sbjct  60   VQLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKQKNIKHNGNITFDEVIAIARIMRTR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S ++ L G+VKEILGTC+SVGCT+DG+ P+D+   +A+GE+E+P++
Sbjct  120  SQSRYLIGTVKEILGTCMSVGCTIDGRTPRDVTDAVANGELEVPEE  165



>ref|XP_975530.1| PREDICTED: 60S ribosomal protein L12 [Tribolium castaneum]
 gb|EFA07030.1| hypothetical protein TcasGA2_TC010002 [Tribolium castaneum]
Length=165

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK TA DWKGL++T
Sbjct  1    MPPKFDPNEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKGTA-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+L +QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNI+LDDVI IA+ MRPR
Sbjct  60   VQLKIQNRQATISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNITLDDVISIARQMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L+G+VKE+LGT  SVGCT+DGK P D+  E+ DG VEIP++
Sbjct  120  SMAKNLSGTVKEVLGTAQSVGCTIDGKLPHDVIDEVNDGSVEIPEE  165



>ref|XP_001605642.1| PREDICTED: 60S ribosomal protein L12 [Nasonia vitripennis]
Length=165

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V +VF+R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKKVFLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GN+S D+++ IA+ MRPR
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKALKEPPRDRKKVKNIKHSGNLSFDEIVSIARAMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM+++L+G++KEILGTC SVGCTV+G+ P D+  EI  G+ E P++
Sbjct  120  SMSRELSGTIKEILGTCQSVGCTVEGRPPHDIIDEINSGDFETPEE  165



>ref|XP_011123623.1| hypothetical protein AOL_s00083g142 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX47634.1| hypothetical protein AOL_s00083g142 [Arthrobotrys oligospora 
ATCC 24927]
Length=165

 Score =   247 bits (631),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T +DWKGLRVT
Sbjct  1    MPPKFDPNEVKVIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKAT-QDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
             KLT+QNRQA VSVVP+A++LVIKALKEP RDRKK KNIKH  +I LD++IEIA+VMR +
Sbjct  60   CKLTIQNRQAAVSVVPTASSLVIKALKEPPRDRKKEKNIKHTKSIPLDEIIEIARVMRHK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S++K+L G+VKEILGT  SVGC VDGK PKD+Q+EI +GEVEIP++
Sbjct  120  SLSKELKGTVKEILGTAFSVGCKVDGKSPKDVQEEIDNGEVEIPEE  165



>emb|CEP08490.1| hypothetical protein [Parasitella parasitica]
Length=385

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  669  SATMPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGL  490
            ++ MPPKFDP++V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T KDWKGL
Sbjct  218  ASMMPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGL  276

Query  489  RVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVM  310
            RVTV+LT+QNRQA+VSVVPSA++LVIKALKEP RDRKK KNIKH+GN+SL+D+IEIA+ M
Sbjct  277  RVTVQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIKHSGNVSLEDIIEIARTM  336

Query  309  RPRSMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            R +S+A++L+G+VKEILGT  SVGCTVDG++PKDL   I  GEVEIP+
Sbjct  337  RFKSLARELSGTVKEILGTAFSVGCTVDGQNPKDLCAAIDAGEVEIPE  384



>gb|AAX62480.1| ribosomal protein L12 [Lysiphlebus testaceipes]
 gb|AAX62481.1| ribosomal protein L12 variant 1 [Lysiphlebus testaceipes]
Length=165

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V +VF+R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKKVFMRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+LVIKALKEP RDRKK KNIKH+GNI+ DDV+ IA+ MR R
Sbjct  60   VQLTIQNRQATISVVPSAASLVIKALKEPPRDRKKQKNIKHSGNITFDDVLSIARTMRER  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L+G+VKEILGT  SVGCTVDG+ P D+ ++I  GE+E+P++
Sbjct  120  SMSRKLSGTVKEILGTSQSVGCTVDGRAPHDIIEDIDSGEIEVPEE  165



>ref|XP_003695708.1| PREDICTED: 60S ribosomal protein L12-like isoform 1 [Apis florea]
 ref|XP_006572254.1| PREDICTED: 60S ribosomal protein L12 isoform X1 [Apis mellifera]
 ref|XP_006572255.1| PREDICTED: 60S ribosomal protein L12 isoform X2 [Apis mellifera]
 ref|XP_006617738.1| PREDICTED: 60S ribosomal protein L12-like isoform X1 [Apis dorsata]
 ref|XP_006617739.1| PREDICTED: 60S ribosomal protein L12-like isoform X2 [Apis dorsata]
Length=165

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IK+LKEP RDRK+ KNIKHNGN+S DD++ IA+ MRPR
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKSLKEPPRDRKRQKNIKHNGNLSFDDIVSIARSMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM+K L+G+VKEILGTC SVGCTV+G+ P+DL +EI  G++++P +
Sbjct  120  SMSKYLSGTVKEILGTCQSVGCTVEGRPPRDLIEEINGGKLQVPDE  165



>ref|XP_002425460.1| 60S ribosomal protein L12, putative [Pediculus humanus corporis]
 gb|EEB12722.1| 60S ribosomal protein L12, putative [Pediculus humanus corporis]
Length=165

 Score =   247 bits (630),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V+++  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK TA DWKGL++T
Sbjct  1    MPPKFDPTEVKTVYLKCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATA-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKHNGN+S D++++IAK MRPR
Sbjct  60   VCLTIQNRQATISVVPSAASLIIKALKEPPRDRKKVKNIKHNGNLSFDEIVQIAKTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L G+VKEILGTC SVGCTV+G+ P D+  +I  GE+EIP +
Sbjct  120  SMSRKLEGTVKEILGTCQSVGCTVEGRPPHDVIDQINGGEIEIPDE  165



>emb|CAJ17266.1| ribosomal protein L12e [Scarabaeus laticollis]
Length=165

 Score =   246 bits (629),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT++  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK TA DWKGL++T
Sbjct  1    MPPKFDPTEIKFVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKGTA-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+L +QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNIS+DD+I IAK MRPR
Sbjct  60   VQLKIQNRQATISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNISMDDIIAIAKQMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK L G+ KE+LGT  SVGCTVDGK+P D+  EI +G +E+P +
Sbjct  120  SMAKTLAGTCKEVLGTAQSVGCTVDGKNPHDVIDEINEGSIEVPNE  165



>ref|XP_002591842.1| hypothetical protein BRAFLDRAFT_125332 [Branchiostoma floridae]
 gb|EEN47853.1| hypothetical protein BRAFLDRAFT_125332 [Branchiostoma floridae]
Length=165

 Score =   246 bits (629),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT +  V++R TGGEVGA +SLAPKIGPLGLSPKK+G+DIAK T +DWKGLR+T
Sbjct  1    MPPKFDPTAITIVYLRATGGEVGATASLAPKIGPLGLSPKKVGDDIAKAT-QDWKGLRIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQAKVSVVPSA++L+IKALKEP RDRKK KNI HNGN+S DD++EIA+ MRPR
Sbjct  60   VQLTIQNRQAKVSVVPSASSLIIKALKEPPRDRKKQKNILHNGNVSFDDIVEIARQMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+A+ L G+VKEILGT  SVGCTVDG  P D+  +I +GE E+P++
Sbjct  120  SIARKLEGTVKEILGTAQSVGCTVDGMPPHDVIDKINEGEYEVPEE  165



>emb|CBN08622.1| ribosomal protein L12 [Microcosmus squamiger]
Length=166

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP  +  V++R TGGEVGA +SLAPKIGPLGLSPKK+G+DIAK T +DWKGLR+T
Sbjct  2    MPPKFDPAAIHVVYLRATGGEVGATASLAPKIGPLGLSPKKVGDDIAKAT-QDWKGLRIT  60

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVPSA++L+IKALKEP RDRKK KNIKH+GN+SL+++I+IAK MR R
Sbjct  61   VKLTIQNRQATVSVVPSASSLIIKALKEPPRDRKKVKNIKHSGNVSLEEIIDIAKTMRER  120

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA+ L G+VKEILGT  SVGCTV GK P D+ +EI DGE+EIP++
Sbjct  121  SMARKLEGTVKEILGTAQSVGCTVGGKPPHDVIEEINDGELEIPEE  166



>gb|EPY49867.1| 60S ribosomal protein/L12A [Schizosaccharomyces cryophilus OY26]
 gb|EPY49895.1| 60S ribosomal protein/L12A [Schizosaccharomyces cryophilus OY26]
Length=165

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  V +R  GGEV   S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPNEVKTVIMRAVGGEVAGGSTLAPKIGPLGLSPKKVGEDIAKAT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVPSA+ALVIKALKEP RDRKK K + H+GN+S+D++IE+A+ MR +
Sbjct  60   VKLTIQNRQAAVSVVPSASALVIKALKEPARDRKKDKGVVHSGNVSIDEIIEVARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AKDL+G+VKEILGT  SVGCTV+GK+P D+Q+EI  G++EIPQ+
Sbjct  120  SLAKDLSGTVKEILGTAFSVGCTVEGKNPHDVQKEIDSGDIEIPQE  165



>ref|XP_003695709.1| PREDICTED: 60S ribosomal protein L12-like isoform 2 [Apis florea]
Length=166

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IK+LKEP RDRK+ KNIKHNGN+S DD++ IA+ MRPR
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKSLKEPPRDRKRQKNIKHNGNLSFDDIVSIARSMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SM+K L+G+VKEILGTC SVGCTV+G+ P+DL +EI  G+++I
Sbjct  120  SMSKYLSGTVKEILGTCQSVGCTVEGRPPRDLIEEINGGKLQI  162



>gb|KDR08977.1| 60S ribosomal protein L12 [Zootermopsis nevadensis]
Length=165

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  VF+R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPSEVKVVFLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA +SV PSAA+L+IKALKEP RDRKK KNIKH+GN+S DDV+ IAK+MR R
Sbjct  60   VKLTIQNRQAAISVCPSAASLIIKALKEPPRDRKKQKNIKHSGNLSFDDVMSIAKMMRDR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ + G+VKEILGTC SVGCTV+GK P D+  +I  GE+E+P+D
Sbjct  120  SMSRKMEGTVKEILGTCQSVGCTVEGKLPHDVIDQINSGELEVPED  165



>gb|EPX71937.1| 60S ribosomal protein/L12A [Schizosaccharomyces octosporus yFS286]
 gb|EPX71964.1| 60S ribosomal protein/L12A [Schizosaccharomyces octosporus yFS286]
Length=165

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  V +R  GGEV   S+LAPKIGPLGLSPKK+GEDIAK T KDWKGLRVT
Sbjct  1    MPPKFDPNEVKTVIMRAVGGEVAGGSTLAPKIGPLGLSPKKVGEDIAKAT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVPSA+ALVIKALKEP RDRKK K + H+GN+S+D+++E+A+ MR +
Sbjct  60   VKLTIQNRQAAVSVVPSASALVIKALKEPARDRKKDKGVVHSGNVSIDEIVEVARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AKDL+G+VKEILGT  SVGCTV+GK+P D+Q+EI  G++EIPQ+
Sbjct  120  SLAKDLSGTVKEILGTAFSVGCTVEGKNPHDVQKEIDSGDIEIPQE  165



>ref|XP_001960698.1| GF11364 [Drosophila ananassae]
 gb|EDV37520.1| GF11364 [Drosophila ananassae]
Length=165

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNIS DD++ IA+VMRPR
Sbjct  60   VCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNISFDDILAIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L G+ KE+LGT  SVGCTVDGK P D+  E+ +G +E+P +
Sbjct  120  SMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE  165



>ref|XP_011335603.1| PREDICTED: 60S ribosomal protein L12 [Cerapachys biroi]
 gb|EZA56353.1| 60S ribosomal protein L12 [Cerapachys biroi]
Length=165

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IKALKEP RDRK+ KNIKH+GN+S DD++ IA+ MRPR
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKALKEPPRDRKRQKNIKHSGNLSFDDIVSIARSMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L G+VKEILGTC SVGCT++G+ P DL  +I  GE+E+P++
Sbjct  120  SMSRTLAGTVKEILGTCQSVGCTIEGRPPHDLIDDINAGELEVPEE  165



>gb|ETN62244.1| 60S ribosomal protein L12 [Anopheles darlingi]
Length=165

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPNEIKHVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATG-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L++KALKEP RDRKK KNIKHNGNI+ D+VI IA+VMRPR
Sbjct  60   VCLTIQNRQATISVVPSAASLIVKALKEPPRDRKKVKNIKHNGNITFDEVISIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L+G+ KE+LGT  SVGCT+DG+ P D+ ++I+ G +E+P +
Sbjct  120  SMARELSGTCKEVLGTAHSVGCTIDGRAPHDVIEDISSGAIEVPSE  165



>ref|XP_003706877.1| PREDICTED: 60S ribosomal protein L12 [Megachile rotundata]
Length=165

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +V++R  GGE+G  SSLAPKIGPLGLSPKK+G+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPNEIKKVYLRCVGGEIGTTSSLAPKIGPLGLSPKKVGDDIAKATT-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IKALKEP RDRK+ K+IKHNGN+S DD++ +A+ MRPR
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKALKEPPRDRKRQKDIKHNGNLSFDDILSVARTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM+K L+G+VKEILGTC SVGCTV+G+ P+DL ++I +GE+++P +
Sbjct  120  SMSKYLSGTVKEILGTCHSVGCTVEGRPPRDLIEDINNGELQVPDE  165



>ref|NP_001119643.1| ribosomal protein L12 [Acyrthosiphon pisum]
 gb|ABD76372.1| putative ribosomal protein L12e [Acyrthosiphon pisum]
 dbj|BAH70782.1| ACYPI000059 [Acyrthosiphon pisum]
Length=165

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V EV++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPSEVKEVYMRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNR A +SVVPSA++LVIKALKEP RDRKK KN+KHNGN++LD++I I++ MRPR
Sbjct  60   VKLTIQNRVATISVVPSASSLVIKALKEPPRDRKKVKNVKHNGNVTLDEIINISRTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA+ L G+VKEILG+  SVGCTVDGK+P D+ + I DG V IP++
Sbjct  120  SMARTLAGTVKEILGSAQSVGCTVDGKNPHDIIEGIDDGAVVIPEE  165



>gb|KFM82963.1| 60S ribosomal protein L12, partial [Stegodyphus mimosarum]
Length=165

 Score =   244 bits (623),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+++  V++RV GGEVGA SSLAPK+GPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPSEIKTVYLRVVGGEVGATSSLAPKVGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL +QNRQA++ VVPSAA+L+I+ALKEP RDRKK K++KHNGNI+ +D+I IA+ MRPR
Sbjct  60   VKLVIQNRQAQIEVVPSAASLLIRALKEPPRDRKKVKHVKHNGNITFEDIITIARTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA+ L+G+VKEILGT  SVGCT+DG  P+DL ++I  GE+E+P++
Sbjct  120  SMARKLSGTVKEILGTSQSVGCTIDGSHPQDLIKQIDSGELEVPEE  165



>gb|AAY54943.1| IP07888p [Drosophila melanogaster]
Length=307

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = -3

Query  696  PSLAACNSVSATMPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAK  517
            P L  C+S    MPPKFDPT+V  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK
Sbjct  131  PFLRDCSSQDTAMPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAK  190

Query  516  ETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLD  337
             T+ DWKGL++TV LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNI  +
Sbjct  191  ATS-DWKGLKITVCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFE  249

Query  336  DVIEIAKVMRPRSMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            D++ IA+VMRPRSMA++L G+ KE+LGT  SVGCTVDGK P D+  E+ +G +E+P +
Sbjct  250  DILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE  307



>ref|XP_319222.2| AGAP010065-PA [Anopheles gambiae str. PEST]
 gb|EAA13967.2| AGAP010065-PA [Anopheles gambiae str. PEST]
Length=165

 Score =   244 bits (623),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPNEVKHVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATG-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L++KALKEP RDRKK KNIKHNGNI+ D+VI IA+VMRPR
Sbjct  60   VCLTIQNRQAAISVVPSAASLIVKALKEPPRDRKKVKNIKHNGNITFDEVINIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L G+ KE+LGT  SVGCT+DG+ P D+  +I+ G +EIP +
Sbjct  120  SMARELAGTCKEVLGTAQSVGCTIDGRSPHDVIDDISSGAIEIPSE  165



>gb|ACY71245.1| ribosomal protein L12 [Chrysomela tremula]
Length=165

 Score =   244 bits (622),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK TA DWKGL++T
Sbjct  1    MPPKFDPNEVKYVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKGTA-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+L +QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKHNGNIS DD++ IA+ MRPR
Sbjct  60   VQLKIQNRQATISVVPSAASLIIKALKEPPRDRKKQKNIKHNGNISFDDILSIARQMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L+G+VKE+LGT  SVGCT+DGK   DL  EI +  +EIP++
Sbjct  120  SMAKNLSGTVKEVLGTAQSVGCTIDGKAAHDLIDEIKNDSLEIPEE  165



>ref|XP_011311827.1| PREDICTED: 60S ribosomal protein L12 [Fopius arisanus]
Length=165

 Score =   243 bits (621),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V +V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEVKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GN+S +DV+ IA+ M+PR
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNLSFEDVLAIARAMKPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L+G+VKEILGTC SVGCT++G+ P D+  ++  GEVE+P++
Sbjct  120  SMSRQLSGTVKEILGTCQSVGCTIEGRPPHDVIDDVNSGEVEVPEE  165



>emb|CAJ17264.1| ribosomal protein L12e [Biphyllus lunatus]
Length=165

 Score =   243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKYVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKGTS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+L +QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNI+ DD+I IA+ MRPR
Sbjct  60   VQLKIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNITFDDIIAIARQMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK L+G+VKE+LGT  SVGCT+DGK P D+  E+ +G V++P++
Sbjct  120  SMAKALSGTVKEVLGTAQSVGCTIDGKAPHDVIDEVNEGAVDVPEE  165



>ref|XP_011134856.1| PREDICTED: 60S ribosomal protein L12 [Harpegnathos saltator]
 gb|EFN87561.1| 60S ribosomal protein L12 [Harpegnathos saltator]
Length=165

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IKALKEP RDRK+ KNIKH+GN+S DD++ IA+ MR R
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKALKEPPRDRKRQKNIKHSGNLSFDDIVTIARAMRSR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L+G+VKEILGTC SVGCTV+G+ P DL  +I  GE+E+P++
Sbjct  120  SMSRTLSGTVKEILGTCQSVGCTVEGRPPHDLIDDINAGELEVPEE  165



>gb|KFB44942.1| 60S ribosomal protein L12 [Anopheles sinensis]
Length=165

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPNEIKQVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATG-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L++KALKEP RDRKK KNIKHNGNI+ D+VI IA+VMRPR
Sbjct  60   VCLTIQNRQATISVVPSAASLIVKALKEPPRDRKKVKNIKHNGNITFDEVISIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L+G+ KE+LGT  SVGCT+DG+ P D+ ++I+ G +E P +
Sbjct  120  SMARELSGTCKEVLGTAHSVGCTIDGRAPHDVIEDISSGAIECPSE  165



>ref|XP_002005849.1| GI18857 [Drosophila mojavensis]
 gb|EDW09784.1| GI18857 [Drosophila mojavensis]
Length=165

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNIS DD++ IA+ MRPR
Sbjct  60   VCLTIQNRQATISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNISFDDILAIARTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L G+ KE+LGT  SVGCTVDGK P D+  EI +G +E+P +
Sbjct  120  SMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDEINNGTMEVPAE  165



>ref|XP_002049983.1| GJ20445 [Drosophila virilis]
 gb|EDW61176.1| GJ20445 [Drosophila virilis]
Length=165

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNIS DD++ IA+ MRPR
Sbjct  60   VCLTIQNRQATISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNISFDDILAIARTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L G+ KE+LGT  SVGCTVDGK P D+  E+ +G +E+P +
Sbjct  120  SMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNNGSIEVPAE  165



>gb|AIW62640.1| ribosomal protein L12 [Scytodes thoracica]
Length=165

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++  V++RV GGEVGA SSLAPK+GPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKTVYLRVVGGEVGATSSLAPKVGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKL +QNRQA++ VVPSAA+L+IKALKEP RDRKK K++K +GN+S DD++ IAK MRPR
Sbjct  60   VKLVIQNRQAQIEVVPSAASLIIKALKEPPRDRKKVKHVKXSGNLSFDDILTIAKTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA+ L+G+VKEILGT  SVGCT+DG  P DL Q+I +GE+E+P++
Sbjct  120  SMARHLSGTVKEILGTAQSVGCTIDGNQPHDLIQQIDNGEMEVPEE  165



>ref|XP_001865531.1| 60S ribosomal protein L12 [Culex quinquefasciatus]
 gb|EDS41859.1| 60S ribosomal protein L12 [Culex quinquefasciatus]
Length=165

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT++  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPTEIKHVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATG-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L++KALKEP RDRKK KNIKHNGNI+ D+VI IA+VMRPR
Sbjct  60   VCLTIQNRQAAISVVPSAASLIVKALKEPPRDRKKVKNIKHNGNITFDEVISIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L+G+ KE+LGT  SVGCT+DG+ P D+  +I  G +E P +
Sbjct  120  SMARELSGTCKEVLGTAHSVGCTIDGRAPHDVIDDINSGAIECPAE  165



>ref|XP_005705340.1| 60S ribosomal protein L12e [Galdieria sulphuraria]
 gb|EME28820.1| 60S ribosomal protein L12e [Galdieria sulphuraria]
Length=174

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP  +  ++VRVTGGEVGA SSLAPKIGPLGLSPKKIGE IA+ T KDWKGL+V 
Sbjct  1    MPPKFDPNAIHVIYVRVTGGEVGAVSSLAPKIGPLGLSPKKIGEQIAQAT-KDWKGLKVM  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLTVQNRQA  +VVPSAA+L+IKALKEPERDRKK KNIKHNGN+ LD+VI++AK MR R
Sbjct  60   VKLTVQNRQATATVVPSAASLLIKALKEPERDRKKVKNIKHNGNLPLDEVIKVAKAMRAR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMAK ++G+VKEILGT  SVGCTVDG  P D+ Q+I   E+EI
Sbjct  120  SMAKRMSGTVKEILGTAHSVGCTVDGMHPHDVIQKIDANEIEI  162



>emb|CAJ82729.1| 60s ribosomal protien rpl12 prov protein [Xenopus (Silurana) 
tropicalis]
Length=165

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT++  VF+R TGGEVGA S+LAPKIGPLGLSPKK+G+DIAK T  DWKGLR+T
Sbjct  1    MPPKFDPTEIKVVFLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATG-DWKGLRIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA++ VVPSA+AL+IKALKEP RDRKK KNIKHNGNIS+D+VI IA+ MR R
Sbjct  60   VKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHNGNISMDEVISIARQMRHR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S+A++L+G++KEILGT  SVGC VDG+ P D+  +I  G VE P
Sbjct  120  SLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECP  163



>gb|ABI83774.1| ribosomal protein L12 [Anopheles funestus]
Length=165

 Score =   242 bits (618),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPNEIKHVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATG-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L++KALKEP RDRKK KNIKHNGNI+ D+VI IA+VMRPR
Sbjct  60   VCLTIQNRQAAISVVPSAASLIVKALKEPPRDRKKVKNIKHNGNITFDEVINIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L+G+ KE+LGT  SVGCT+DG+ P ++  +I+ G +E+P +
Sbjct  120  SMARELSGTCKEVLGTAQSVGCTIDGRSPHEVIDDISSGAIEVPSE  165



>ref|XP_007149604.1| hypothetical protein PHAVU_005G083600g [Phaseolus vulgaris]
 gb|ESW21598.1| hypothetical protein PHAVU_005G083600g [Phaseolus vulgaris]
Length=150

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 135/164 (82%), Gaps = 16/164 (10%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP+QVV+V +RVTGGEVG ASSLAPKIGP                  DWKGLR+T
Sbjct  1    MPPKFDPSQVVDVIIRVTGGEVGTASSLAPKIGP----------------RLDWKGLRMT  44

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            +KLTVQN QAKV+VV SAAALVI ALKEPERDRKK KN+KHNGNI+LDDVIEI +VMR  
Sbjct  45   MKLTVQNHQAKVTVVHSAAALVINALKEPERDRKKNKNVKHNGNIALDDVIEIVRVMRSH  104

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAKDL+ S+KEIL TCVSVGCTVDGKDPKDLQQEI+DG++E+P
Sbjct  105  SMAKDLSRSIKEILRTCVSVGCTVDGKDPKDLQQEISDGDIEVP  148



>ref|XP_002840383.1| 60S ribosomal protein L12 [Tuber melanosporum Mel28]
 emb|CAZ84574.1| unnamed protein product [Tuber melanosporum]
Length=189

 Score =   243 bits (620),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -3

Query  699  NPSLAACNSVSATMPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIA  520
             P+    +  S  MPPKFDP++V  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIA
Sbjct  12   TPNTQLPHQKSVAMPPKFDPSEVKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIA  71

Query  519  KETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISL  340
            K T  DWKGLRVTVKLT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH  +I L
Sbjct  72   KATG-DWKGLRVTVKLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHTKSIPL  130

Query  339  DDVIEIAKVMRPRSMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            D++IEIA+ MR +S+A++L G+VKEILGT  SVGC VDG+ PKD+  +I+ GE+EIP +
Sbjct  131  DEIIEIARTMRFKSLARELKGTVKEILGTAYSVGCQVDGRSPKDVSDDISSGEIEIPDE  189



>ref|XP_001802348.1| hypothetical protein SNOG_12114 [Phaeosphaeria nodorum SN15]
 gb|EAT80526.1| hypothetical protein SNOG_12114 [Phaeosphaeria nodorum SN15]
Length=165

 Score =   242 bits (617),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKFDPSEVKVIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH  +I LD++I IA+ MR +
Sbjct  60   VKLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHTKSIPLDEIISIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGT  S GC VDG+ PKD+  +I  GE+EIP++
Sbjct  120  SMAKDLKGTVKEILGTAFSTGCQVDGRSPKDISDDIESGEIEIPEE  165



>ref|XP_001364951.2| PREDICTED: 60S ribosomal protein L12 [Monodelphis domestica]
Length=165

 Score =   242 bits (617),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++  VF+R TGGEVGA S+LAPKIGPLGLSPKK+G+DIAK T  DWKGLR+T
Sbjct  1    MPPKFDPNEIKVVFLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATG-DWKGLRIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA++ VVPSA+AL+IKALKEP RDRKK KNIKHNGNISLD++I IA+ MR R
Sbjct  60   VKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHNGNISLDEIINIARQMRHR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            S+A+DL+G++KEILGT  SVGC +DG+ P D+  +I  G VE P
Sbjct  120  SLARDLSGTIKEILGTAQSVGCNIDGRHPHDVIDDINSGAVECP  163



>gb|KFY27378.1| hypothetical protein V493_03530 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
 gb|KFY58832.1| hypothetical protein V496_05928 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY92993.1| hypothetical protein V498_04610 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=165

 Score =   242 bits (617),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPT++  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKVDPTEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I+LD+VIEIA+ MR +
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSITLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK L G+VKEILGT  SVGC VDG+ PKD+  +I  GE+EIP++
Sbjct  120  SMAKSLQGTVKEILGTAFSVGCQVDGRSPKDISDDIESGEIEIPEE  165



>ref|XP_011561160.1| PREDICTED: 60S ribosomal protein L12 [Plutella xylostella]
Length=164

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPNEVKIVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATG-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SV PSAA+LVIKALKEP RDRKK KNIKHNGNI++++VI IAKVMRPR
Sbjct  60   VQLTIQNRQATISVCPSAASLVIKALKEPPRDRKKQKNIKHNGNITMEEVISIAKVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEI  172
            SMA++L+G+VKE+LGTC SVGCT+DG+ P D+  +I  G V +
Sbjct  120  SMARELSGTVKEVLGTCQSVGCTIDGRAPHDIIDDINSGAVTV  162



>ref|XP_011056487.1| PREDICTED: 60S ribosomal protein L12 [Acromyrmex echinatior]
 ref|XP_011881536.1| PREDICTED: 60S ribosomal protein L12 [Vollenhovia emeryi]
 ref|XP_012060998.1| PREDICTED: 60S ribosomal protein L12 [Atta cephalotes]
 gb|EGI64178.1| 60S ribosomal protein L12 [Acromyrmex echinatior]
Length=165

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +VF+R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKKVFLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IKALKEP RDRK+ KNIKH+GN++ DD++ IA+ MR R
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKALKEPPRDRKRQKNIKHSGNLTFDDIVSIARAMRSR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L G+VKEILGTC SVGCTV+G+ P DL  +I  GE+E+P++
Sbjct  120  SMSRTLGGTVKEILGTCQSVGCTVEGRPPHDLIDDINAGELEVPEE  165



>gb|KFY16547.1| hypothetical protein V492_01265 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY34204.1| hypothetical protein V494_06958 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=165

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPT++  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKVDPTEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I+LD+VIEIA+ MR +
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSITLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L+G+VKEILGT  SVGC VDG+ PKD+  +I  GE+EIP++
Sbjct  120  SLAKELSGTVKEILGTAFSVGCQVDGRSPKDVSDDIESGEIEIPEE  165



>gb|ELR06397.1| 60S ribosomal protein L12 [Pseudogymnoascus destructans 20631-21]
 gb|KFY85368.1| hypothetical protein V500_08466 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFZ17523.1| hypothetical protein V502_04547 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=165

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPT++  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKVDPTEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I+LD+VIEIA+ MR +
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSITLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK L G+VKEILGT  SVGC VDG+ PKD+  +I  GE+EIP++
Sbjct  120  SMAKSLQGTVKEILGTAFSVGCQVDGRSPKDVSDDIESGEIEIPEE  165



>ref|XP_003108385.1| CRE-RPL-12 protein [Caenorhabditis remanei]
 gb|EFO93185.1| CRE-RPL-12 protein [Caenorhabditis remanei]
 gb|EGT37153.1| CBN-RPL-12 protein [Caenorhabditis brenneri]
Length=165

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT++  V++R  GGEVGA S+LAPK+GPLGLSPKKIGEDIAK T +DWKGL+VT
Sbjct  1    MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKAT-QDWKGLKVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
             KLT+QNR AK+ VVPSAA+L++K LKEP RDRKK KN+KHNG++++D +I+IA++MRPR
Sbjct  60   CKLTIQNRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVKHNGDLTIDTIIKIARIMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK L G+VKEILGT  SVGCT+DG+ P D+ + IA+GEVEIP
Sbjct  120  SMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEVEIP  163



>gb|EHK49773.1| hypothetical protein TRIATDRAFT_297636 [Trichoderma atroviride 
IMI 206040]
Length=165

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKFDPSEVKVIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVP+A++L+IKALKEP RDRKK KNIKHN +I++D+VIEIA+ MR +
Sbjct  60   VKLTIQNRQAAVSVVPTASSLIIKALKEPPRDRKKEKNIKHNKSIAIDEVIEIARTMRYK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S AKDL GSVKEILGT  SVGC VDGK P+ + + I +GE+EIP++
Sbjct  120  SFAKDLKGSVKEILGTAYSVGCQVDGKPPQSVIEAIDNGEIEIPEE  165



>ref|NP_524819.1| ribosomal protein L12, isoform A [Drosophila melanogaster]
 ref|NP_726412.1| ribosomal protein L12, isoform B [Drosophila melanogaster]
 ref|NP_726413.1| ribosomal protein L12, isoform C [Drosophila melanogaster]
 ref|XP_001976541.1| GG22931 [Drosophila erecta]
 ref|XP_002037500.1| GM18298 [Drosophila sechellia]
 ref|XP_002092759.1| RpL12 [Drosophila yakuba]
 ref|XP_002082917.1| GD11830 [Drosophila simulans]
 pdb|3J39|K Chain K, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 gb|AAF47152.1| ribosomal protein L12, isoform C [Drosophila melanogaster]
 gb|AAL48868.1| RE28824p [Drosophila melanogaster]
 gb|AAM68298.1| ribosomal protein L12, isoform A [Drosophila melanogaster]
 gb|AAM68299.1| ribosomal protein L12, isoform B [Drosophila melanogaster]
 gb|AAR09834.1| similar to Drosophila melanogaster CG3195, partial [Drosophila 
yakuba]
 gb|EDV56941.1| GG22931 [Drosophila erecta]
 gb|EDW53918.1| GM18298 [Drosophila sechellia]
 gb|EDW92471.1| RpL12 [Drosophila yakuba]
 gb|EDX08502.1| GD11830 [Drosophila simulans]
 gb|ACL92614.1| RpL12-PA, partial [synthetic construct]
Length=165

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNI  +D++ IA+VMRPR
Sbjct  60   VCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L G+ KE+LGT  SVGCTVDGK P D+  E+ +G +E+P +
Sbjct  120  SMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE  165



>ref|XP_001647834.1| AAEL014562-PA [Aedes aegypti]
 gb|ABF18141.1| 40S ribosomal protein S2 [Aedes aegypti]
 gb|EAT32502.1| AAEL014562-PA [Aedes aegypti]
Length=165

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++  V++R  GGEVGA SSLAPKIGPLGLSPKKIG+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPNEIKHVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATG-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L++KALKEP RDRKK KNIKHNGNI+ D+VI IA+VMRPR
Sbjct  60   VCLTIQNRQAAISVVPSAASLIVKALKEPPRDRKKVKNIKHNGNITFDEVISIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L+G+ KE+LGT  SVGCT+DG+ P D+  +I  G +E P +
Sbjct  120  SMARELSGTCKEVLGTAHSVGCTIDGRSPSDVIDDINSGAIECPAE  165



>emb|CCX29538.1| Similar to 60S ribosomal protein L12; acc. no. Q9C285 [Pyronema 
omphalodes CBS 100304]
Length=165

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  +++R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKFDPSEVKVIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+L +QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH  ++SLD++IEIA+ MR +
Sbjct  60   VQLRIQNRQATVSVVPSASSLVIKALKEPPRDRKKEKNIKHTKSVSLDEIIEIARTMRHK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+A++L G+VKEILGT  SVGC VDG+ PKD+  +I  GE+EIP++
Sbjct  120  SLARELKGTVKEILGTAFSVGCQVDGRSPKDISDDIEAGEIEIPEN  165



>gb|KFY13744.1| hypothetical protein V491_06309 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=165

 Score =   241 bits (615),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPT++  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKVDPTEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I+LD+VIEIA+ MR +
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSITLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L G+VKEILGT  SVGC VDG+ PKD+  +I +GE+EIP++
Sbjct  120  SLAKELQGTVKEILGTAFSVGCQVDGRSPKDVSDDIENGEIEIPEE  165



>gb|ESZ91150.1| hypothetical protein SBOR_8461 [Sclerotinia borealis F-4157]
Length=165

 Score =   241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPT++  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKLDPTEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I+LD+VIEIA+ MR +
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSITLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L G+VKEILGT  SVGC VDG+ PKD+  +I  GE+EIP +
Sbjct  120  SLAKELKGTVKEILGTAFSVGCQVDGRSPKDISDDIESGEIEIPSE  165



>ref|XP_002792305.1| 60S ribosomal protein L12 [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH16080.2| 60S ribosomal protein L12 [Paracoccidioides brasiliensis Pb03]
Length=165

 Score =   241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  + +R TGGEVGA S+LAPKIGPLGLSPKKIGEDIAK T  DWKGLRVT
Sbjct  1    MPPKFDPNEVKIIHLRTTGGEVGAQSALAPKIGPLGLSPKKIGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA+VSVVPSA++LVIKALKEP RDRKK KNIKH  +I LD++IEIA+VMR R
Sbjct  60   VKLTIQNRQAQVSVVPSASSLVIKALKEPPRDRKKEKNIKHTKSIPLDEIIEIARVMRSR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L G+V EILGT  SVGC VDG+ PKD+  E+  GE++IP +
Sbjct  120  SLAKELKGTVLEILGTAFSVGCQVDGRSPKDISDEVKAGEIDIPSE  165



>ref|XP_001360891.1| GA16582 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002016579.1| GL11659 [Drosophila persimilis]
 gb|EAL25466.1| GA16582 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW32469.1| GL11659 [Drosophila persimilis]
Length=165

 Score =   241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPTEVKLVYMRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNI+ +D++ IA+ MRPR
Sbjct  60   VCLTIQNRQATISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIAFEDILAIARTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L G+ KE+LGT  SVGCTVDGK P D+  E+ DG +E+P +
Sbjct  120  SMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNDGSLEVPAE  165



>dbj|BAF98659.1| ribosomal protein L12 [Solea senegalensis]
Length=165

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R TGGEVGA S+LAPKIGPLGLSPKK+G+DIAK T  DWKGLR+T
Sbjct  1    MPPKFDPTEVKIVYMRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATG-DWKGLRIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA V VVPSA+ALVIKALKEP RDRKK KNIKH+G+++ D+++ IA+VMRPR
Sbjct  60   VKLTIQNRQAAVEVVPSASALVIKALKEPPRDRKKVKNIKHSGSVTFDEIVGIARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+A++L+G++KEILGT  SVGCT+DG+ P D+  +I  G+VE P D
Sbjct  120  SIARELSGTIKEILGTAQSVGCTIDGRPPHDVIDDINSGKVECPSD  165



>gb|KFY72814.1| hypothetical protein V499_07078 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFZ08409.1| hypothetical protein V501_05994 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=165

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPT++  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKVDPTEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I+LD+VIEIA+ MR +
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSITLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK L+G+VKEILGT  SVGC VDG+ PKD+  +I  GE+EIP++
Sbjct  120  SLAKTLSGTVKEILGTAFSVGCQVDGRSPKDVSDDIESGEIEIPEE  165



>gb|KFX98364.1| hypothetical protein V490_02360 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFY03708.1| hypothetical protein O988_01283 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY37076.1| hypothetical protein V495_07408 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY56539.1| hypothetical protein V497_06182 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=165

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPK DPT++  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKVDPTEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I+LD+VIEIA+ MR +
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSITLDEVIEIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L G+VKEILGT  SVGC VDG+ PKD+  +I  GE+EIP++
Sbjct  120  SLAKELQGTVKEILGTAFSVGCQVDGRSPKDVSDDIESGEIEIPEE  165



>ref|NP_502542.1| Protein RPL-12, isoform a [Caenorhabditis elegans]
 ref|XP_002634236.1| C. briggsae CBR-RPL-12 protein [Caenorhabditis briggsae]
 sp|P61865.1|RL12_CAEBR RecName: Full=60S ribosomal protein L12 [Caenorhabditis briggsae]
 sp|P61866.1|RL12_CAEEL RecName: Full=60S ribosomal protein L12 [Caenorhabditis elegans]
 gb|AAF65224.1|AF246691_1 ribosomal protein L12 [Caenorhabditis briggsae]
 emb|CAB05226.1| RPL-12, isoform a [Caenorhabditis elegans]
 emb|CAP22831.1| Protein CBR-RPL-12 [Caenorhabditis briggsae]
Length=165

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT++  V++R  GGEVGA S+LAPK+GPLGLSPKKIGEDIAK T +DWKGL+VT
Sbjct  1    MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKAT-QDWKGLKVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
             KLT+QNR AK+ VVPSAA+L++K LKEP RDRKK KN+KHNG++++D +I+IA++MRPR
Sbjct  60   CKLTIQNRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVKHNGDLTVDTIIKIARIMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIP  169
            SMAK L G+VKEILGT  SVGCT+DG+ P D+ + IA+GE+EIP
Sbjct  120  SMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEIP  163



>ref|XP_003841726.1| similar to 60S ribosomal protein L12 [Leptosphaeria maculans 
JN3]
 emb|CBX98247.1| similar to 60S ribosomal protein L12 [Leptosphaeria maculans 
JN3]
Length=170

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP++V  + +R TGGEVGA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGLRVT
Sbjct  1    MPPKFDPSEVKVIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH  ++ LD++I IA+ MR +
Sbjct  60   VKLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHTKSVPLDEIINIARTMRFK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAKDL G+VKEILGT  S GC VDG+ PKD+  +I  GE+EIP++
Sbjct  120  SMAKDLKGTVKEILGTAFSTGCQVDGRSPKDISDDIESGEIEIPEE  165



>ref|XP_001817789.1| 60S ribosomal protein L12 [Aspergillus oryzae RIB40]
 ref|XP_002372931.1| 60S ribosomal protein L12 [Aspergillus flavus NRRL3357]
 dbj|BAE55787.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED57319.1| 60S ribosomal protein L12 [Aspergillus flavus NRRL3357]
Length=165

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  + +RVTGGEVGA S+LAPKIGPLGLSPKKIGEDIAK T  DWKGLRVT
Sbjct  1    MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGEDIAKNTG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSA++LVIKALKEP RDRKK KNIKHN ++ LD++IEIA+ MR R
Sbjct  60   VRLTIQNRQAAISVVPSASSLVIKALKEPPRDRKKEKNIKHNKSVPLDEIIEIARKMRHR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L G+V EILGT  SVGC VDG+ PKD+  EI  GE++IP +
Sbjct  120  SLAKELQGTVLEILGTAFSVGCQVDGRSPKDISDEIKAGEIDIPSE  165



>ref|XP_002558757.1| Pc13g03190 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP91388.1| Pc13g03190 [Penicillium rubens Wisconsin 54-1255]
Length=165

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  + +RVTGGEVGA S+LAPKIGPLGLSPKKIGEDIAK T  DWKGLRVT
Sbjct  1    MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGEDIAKNTG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I +D++IEIA++MR R
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSIPMDEIIEIARIMRTR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G V EILGT  SVGC VDG+ PKD+  ++ +GE++IP++
Sbjct  120  SMAKELRGVVLEILGTAFSVGCQVDGRSPKDVSDDVKEGEIDIPEE  165



>gb|EWC46803.1| 60S ribosomal protein L12 [Drechslerella stenobrocha 248]
Length=165

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  +++R TGGE+GA+S+LAPKIGPLGLSPKK+GEDIAK T  DWKGL+VT
Sbjct  1    MPPKFDPNEVKVIYLRATGGEIGASSALAPKIGPLGLSPKKVGEDIAKATG-DWKGLKVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
             KLT+QNRQA VSVVP+A++LVI+ALKEP RDRKK KNIKH+ +I+LD++I+IA+ MR +
Sbjct  60   CKLTIQNRQAAVSVVPTASSLVIRALKEPPRDRKKEKNIKHSKSIALDEIIDIARQMRHK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+AK+L G+VKEILGT  SVGC VDG+ PKD+Q++I +GE+EIP++
Sbjct  120  SLAKELKGTVKEILGTAFSVGCKVDGQSPKDIQEQIDNGEIEIPEE  165



>emb|CDH53248.1| 60s ribosomal protein l12 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH50994.1| 60s ribosomal protein l12 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14467.1| Putative 60S ribosomal protein L12 [Absidia idahoensis var. thermophila]
 emb|CDS09399.1| Putative 60S ribosomal protein L12 [Absidia idahoensis var. thermophila]
Length=165

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  +++R TGGE+ A+S+LAPKIGPLGLSPKK+GEDI K T KDWKGLRVT
Sbjct  1    MPPKFDPNEVKIIYLRATGGELAASSALAPKIGPLGLSPKKVGEDIMKNT-KDWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            ++LT+QNRQA+V+VVPSA++LVIKALKEP RDRKK KNIKH GNI LD++IEIA+ MR +
Sbjct  60   IQLTIQNRQAQVAVVPSASSLVIKALKEPPRDRKKDKNIKHTGNIPLDEIIEIARTMRYK  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQ  166
            S A++L G+VKEILGT  SVGCTVDG+ PKDL   I  GEVEIP+
Sbjct  120  SFARELKGTVKEILGTANSVGCTVDGQSPKDLCDAIDAGEVEIPE  164



>ref|XP_011685510.1| PREDICTED: 60S ribosomal protein L12 [Wasmannia auropunctata]
Length=165

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IKALKEP RDRK+ KNIKH+GN++ DD++ IA+ MR R
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKALKEPPRDRKRQKNIKHSGNLTFDDIVSIARAMRSR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L G++KEILGTC SVGCTV+G+ P DL  +I  GE+E+P++
Sbjct  120  SMSRTLGGTIKEILGTCQSVGCTVEGRPPHDLIDDINAGELEVPEE  165



>gb|ADM64581.1| ribosomal protein L12 [Hypophthalmichthys nobilis]
Length=165

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT+V  V++R TGGEVGA SSLAPKIGPLGLSPKK+G+DIAK T  DWKGLR+T
Sbjct  1    MPPKFDPTEVKVVYMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATG-DWKGLRIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            VKLT+QNRQA + VVPSA+AL+IKALKEP RDRKK KNIKH+G+++ D++I +A+VMRPR
Sbjct  60   VKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVTFDEIINVARVMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            S+A++L+G++KEILGT  SVGCT+DG+ P D+  +I  G++E P +
Sbjct  120  SIARELSGTIKEILGTAQSVGCTIDGRPPHDVIDDINSGKIECPAE  165



>gb|EKV05219.1| 60S ribosomal protein L12 [Penicillium digitatum Pd1]
 gb|EKV13545.1| 60S ribosomal protein L12 [Penicillium digitatum PHI26]
 emb|CDM27116.1| 60S ribosomal protein L12 [Penicillium roqueforti FM164]
 gb|KGO39729.1| Ribosomal protein L11, C-terminal [Penicillium expansum]
 gb|KGO62729.1| Ribosomal protein L11, C-terminal [Penicillium expansum]
 gb|KGO65519.1| Ribosomal protein L11, C-terminal [Penicillium expansum]
 gb|KGO66241.1| Ribosomal protein L11, C-terminal [Penicillium italicum]
 gb|KJJ26268.1| Ribosomal protein L11 C-terminal [Penicillium solitum]
Length=165

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP +V  + +RVTGGEVGA S+LAPKIGPLGLSPKKIGEDIAK T  DWKGLRVT
Sbjct  1    MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGEDIAKNTG-DWKGLRVT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA VSVVPSA++LVIKALKEP RDRKK KNIKH+ +I +D++IEIA++MR R
Sbjct  60   VRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSIPMDEIIEIARIMRTR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMAK+L G V EILGT  SVGC VDG+ PKD+  ++  GE++IP++
Sbjct  120  SMAKELRGGVLEILGTAFSVGCQVDGRSPKDVSDDVKSGEIDIPEE  165



>ref|XP_011269459.1| PREDICTED: 60S ribosomal protein L12 [Camponotus floridanus]
 ref|XP_011639508.1| PREDICTED: 60S ribosomal protein L12 [Pogonomyrmex barbatus]
 ref|XP_011639509.1| PREDICTED: 60S ribosomal protein L12 [Pogonomyrmex barbatus]
 gb|EFN72686.1| 60S ribosomal protein L12 [Camponotus floridanus]
Length=165

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDP ++ +V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++T
Sbjct  1    MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V+LT+QNRQA +SVVPSAA+L+IKALKEP RDRK+ KNIKH+GN++ DD++ IA+ MR R
Sbjct  60   VQLTIQNRQATISVVPSAASLIIKALKEPPRDRKRQKNIKHSGNLTFDDIVSIARAMRSR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SM++ L+G+VKEILGTC SVGCTV+ + P DL  +I  GE+E+P++
Sbjct  120  SMSRTLSGTVKEILGTCQSVGCTVESRPPHDLIDDINAGELEVPEE  165



>ref|XP_011206105.1| PREDICTED: 60S ribosomal protein L12 [Bactrocera dorsalis]
Length=165

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  660  MPPKFDPTQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT  481
            MPPKFDPT++  V++R  GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T  DWKGL++T
Sbjct  1    MPPKFDPTEIKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATG-DWKGLKIT  59

Query  480  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIAKVMRPR  301
            V LT+QNRQA +SVVPSAA+L+IKALKEP RDRKK KNIKH+GNI+ DD++ +A+ MRPR
Sbjct  60   VCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNITFDDILSVARTMRPR  119

Query  300  SMAKDLTGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVEIPQD  163
            SMA++L G+ KEILGT  SVGCTVDG+ P D+  +I  G +EIP +
Sbjct  120  SMARNLEGTCKEILGTAQSVGCTVDGRPPHDIIDDINSGSIEIPSE  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1295251989378