BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5713

Length=1125
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364863.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    383   6e-128   Solanum tuberosum [potatoes]
emb|CDP01065.1|  unnamed protein product                                380   5e-127   Coffea canephora [robusta coffee]
ref|XP_004237917.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     379   2e-126   Solanum lycopersicum
ref|XP_009613129.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     376   2e-125   Nicotiana tomentosiformis
ref|XP_009778517.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    365   3e-121   Nicotiana sylvestris
gb|KDO80979.1|  hypothetical protein CISIN_1g020846mg                   364   1e-120   Citrus sinensis [apfelsine]
ref|XP_006472592.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    363   2e-120   Citrus sinensis [apfelsine]
ref|XP_006433972.1|  hypothetical protein CICLE_v10001862mg             361   2e-119   Citrus clementina [clementine]
ref|XP_004300651.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     360   5e-119   Fragaria vesca subsp. vesca
ref|XP_011016531.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     357   1e-117   Populus euphratica
ref|XP_008372920.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     354   7e-117   
gb|KDO80978.1|  hypothetical protein CISIN_1g020846mg                   353   1e-116   Citrus sinensis [apfelsine]
ref|XP_008383930.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     352   6e-116   Malus domestica [apple tree]
ref|XP_002302300.2|  thioredoxin-related family protein                 352   9e-116   
ref|XP_008343322.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     351   1e-115   
ref|XP_008219447.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     350   3e-115   Prunus mume [ume]
ref|XP_009372786.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     349   5e-115   Pyrus x bretschneideri [bai li]
ref|XP_002285788.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     349   1e-114   Vitis vinifera
ref|XP_007222969.1|  hypothetical protein PRUPE_ppa008937mg             348   1e-114   Prunus persica
ref|XP_009334329.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     348   2e-114   Pyrus x bretschneideri [bai li]
ref|XP_009334346.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     347   3e-114   Pyrus x bretschneideri [bai li]
ref|XP_007136256.1|  hypothetical protein PHAVU_009G031500g             340   3e-111   Phaseolus vulgaris [French bean]
gb|KHN03900.1|  5'-adenylylsulfate reductase-like 4                     339   7e-111   Glycine soja [wild soybean]
gb|KHN19767.1|  5'-adenylylsulfate reductase-like 4                     338   1e-110   Glycine soja [wild soybean]
ref|XP_006581537.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    337   5e-110   Glycine max [soybeans]
ref|XP_003522795.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    336   1e-109   
gb|KJB14728.1|  hypothetical protein B456_002G140600                    335   2e-109   Gossypium raimondii
ref|XP_009778518.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    333   5e-109   Nicotiana sylvestris
gb|KEH34942.1|  5-adenylylsulfate reductase-like protein                333   2e-108   Medicago truncatula
ref|XP_010676416.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     332   2e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011004793.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     331   1e-107   Populus euphratica
gb|KDP41389.1|  hypothetical protein JCGZ_15796                         329   6e-107   Jatropha curcas
ref|XP_012067882.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     329   6e-107   Jatropha curcas
ref|XP_010089873.1|  5'-adenylylsulfate reductase-like 4                354   8e-107   
ref|XP_007018757.1|  APR-like 4 isoform 1                               328   1e-106   
ref|XP_002513930.1|  conserved hypothetical protein                     328   1e-106   Ricinus communis
ref|XP_010267539.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     326   7e-106   Nelumbo nucifera [Indian lotus]
ref|XP_004500630.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    324   4e-105   
ref|XP_004500631.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    324   4e-105   
gb|KDO80980.1|  hypothetical protein CISIN_1g020846mg                   322   4e-105   Citrus sinensis [apfelsine]
ref|XP_002306572.2|  hypothetical protein POPTR_0005s17150g             324   7e-105   
ref|XP_004500632.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    322   4e-104   
gb|KJB64265.1|  hypothetical protein B456_010G039900                    320   3e-103   Gossypium raimondii
ref|XP_008444841.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     316   8e-102   Cucumis melo [Oriental melon]
ref|XP_007222968.1|  hypothetical protein PRUPE_ppa008937mg             311   3e-101   
ref|XP_011074264.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     314   3e-101   Sesamum indicum [beniseed]
ref|XP_004152636.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     314   5e-101   Cucumis sativus [cucumbers]
gb|KHN08939.1|  5'-adenylylsulfate reductase-like 4                     311   3e-100   Glycine soja [wild soybean]
ref|XP_007018758.1|  APR-like 4 isoform 2                               312   5e-100   
gb|KHG11609.1|  5'-adenylylsulfate reductase-like 4                     310   2e-99    Gossypium arboreum [tree cotton]
ref|NP_001240132.1|  uncharacterized protein LOC100796765 precursor     308   1e-98    Glycine max [soybeans]
gb|KHG10185.1|  5'-adenylylsulfate reductase-like 4                     300   2e-95    Gossypium arboreum [tree cotton]
ref|NP_564452.1|  5'-adenylylsulfate reductase-like 4                   299   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397424.1|  hypothetical protein EUTSA_v10001824mg             298   7e-95    Eutrema salsugineum [saltwater cress]
emb|CDX91762.1|  BnaC08g06810D                                          295   8e-94    
ref|XP_010060013.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     294   2e-93    Eucalyptus grandis [rose gum]
emb|CDY41863.1|  BnaA08g06360D                                          294   3e-93    Brassica napus [oilseed rape]
ref|XP_009107920.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     293   7e-93    Brassica rapa
ref|XP_006305413.1|  hypothetical protein CARUB_v10009812mg             292   9e-93    Capsella rubella
gb|KFK23381.1|  hypothetical protein AALP_AAs59400U000300               292   1e-92    Arabis alpina [alpine rockcress]
ref|XP_010269310.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     292   1e-92    Nelumbo nucifera [Indian lotus]
gb|KCW66535.1|  hypothetical protein EUGRSUZ_F00332                     290   1e-91    Eucalyptus grandis [rose gum]
gb|KHN19769.1|  5'-adenylylsulfate reductase-like 4                     290   1e-91    Glycine soja [wild soybean]
ref|XP_002893853.1|  hypothetical protein ARALYDRAFT_473651             289   1e-91    
gb|EYU36495.1|  hypothetical protein MIMGU_mgv1a0105141mg               285   1e-90    Erythranthe guttata [common monkey flower]
ref|XP_010538940.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     287   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_010478919.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     286   2e-90    Camelina sativa [gold-of-pleasure]
gb|ACU23635.1|  unknown                                                 286   3e-90    Glycine max [soybeans]
ref|XP_010939664.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3     285   8e-90    
ref|XP_010500009.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     283   4e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010461284.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     281   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_008790885.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3     275   6e-86    Phoenix dactylifera
ref|XP_010937429.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3     271   1e-84    Elaeis guineensis
ref|XP_008811170.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3     266   1e-82    Phoenix dactylifera
gb|KJB29322.1|  hypothetical protein B456_005G094200                    261   2e-81    Gossypium raimondii
ref|XP_002452534.1|  hypothetical protein SORBIDRAFT_04g027510          259   1e-79    Sorghum bicolor [broomcorn]
gb|ACG42026.1|  APRL3 - Zea mays adenosine 5'-phosphosulfate redu...    258   3e-79    Zea mays [maize]
ref|NP_001105765.1|  adenosine 5'-phosphosulfate reductase-like3 ...    258   4e-79    Zea mays [maize]
ref|XP_004953961.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    256   1e-78    
ref|XP_010421807.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6     255   2e-78    Camelina sativa [gold-of-pleasure]
ref|XP_004953962.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    254   9e-78    
gb|EAY87573.1|  hypothetical protein OsI_08985                          251   7e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_010436141.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6     251   8e-77    Camelina sativa [gold-of-pleasure]
ref|NP_001048159.1|  Os02g0754900                                       251   9e-77    
ref|XP_006397245.1|  hypothetical protein EUTSA_v10028636mg             256   1e-76    
ref|XP_009391309.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3     250   2e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001105802.1|  adenosine 5'-phosphosulfate reductase-like4 ...    249   8e-76    Zea mays [maize]
ref|XP_010455301.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6     248   1e-75    Camelina sativa [gold-of-pleasure]
emb|CDY54942.1|  BnaCnng27720D                                          246   4e-75    Brassica napus [oilseed rape]
ref|NP_001117412.1|  5'-adenylylsulfate reductase-like 4                246   4e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647922.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-adenylyls...    246   6e-75    Oryza brachyantha
ref|XP_002874503.1|  hypothetical protein ARALYDRAFT_911058             244   2e-74    Arabidopsis lyrata subsp. lyrata
ref|XP_003570613.2|  PREDICTED: probable pectin methyltransferase...    259   4e-74    
dbj|BAK05689.1|  predicted protein                                      243   1e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006288344.1|  hypothetical protein CARUB_v10001592mg             242   2e-73    Capsella rubella
gb|KFK32103.1|  hypothetical protein AALP_AA6G199200                    240   1e-72    Arabis alpina [alpine rockcress]
ref|NP_192632.2|  protein APR-like 6                                    239   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|KJB29321.1|  hypothetical protein B456_005G094200                    232   1e-70    Gossypium raimondii
gb|EPS62898.1|  hypothetical protein M569_11894                         233   5e-70    Genlisea aurea
emb|CDY28407.1|  BnaA05g18330D                                          229   5e-69    Brassica napus [oilseed rape]
ref|XP_010543933.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    227   1e-67    
ref|XP_009417587.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3     231   1e-67    
gb|AAD17368.1|  contains similarity to protein disulfide isomerases     224   3e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543943.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    218   6e-65    
ref|XP_008782161.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     217   2e-63    Phoenix dactylifera
gb|EMS61645.1|  putative pectin methyltransferase QUA2                  224   1e-62    Triticum urartu
gb|KHG08455.1|  5'-adenylylsulfate reductase-like 4                     210   1e-61    Gossypium arboreum [tree cotton]
gb|KDO80981.1|  hypothetical protein CISIN_1g020846mg                   204   2e-60    Citrus sinensis [apfelsine]
gb|ABK24398.1|  unknown                                                 200   5e-57    Picea sitchensis
gb|EEC80244.1|  hypothetical protein OsI_22194                          195   2e-55    Oryza sativa Indica Group [Indian rice]
ref|NP_001057172.1|  Os06g0220800                                       194   4e-55    
ref|XP_006656789.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    190   3e-53    Oryza brachyantha
gb|KJB29323.1|  hypothetical protein B456_005G094200                    184   2e-52    Gossypium raimondii
ref|XP_006853185.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3     185   7e-52    Amborella trichopoda
ref|XP_003574474.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    184   8e-52    Brachypodium distachyon [annual false brome]
ref|XP_004974687.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-adenylyls...    186   3e-51    
ref|XP_010235118.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    181   5e-51    Brachypodium distachyon [annual false brome]
gb|EEC83570.1|  hypothetical protein OsI_29227                          182   2e-50    Oryza sativa Indica Group [Indian rice]
sp|Q5DJV7.1|APRL4_ORYSJ  RecName: Full=5'-adenylylsulfate reducta...    181   3e-50    Oryza sativa Japonica Group [Japonica rice]
gb|EEE68672.1|  hypothetical protein OsJ_27290                          177   1e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660127.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    172   6e-48    Oryza brachyantha
gb|ADE77738.1|  unknown                                                 174   4e-47    Picea sitchensis
ref|XP_001762516.1|  predicted protein                                  167   4e-46    
ref|XP_002444324.1|  hypothetical protein SORBIDRAFT_07g020170          166   8e-45    Sorghum bicolor [broomcorn]
dbj|BAC99693.1|  disulfide isomerase-like protein                       167   1e-44    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105766.1|  adenosine 5'-phosphosulfate reductase-like5 ...    162   3e-43    Zea mays [maize]
ref|XP_011628789.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7     156   1e-40    
ref|XP_010455302.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6     147   1e-38    Camelina sativa [gold-of-pleasure]
dbj|BAE99715.1|  protein disulfide isomerase like protein               146   2e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981362.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    142   2e-35    Setaria italica
ref|XP_002466254.1|  hypothetical protein SORBIDRAFT_01g004420          140   6e-35    Sorghum bicolor [broomcorn]
ref|NP_001105807.1|  adenosine 5'-phosphosulfate reductase-like9 ...    140   2e-34    Zea mays [maize]
ref|NP_001175575.1|  Os08g0412401                                       134   3e-34    
ref|NP_001105768.1|  adenosine 5'-phosphosulfate reductase-like8 ...    139   4e-34    Zea mays [maize]
ref|NP_001281246.1|  APRL5 - Zea mays adenosine 5'-phosphosulfate...    138   5e-34    
gb|EYU31671.1|  hypothetical protein MIMGU_mgv1a010641mg                138   8e-34    Erythranthe guttata [common monkey flower]
ref|XP_006479121.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    137   9e-34    Citrus sinensis [apfelsine]
ref|XP_008813732.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     137   2e-33    Phoenix dactylifera
ref|XP_003564162.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     135   5e-33    Brachypodium distachyon [annual false brome]
gb|EMT06163.1|  hypothetical protein F775_28438                         134   9e-33    
ref|XP_004981363.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    135   9e-33    Setaria italica
ref|XP_006443434.1|  hypothetical protein CICLE_v100214292mg            132   2e-32    
ref|XP_002882315.1|  hypothetical protein ARALYDRAFT_477638             134   2e-32    
ref|XP_009353126.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     134   2e-32    Pyrus x bretschneideri [bai li]
ref|XP_003554021.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    133   3e-32    Glycine max [soybeans]
ref|XP_002276765.2|  PREDICTED: 5'-adenylylsulfate reductase-like 5     133   4e-32    Vitis vinifera
ref|XP_008644294.1|  PREDICTED: adenosine 5'-phosphosulfate reduc...    132   1e-31    Zea mays [maize]
ref|XP_010463851.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     132   1e-31    Camelina sativa [gold-of-pleasure]
ref|XP_009396929.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     131   3e-31    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923362.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     130   4e-31    Elaeis guineensis
gb|KJB26618.1|  hypothetical protein B456_004G250500                    130   4e-31    Gossypium raimondii
ref|XP_010257654.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     130   5e-31    Nelumbo nucifera [Indian lotus]
gb|AEK94318.1|  disulfide isomerase-related protein                     130   5e-31    Pyrus x bretschneideri [bai li]
ref|XP_010485745.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     129   8e-31    Camelina sativa [gold-of-pleasure]
ref|NP_566214.1|  5'-adenylylsulfate reductase-like 5                   129   8e-31    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011021471.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7     129   1e-30    Populus euphratica
ref|XP_008391699.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     129   1e-30    Malus domestica [apple tree]
ref|XP_008804329.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     129   2e-30    Phoenix dactylifera
ref|XP_010515215.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     128   2e-30    Camelina sativa [gold-of-pleasure]
ref|XP_009366461.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     128   3e-30    Pyrus x bretschneideri [bai li]
ref|XP_010054630.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    128   3e-30    Eucalyptus grandis [rose gum]
ref|XP_009620886.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     128   3e-30    Nicotiana tomentosiformis
gb|KJB46049.1|  hypothetical protein B456_007G345900                    127   4e-30    Gossypium raimondii
ref|XP_009408458.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     127   7e-30    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG25607.1|  5'-adenylylsulfate reductase-like 7                     127   8e-30    Gossypium arboreum [tree cotton]
gb|KJB44623.1|  hypothetical protein B456_007G261900                    127   8e-30    Gossypium raimondii
ref|XP_006408248.1|  hypothetical protein EUTSA_v10021238mg             125   2e-29    Eutrema salsugineum [saltwater cress]
ref|XP_009795826.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     125   2e-29    Nicotiana sylvestris
ref|XP_010934707.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     125   3e-29    Elaeis guineensis
ref|XP_002325842.1|  hypothetical protein POPTR_0019s05130g             125   3e-29    Populus trichocarpa [western balsam poplar]
ref|XP_007161953.1|  hypothetical protein PHAVU_001G1116001g            124   3e-29    Phaseolus vulgaris [French bean]
ref|XP_009130392.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     125   3e-29    Brassica rapa
emb|CDY50856.1|  BnaA05g37170D                                          125   4e-29    Brassica napus [oilseed rape]
ref|XP_011089720.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    124   5e-29    Sesamum indicum [beniseed]
gb|KFK37822.1|  hypothetical protein AALP_AA3G033700                    124   6e-29    Arabis alpina [alpine rockcress]
emb|CBI29948.3|  unnamed protein product                                123   6e-29    Vitis vinifera
ref|XP_010054638.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    123   7e-29    Eucalyptus grandis [rose gum]
gb|AAF00632.1|AC009540_9  unknown protein                               124   1e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350130.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-adenylyls...    123   1e-28    
gb|ACG38706.1|  APRL5 - Zea mays adenosine 5'-phosphosulfate redu...    122   1e-28    Zea mays [maize]
gb|ACU17922.1|  unknown                                                 118   2e-28    Glycine max [soybeans]
gb|AES75170.2|  5-adenylylsulfate reductase-like protein                123   2e-28    Medicago truncatula
emb|CDY64906.1|  BnaC05g47730D                                          122   3e-28    Brassica napus [oilseed rape]
ref|XP_012070440.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7     122   3e-28    Jatropha curcas
ref|NP_001051635.1|  Os03g0806500                                       122   4e-28    
ref|XP_003548734.2|  PREDICTED: 5'-adenylylsulfate reductase-like...    121   5e-28    Glycine max [soybeans]
ref|XP_003618952.1|  Thioredoxin domain-containing protein              122   6e-28    
ref|XP_004489697.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    120   9e-28    Cicer arietinum [garbanzo]
ref|XP_002525419.1|  conserved hypothetical protein                     120   1e-27    Ricinus communis
emb|CDX92054.1|  BnaC03g33560D                                          120   2e-27    
gb|ACN33657.1|  unknown                                                 116   2e-27    Zea mays [maize]
ref|XP_006296718.1|  hypothetical protein CARUB_v10014268mg             120   2e-27    Capsella rubella
ref|XP_009134747.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     120   2e-27    Brassica rapa
ref|XP_011457634.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     118   3e-27    Fragaria vesca subsp. vesca
ref|XP_004228686.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     119   3e-27    Solanum lycopersicum
emb|CDY29967.1|  BnaC01g40410D                                          119   4e-27    Brassica napus [oilseed rape]
emb|CDP14309.1|  unnamed protein product                                119   5e-27    Coffea canephora [robusta coffee]
ref|XP_006354125.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    119   5e-27    Solanum tuberosum [potatoes]
ref|XP_007202392.1|  hypothetical protein PRUPE_ppa009402mg             118   6e-27    Prunus persica
ref|XP_009413322.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     118   9e-27    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004962823.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    117   1e-26    Setaria italica
ref|XP_007030092.1|  APR-like 5, putative                               117   1e-26    
emb|CDY21158.1|  BnaA01g33890D                                          117   2e-26    Brassica napus [oilseed rape]
ref|XP_009417154.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    117   2e-26    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102086.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     117   2e-26    Brassica rapa
ref|XP_010097394.1|  5'-adenylylsulfate reductase-like 5                117   3e-26    
ref|XP_011089719.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    116   4e-26    Sesamum indicum [beniseed]
ref|XP_009417155.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    114   9e-26    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420649.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     115   1e-25    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871802.1|  hypothetical protein ARALYDRAFT_909820             114   1e-25    Arabidopsis lyrata subsp. lyrata
ref|XP_009797663.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     114   2e-25    Nicotiana sylvestris
ref|XP_006664614.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    112   4e-25    Oryza brachyantha
gb|EYU39267.1|  hypothetical protein MIMGU_mgv1a011190mg                112   6e-25    Erythranthe guttata [common monkey flower]
ref|XP_010558723.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7     112   7e-25    
ref|XP_006400357.1|  hypothetical protein EUTSA_v10014257mg             112   1e-24    Eutrema salsugineum [saltwater cress]
gb|AGV54233.1|  5'-adenylylsulfate reductase-like protein               112   1e-24    Phaseolus vulgaris [French bean]
ref|XP_007151851.1|  hypothetical protein PHAVU_004G080800g             112   2e-24    Phaseolus vulgaris [French bean]
gb|KGN53935.1|  hypothetical protein Csa_4G192070                       110   2e-24    Cucumis sativus [cucumbers]
ref|XP_008441988.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     111   3e-24    Cucumis melo [Oriental melon]
ref|XP_007202391.1|  hypothetical protein PRUPE_ppa009402mg             110   3e-24    
gb|EYU26001.1|  hypothetical protein MIMGU_mgv1a022783mg                110   3e-24    Erythranthe guttata [common monkey flower]
dbj|BAB09470.1|  unnamed protein product                                110   4e-24    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008240528.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     110   5e-24    Prunus mume [ume]
ref|NP_568360.1|  5'-adenylylsulfate reductase-like 7                   109   6e-24    Arabidopsis thaliana [mouse-ear cress]
gb|ERN20398.1|  hypothetical protein AMTR_s00068p00075130               107   9e-24    Amborella trichopoda
ref|XP_010237189.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6     109   9e-24    Brachypodium distachyon [annual false brome]
gb|AAM60945.1|  contains similarity to protein disulfide isomeras...    109   9e-24    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036228.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     108   1e-23    Eucalyptus grandis [rose gum]
ref|XP_009624667.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     109   1e-23    Nicotiana tomentosiformis
ref|XP_004147538.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5     108   2e-23    Cucumis sativus [cucumbers]
ref|XP_002319158.2|  hypothetical protein POPTR_0013s05370g             106   5e-23    
sp|Q2QP53.1|APRL6_ORYSJ  RecName: Full=5'-adenylylsulfate reducta...    106   1e-22    Oryza sativa Japonica Group [Japonica rice]
gb|KHN00681.1|  5'-adenylylsulfate reductase-like 5                     106   1e-22    Glycine soja [wild soybean]
emb|CDY25457.1|  BnaC09g39720D                                          105   2e-22    Brassica napus [oilseed rape]
emb|CDP14310.1|  unnamed protein product                                105   4e-22    Coffea canephora [robusta coffee]
ref|XP_006400356.1|  hypothetical protein EUTSA_v10014257mg             104   5e-22    Eutrema salsugineum [saltwater cress]
ref|XP_010524982.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7     104   5e-22    Tarenaya hassleriana [spider flower]
ref|XP_010420552.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    103   7e-22    
ref|XP_010420551.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    103   7e-22    Camelina sativa [gold-of-pleasure]
ref|XP_003548940.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    100   9e-22    Glycine max [soybeans]
ref|XP_010454034.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    103   9e-22    Camelina sativa [gold-of-pleasure]
ref|XP_010454033.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    103   2e-21    Camelina sativa [gold-of-pleasure]
gb|KHN34690.1|  5'-adenylylsulfate reductase-like 5                     100   2e-21    Glycine soja [wild soybean]
gb|ACF81704.1|  unknown                                                 100   3e-21    Zea mays [maize]
ref|XP_006288371.1|  hypothetical protein CARUB_v10001621mg             101   5e-21    Capsella rubella
gb|EMS52111.1|  5'-adenylylsulfate reductase-like 6                   99.0    2e-20    Triticum urartu
ref|XP_010492806.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  99.4    3e-20    
emb|CDX70796.1|  BnaC03g08800D                                        99.0    3e-20    
ref|XP_010492807.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  99.0    3e-20    
ref|XP_002443304.1|  hypothetical protein SORBIDRAFT_08g017260        99.0    3e-20    Sorghum bicolor [broomcorn]
ref|NP_001105767.1|  adenosine 5'-phosphosulfate reductase6 precu...  97.8    9e-20    Zea mays [maize]
ref|XP_010549678.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7   97.4    1e-19    
gb|KCW47755.1|  hypothetical protein EUGRSUZ_K01503                   95.9    3e-19    Eucalyptus grandis [rose gum]
ref|XP_006650758.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  94.4    3e-19    
ref|NP_001242527.1|  uncharacterized protein LOC100813728 precursor   95.1    3e-19    
ref|XP_009131638.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  95.5    4e-19    Brassica rapa
emb|CDX78778.1|  BnaA03g06900D                                        94.7    1e-18    
gb|ACG47677.1|  APRL6 - Zea mays adenosine 5'-phosphosulfate redu...  94.7    1e-18    Zea mays [maize]
gb|EEC69443.1|  hypothetical protein OsI_38622                        92.4    2e-18    Oryza sativa Indica Group [Indian rice]
gb|ACG34292.1|  APRL6 - Zea mays adenosine 5'-phosphosulfate redu...  93.2    4e-18    Zea mays [maize]
ref|XP_008673453.1|  PREDICTED: adenosine 5'-phosphosulfate reduc...  92.8    4e-18    Zea mays [maize]
emb|CDY38488.1|  BnaA10g16700D                                        92.0    9e-18    Brassica napus [oilseed rape]
ref|NP_001105806.1|  adenosine 5'-phosphosulfate reductase-like7 ...  92.0    9e-18    Zea mays [maize]
ref|XP_009121010.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  91.7    1e-17    Brassica rapa
gb|KHN46769.1|  5'-adenylylsulfate reductase-like 5                   89.7    1e-17    Glycine soja [wild soybean]
ref|NP_001136871.1|  hypothetical protein precursor                   87.8    6e-17    
ref|XP_009131639.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  87.8    2e-16    Brassica rapa
ref|XP_009121013.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  84.0    6e-15    Brassica rapa
gb|ACF81335.1|  unknown                                               79.0    4e-14    Zea mays [maize]
ref|XP_010916845.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-adenylyls...  78.2    8e-14    
emb|CBI19166.3|  unnamed protein product                              76.6    2e-13    Vitis vinifera
gb|KHG25608.1|  5'-adenylylsulfate reductase-like 5                   72.4    5e-11    Gossypium arboreum [tree cotton]
gb|EPS59781.1|  5'-adenylylsulfate reductase-like 7                   70.1    1e-10    Genlisea aurea
gb|KDO55016.1|  hypothetical protein CISIN_1g0462602mg                68.2    3e-10    Citrus sinensis [apfelsine]
gb|KFK37812.1|  hypothetical protein AALP_AA3G032500                  71.2    6e-10    Arabis alpina [alpine rockcress]
gb|AEW07692.1|  hypothetical protein 0_9092_01                        65.1    4e-09    Pinus radiata
gb|ACF88355.1|  unknown                                               64.7    5e-09    Zea mays [maize]
gb|AFG62695.1|  hypothetical protein 0_9092_01                        64.7    5e-09    Pinus taeda
tpg|DAA52030.1|  TPA: hypothetical protein ZEAMMB73_798246            63.2    2e-08    
dbj|GAM21807.1|  hypothetical protein SAMD00019534_049820             63.5    6e-08    
ref|XP_008664336.1|  PREDICTED: uncharacterized protein LOC103642962  62.4    4e-07    
gb|EAZ20769.1|  hypothetical protein OsJ_36393                        59.7    1e-06    
gb|EFA79447.1|  thioredoxin-like protein                              58.5    2e-06    
tpg|DAA55323.1|  TPA: hypothetical protein ZEAMMB73_501257            56.6    3e-06    
dbj|GAM19887.1|  hypothetical protein SAMD00019534_030620             57.4    3e-06    
gb|ACF82441.1|  unknown                                               56.2    4e-06    
gb|KDR21307.1|  Thioredoxin domain-containing protein 15              58.2    4e-06    
gb|EFX72155.1|  hypothetical protein DAPPUDRAFT_326524                58.5    4e-06    
gb|EAY94175.1|  hypothetical protein OsI_15947                        57.0    2e-05    
ref|XP_741900.1|  hypothetical protein                                54.3    2e-05    
gb|ABD83915.1|  disulfide isomerase-like                              55.5    3e-05    
ref|XP_010146255.1|  PREDICTED: thioredoxin domain-containing pro...  54.3    3e-05    
gb|KFV91810.1|  Thioredoxin domain-containing protein 15              54.3    3e-05    
ref|XP_002024963.1|  GL17836                                          55.8    4e-05    
dbj|GAM27207.1|  hypothetical protein SAMD00019534_103820             55.1    4e-05    
ref|XP_010282929.1|  PREDICTED: thioredoxin domain-containing pro...  53.9    4e-05    
ref|XP_001957224.1|  GF24161                                          55.5    4e-05    
ref|XP_001352537.1|  GA18605                                          55.5    5e-05    
ref|XP_001983364.1|  GH15857                                          55.1    6e-05    
ref|XP_008816510.1|  protein disulfide-isomerase                      55.1    7e-05    
ref|XP_010199722.1|  PREDICTED: thioredoxin domain-containing pro...  53.1    8e-05    
emb|CDJ49354.1|  thioredoxin, putative                                53.5    8e-05    
gb|KFP25636.1|  Thioredoxin domain-containing protein 15              53.1    8e-05    
ref|XP_010014471.1|  PREDICTED: thioredoxin domain-containing pro...  53.1    9e-05    
ref|XP_739268.1|  disulfide isomerase precursor                       53.1    9e-05    
gb|KFV55765.1|  Thioredoxin domain-containing protein 15              52.8    1e-04    
emb|CAE03042.3|  OSJNBa0084A10.17                                     54.3    1e-04    
ref|XP_006653412.1|  PREDICTED: protein disulfide isomerase-like ...  54.3    1e-04    
ref|XP_009813081.1|  PREDICTED: thioredoxin domain-containing pro...  52.8    1e-04    
ref|NP_001052831.2|  Os04g0432500                                     54.3    1e-04    
ref|XP_009889711.1|  PREDICTED: thioredoxin domain-containing pro...  53.1    1e-04    
ref|XP_002006969.1|  GI12640                                          54.3    1e-04    
ref|XP_001973196.1|  GG15964                                          53.9    1e-04    
ref|NP_648847.3|  CG5027                                              53.9    1e-04    
ref|XP_001614884.1|  protein disulfide isomerase                      54.3    1e-04    
ref|XP_002095756.1|  GE19532                                          53.9    1e-04    
gb|KJP89522.1|  protein disulfide-isomerase domain                    53.9    1e-04    
ref|XP_002046182.1|  GJ12759                                          53.9    1e-04    
gb|KGL86991.1|  Thioredoxin domain-containing protein 15              52.8    1e-04    
emb|CDI80419.1|  thioredoxin, putative                                52.8    1e-04    
ref|XP_002258043.1|  disulfide isomerase                              53.9    2e-04    
gb|EPY51700.1|  protein disulfide isomerase                           53.5    2e-04    
emb|CCG82076.1|  Protein disulfide-isomerase erp38                    52.8    2e-04    
gb|AFW58276.1|  putative thioredoxin superfamily protein              53.1    2e-04    
ref|XP_010303602.1|  PREDICTED: thioredoxin domain-containing pro...  52.0    2e-04    
gb|KFV01495.1|  Thioredoxin domain-containing protein 15              52.0    2e-04    
ref|XP_009982745.1|  PREDICTED: thioredoxin domain-containing pro...  51.6    2e-04    
ref|NP_001105803.1|  protein disulfide isomerase11 precursor          53.5    2e-04    
ref|NP_001088331.1|  protein disulfide isomerase family A, member...  53.5    2e-04    
gb|AAV36000.1|  protein disulfide isomerase                           53.5    2e-04    
gb|EUD70702.1|  protein disulfide-isomerase                           53.5    2e-04    
ref|XP_008626244.1|  protein disulfide-isomerase                      53.1    2e-04    
ref|XP_003771776.1|  PREDICTED: protein disulfide-isomerase A4        53.5    2e-04    
ref|NP_001092245.1|  thioredoxin domain-containing protein 15 pre...  52.8    2e-04    
ref|XP_009498987.1|  PREDICTED: thioredoxin domain-containing pro...  51.6    3e-04    
ref|XP_002908400.1|  protein disulfide-isomerase, putative            51.6    3e-04    
ref|XP_725916.1|  protein disulfide isomerase                         53.1    3e-04    
gb|KFW96107.1|  Thioredoxin domain-containing protein 15              51.2    3e-04    
gb|KDO33338.1|  hypothetical protein SPRG_02145                       53.5    3e-04    
gb|ETB58600.1|  protein disulfide-isomerase domain                    53.1    3e-04    
emb|CCA15328.1|  SSP8                                                 52.8    3e-04    
emb|CDJ63262.1|  thioredoxin, putative                                52.0    3e-04    
ref|XP_010126238.1|  PREDICTED: thioredoxin domain-containing pro...  51.6    3e-04    
gb|AAN31493.1|  protein disulfide-isomerase                           51.6    3e-04    
ref|XP_677145.1|  disulfide isomerase precursor                       52.8    3e-04    
ref|XP_002941424.1|  PREDICTED: protein disulfide-isomerase A4        53.1    3e-04    
ref|XP_004952834.1|  PREDICTED: protein disulfide isomerase-like ...  52.8    3e-04    
ref|XP_009909275.1|  PREDICTED: thioredoxin domain-containing pro...  51.2    3e-04    
ref|XP_004355301.1|  hypothetical protein DFA_07805                   53.1    3e-04    
gb|KFV61263.1|  Thioredoxin domain-containing protein 15              51.2    3e-04    
emb|CDJ29500.1|  thioredoxin, putative                                52.0    3e-04    
emb|CDI83347.1|  thioredoxin, putative                                52.0    3e-04    
gb|KDN48212.1|  thioredoxin-domain-containing protein                 53.1    3e-04    
gb|ETW18837.1|  protein disulfide-isomerase domain                    52.8    4e-04    
gb|AAX98286.1|  protein disulifide isomerase                          52.8    4e-04    
emb|CCI44606.1|  unnamed protein product                              52.4    4e-04    
emb|CAC15387.1|  protein disulfide isomerase                          52.8    4e-04    
gb|KDO24271.1|  hypothetical protein SPRG_09907                       53.1    4e-04    
ref|XP_005818369.1|  hypothetical protein GUITHDRAFT_46284            49.7    4e-04    
gb|KFU83923.1|  Thioredoxin domain-containing protein 15              50.8    4e-04    
emb|CDO64046.1|  protein disulfide isomerase                          52.4    4e-04    
emb|CDI97711.1|  Thioredoxin fold                                     49.7    4e-04    
ref|XP_010735892.1|  PREDICTED: thioredoxin domain-containing pro...  52.0    4e-04    
emb|CDJ43169.1|  thioredoxin, putative                                51.2    4e-04    
gb|KFW79527.1|  Thioredoxin domain-containing protein 15              51.2    4e-04    
emb|CDJ56301.1|  thioredoxin, putative                                52.4    4e-04    
ref|XP_009942377.1|  PREDICTED: thioredoxin domain-containing pro...  50.8    5e-04    
gb|KGR17236.1|  protein disulfide-isomerase A6                        50.4    5e-04    
ref|XP_718617.1|  potential protein disulfide isomerase fragment      51.2    5e-04    
gb|KGR10618.1|  protein disulfide-isomerase A6                        51.2    5e-04    
gb|KFR01814.1|  Thioredoxin domain-containing protein 15              50.8    5e-04    
gb|KJH48607.1|  thioredoxin                                           52.0    5e-04    
ref|XP_008938522.1|  PREDICTED: thioredoxin domain-containing pro...  50.8    5e-04    
gb|EUR73061.1|  protein disulfide-isomerase domain                    52.4    5e-04    
gb|ETW36999.1|  protein disulfide-isomerase domain                    52.4    5e-04    
ref|XP_006654072.1|  PREDICTED: protein disulfide isomerase-like ...  52.0    5e-04    
gb|EUT87354.1|  protein disulfide-isomerase domain                    52.4    5e-04    
gb|KFQ18620.1|  Thioredoxin domain-containing protein 15              50.8    5e-04    
ref|XP_011481427.1|  PREDICTED: thioredoxin domain-containing pro...  51.6    6e-04    
ref|XP_004076101.1|  PREDICTED: thioredoxin domain-containing pro...  52.0    6e-04    
ref|XP_009994061.1|  PREDICTED: thioredoxin domain-containing pro...  50.8    6e-04    
gb|KGQ92050.1|  protein disulfide-isomerase A6                        51.2    6e-04    
ref|XP_002808883.1|  protein disulfide isomerase                      52.0    6e-04    
gb|KGU13771.1|  protein disulfide-isomerase A6                        51.2    6e-04    
ref|XP_002158667.2|  PREDICTED: uncharacterized protein LOC100203...  52.0    6e-04    
ref|XP_008330662.1|  PREDICTED: thioredoxin domain-containing pro...  51.6    6e-04    
emb|CDS24375.1|  Thioredoxin fold                                     49.3    6e-04    
ref|XP_001755660.1|  predicted protein                                52.4    6e-04    
ref|XP_008920432.1|  PREDICTED: thioredoxin domain-containing pro...  50.8    7e-04    
ref|NP_001148680.1|  protein disulfide isomerase precursor            51.6    7e-04    
gb|EKG06544.1|  protein disulfide isomerase, putative                 51.6    8e-04    
ref|XP_008643659.1|  PREDICTED: protein disulfide isomerase isofo...  51.6    8e-04    
gb|KGQ87748.1|  protein disulfide-isomerase A6                        51.2    8e-04    
ref|XP_010605480.1|  PREDICTED: protein disulfide-isomerase TMX3      48.9    8e-04    
ref|XP_010767359.1|  PREDICTED: thioredoxin domain-containing pro...  51.6    8e-04    
ref|XP_006785101.1|  PREDICTED: thioredoxin domain-containing pro...  51.2    8e-04    
gb|ESS69956.1|  protein disulfide isomerase                           51.2    8e-04    
ref|XP_009321048.1|  PREDICTED: thioredoxin domain-containing pro...  50.4    0.001    
gb|EEQ44186.1|  conserved hypothetical protein                        51.2    0.001    
gb|KHC69866.1|  protein disulfide-isomerase A6                        51.2    0.001    
gb|KFM12078.1|  Thioredoxin domain-containing protein 15              49.7    0.001    
gb|KFO70052.1|  Thioredoxin domain-containing protein 15              50.8    0.001    
ref|XP_009561098.1|  PREDICTED: thioredoxin domain-containing pro...  50.4    0.001    



>ref|XP_006364863.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Solanum 
tuberosum]
Length=323

 Score =   383 bits (983),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 201/324 (62%), Positives = 246/324 (76%), Gaps = 4/324 (1%)
 Frame = -2

Query  1094  MARLREWRAG-MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIF-ALPDSTCSIDEIK  921
             M  L  + AG + LLM+   +    T+     ++C  K S KD +F    D TC +D I+
Sbjct  1     MGLLSAFAAGFVVLLMVFEGMASPETVNVSVRSVCPLK-SVKDSVFMGFQDLTCPLDGIQ  59

Query  920   SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  741
             SS    VI+GDE SLQRAL+++HR +HDYVALLFYASWCPFSR F+P FS++SSL P +P
Sbjct  60    SSYVAEVIQGDELSLQRALNMIHRNTHDYVALLFYASWCPFSRSFRPKFSIMSSLYPSIP  119

Query  740   HFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSK  561
             HFAIEESA+KPSTLSKYGV GFPTLFL+NSTMR RYHGSRSLDS+++FYG  TG  ++S 
Sbjct  120   HFAIEESAVKPSTLSKYGVHGFPTLFLLNSTMRMRYHGSRSLDSVIEFYGGTTGFHSASV  179

Query  560   DNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
             D  SL K+ CSSN  +  GS+QE+CPFSW+RSP+N  +QETYLALATAFVLM++LY+IFP
Sbjct  180   DATSLGKMGCSSNLLKLHGSDQENCPFSWARSPENLFQQETYLALATAFVLMKVLYMIFP  239

Query  380   AVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
             A+ + ++     CIL +R RS WE P L  +RAVQ  NSLKEPCKRSNLQEGAMNAKAWA
Sbjct  240   ALRKIAQIGLGGCILQIRIRSLWELPLLYLNRAVQLCNSLKEPCKRSNLQEGAMNAKAWA  299

Query  203   SKSLASVSIGDasssravavsSTH  132
             SKSLASVS G++S+SR   VSSTH
Sbjct  300   SKSLASVSFGESSASRVEPVSSTH  323



>emb|CDP01065.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   380 bits (976),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 230/311 (74%), Gaps = 3/311 (1%)
 Frame = -2

Query  1094  MARLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPD--STCSIDEIK  921
             MA  +   AG+ LL + GR+T + T+  P  +  C   S KD I    D    C +D I+
Sbjct  1     MAIFKVLGAGLTLLFLFGRVTASDTIRVPSASSFCPLISIKDSILGSQDHADACPVDGIE  60

Query  920   SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  741
                 T VIEGDE SLQRAL+++H   HDYV LLFYASWCPFS  F+P FS+++SL P +P
Sbjct  61    PLHITGVIEGDEASLQRALNMIHGNKHDYVILLFYASWCPFSGTFRPTFSILASLFPSLP  120

Query  740   HFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSK  561
             HFAIEESA+KPSTLSKYGV GFPT+FL+NST+R RYHGSR+ DSL+ FY D+TG +T+S 
Sbjct  121   HFAIEESAVKPSTLSKYGVHGFPTIFLLNSTLRVRYHGSRTRDSLITFYEDVTGIKTASL  180

Query  560   DNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
               +SL+KI CSS+  +   S+ ESCPF W+RSP+N LRQETYLALATAFVLMRLLYV FP
Sbjct  181   SGLSLEKIECSSDHQKHNSSDPESCPFPWARSPENLLRQETYLALATAFVLMRLLYVFFP  240

Query  380   AVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
             A+ R  + A RR I N R R+ WE+P +C +RA Q  NSLKEPCK+SNLQEGAMNAKAWA
Sbjct  241   ALHRSGQLAWRRYISNTRLRNLWEHPLVCLNRAKQLLNSLKEPCKKSNLQEGAMNAKAWA  300

Query  203   SKSLASVSIGD  171
             SKSLASVS GD
Sbjct  301   SKSLASVSFGD  311



>ref|XP_004237917.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Solanum lycopersicum]
Length=323

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 244/324 (75%), Gaps = 4/324 (1%)
 Frame = -2

Query  1094  MARLREWRAG-MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIF-ALPDSTCSIDEIK  921
             M  L  + AG + +LM+   +    T      ++C  K S KD IF    D TC +D I+
Sbjct  1     MGLLSAFAAGFVVILMVFEGMASPETANVSVRSVCPLK-SVKDSIFMGFQDLTCPLDGIQ  59

Query  920   SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  741
             SS    VI+GDE SLQRAL ++HR +HDYVALLFYASWCPFSR F+P FS++SSL P +P
Sbjct  60    SSYVAEVIQGDELSLQRALSMIHRNTHDYVALLFYASWCPFSRSFRPKFSIMSSLYPSIP  119

Query  740   HFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSK  561
             HFAIEESA+KPSTLSKYGV GFPTLFL+NSTMR RYHGSRSLDS+++FYG  TG  ++S 
Sbjct  120   HFAIEESAVKPSTLSKYGVHGFPTLFLLNSTMRMRYHGSRSLDSVIEFYGGTTGFHSASV  179

Query  560   DNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
             D  SL K+ CSSN  +  GS+QE+CPFSW+RSP+N  +QETYLALATAFVL+++LY+IFP
Sbjct  180   DATSLGKMGCSSNLLKLHGSDQENCPFSWARSPENLFQQETYLALATAFVLLKVLYMIFP  239

Query  380   AVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
             A+ + ++     CIL +R RS WE P L  +RAVQ  NSLKEPCKRSNLQEGAMNAKAWA
Sbjct  240   ALRKIAQIGLGGCILQIRIRSLWELPLLYLNRAVQLCNSLKEPCKRSNLQEGAMNAKAWA  299

Query  203   SKSLASVSIGDasssravavsSTH  132
             SKSLASVS G++S+SR   VSSTH
Sbjct  300   SKSLASVSFGESSASRVEPVSSTH  323



>ref|XP_009613129.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Nicotiana tomentosiformis]
Length=324

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 234/312 (75%), Gaps = 5/312 (2%)
 Frame = -2

Query  1094  MARLREWRAGMALLMIV-GRLTCAHTLTAPFPALCCSKYSAKDWIFA--LPDSTCSIDEI  924
             M  L  W AG  +LM+    L    T T  F ++C  K S KD IF     D TC +D I
Sbjct  1     MGLLSVWAAGFVVLMMAFDGLASPETSTMSFRSVCPLK-SLKDSIFMGFHQDLTCPLDGI  59

Query  923   KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
             +SS    VI+GDE SLQRAL+++HR +HDYVALLFYASWCPFS  F+P FSV+SSL P +
Sbjct  60    QSSHMAGVIQGDELSLQRALNMIHRNTHDYVALLFYASWCPFSGSFRPKFSVLSSLFPSI  119

Query  743   PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSS  564
             PHFAIEESA+KPSTLSKYGV GFPTLFL+NSTMR RYHGSR+LDS+++FY   TG + +S
Sbjct  120   PHFAIEESAVKPSTLSKYGVHGFPTLFLLNSTMRVRYHGSRTLDSVIEFYSGTTGFQIAS  179

Query  563   KDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIF  384
              D+ SL K RCS N  +  GS+QE+CPFSW+RSP+N L+QETYLALATAFVLMRLLY +F
Sbjct  180   VDDTSLGKTRCSLNHLKLHGSDQENCPFSWARSPENLLQQETYLALATAFVLMRLLYKLF  239

Query  383   PAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAW  207
             PA+ + +  S  R  L++R RS WE P L  +RA+Q  NSL+EPCKRSNLQEGAMNAKAW
Sbjct  240   PALRKIAHFSWERSNLHIRIRSLWELPLLYMNRAIQLCNSLQEPCKRSNLQEGAMNAKAW  299

Query  206   ASKSLASVSIGD  171
             ASKSLASVS G+
Sbjct  300   ASKSLASVSFGE  311



>ref|XP_009778517.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X1 [Nicotiana 
sylvestris]
Length=324

 Score =   365 bits (938),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 229/306 (75%), Gaps = 5/306 (2%)
 Frame = -2

Query  1094  MARLREWRAG-MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFA--LPDSTCSIDEI  924
             M  L  W A  + LLM+   L    T T  F ++C  K S KD IF     D TC +D I
Sbjct  1     MGLLSVWAAVFVVLLMVFEGLASPETRTMSFRSVCPLK-SIKDSIFMGFHQDLTCPLDGI  59

Query  923   KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
             +SS    VI+GDE +L RAL+++HR +HDYVALLFYASWCPFS  F+P FSV+SSL P +
Sbjct  60    QSSYMAGVIQGDELALHRALNLIHRNTHDYVALLFYASWCPFSGSFRPKFSVLSSLFPSI  119

Query  743   PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSS  564
             PHFAIEESA+KPSTLSKYGV GFPTLFL+NSTMR RYHGSR+LDS+++FY   TG + +S
Sbjct  120   PHFAIEESAVKPSTLSKYGVHGFPTLFLLNSTMRIRYHGSRTLDSVIEFYSGSTGFQIAS  179

Query  563   KDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIF  384
              D+ SL K RCSSN  +  GS+QE+CPFSW+RSP+N L+QETYLALATAFVLMRLLY +F
Sbjct  180   VDDTSLGKTRCSSNHLKLHGSDQENCPFSWARSPENLLQQETYLALATAFVLMRLLYKLF  239

Query  383   PAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAW  207
             PA+ + +  S  R  L++R RS WE P L  +RA+Q  NSL+EPCKRSNLQEGAMNAKAW
Sbjct  240   PALRKIAHLSWERSNLHVRIRSLWELPLLYLNRAIQLCNSLQEPCKRSNLQEGAMNAKAW  299

Query  206   ASKSLA  189
             ASKSLA
Sbjct  300   ASKSLA  305



>gb|KDO80979.1| hypothetical protein CISIN_1g020846mg [Citrus sinensis]
Length=320

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 227/306 (74%), Gaps = 4/306 (1%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCST  906
             LR W  G+ +L++ GRLTCA  +   FP   C   S  D IF   DS C I         
Sbjct  3     LRFWETGILMLVLWGRLTCA-VVAVRFP--LCPTESVTDSIFRFQDSFCPISCNDFQDIV  59

Query  905   AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
              VIEGDE SLQ AL++VH+ SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIE
Sbjct  60    GVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIE  119

Query  725   ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
             ESAI+PS LSKYGV GFPTLFL+NS+MR RYHGSR+LDSLV FY D+TG  T+S D IS 
Sbjct  120   ESAIRPSILSKYGVHGFPTLFLLNSSMRVRYHGSRTLDSLVAFYSDVTGMNTASLDKISP  179

Query  545   DKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRF  366
             DK+  +SN  +   +E+ESCPFSW+RSP+N L+QETYLALATAFVL+RL+Y+  P +  F
Sbjct  180   DKVGKASNHEKHNNTEEESCPFSWARSPENLLQQETYLALATAFVLLRLVYIFLPTLLIF  239

Query  365   SRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLA  189
             ++ + RR I NL+  S  E+P+   +RA+Q F +L EPCKRSNLQEGA+NA+AWASKSLA
Sbjct  240   AQFTWRRLIRNLKLGSLLEHPRTYLNRAIQLFKTLNEPCKRSNLQEGALNARAWASKSLA  299

Query  188   SVSIGD  171
             +VSIGD
Sbjct  300   TVSIGD  305



>ref|XP_006472592.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Citrus sinensis]
Length=320

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 227/306 (74%), Gaps = 4/306 (1%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCST  906
             LR W  G+ +L++ GRLTCA  +   FP   C   S  D IF   DS C I         
Sbjct  3     LRFWETGILMLVLWGRLTCA-VVAVRFP--LCPTESVTDSIFRFQDSFCPISCNDFQDIV  59

Query  905   AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
              VIEGDE SLQ AL++VH+ SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIE
Sbjct  60    GVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIE  119

Query  725   ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
             ESAI+PS LSKYGV GFPTLFL+NS+MR RYHGSR+LDSLV FY D+TG  T+S D IS 
Sbjct  120   ESAIRPSILSKYGVHGFPTLFLLNSSMRVRYHGSRTLDSLVAFYSDVTGINTASLDKISP  179

Query  545   DKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRF  366
             DK+  +SN  +   +E+ESCPFSW+RSP+N L+QETYLALATAFVL+RL+Y+  P +  F
Sbjct  180   DKVGKASNHEKHNNTEEESCPFSWARSPENLLQQETYLALATAFVLLRLVYIFLPTLLIF  239

Query  365   SRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLA  189
             ++ + RR I NL+  S  E+P+   +RA+Q F +L EPCKRSNLQEGA+NA+AWASKSLA
Sbjct  240   AQFTWRRLIRNLKLGSLLEHPRTYLNRAIQLFKTLNEPCKRSNLQEGALNARAWASKSLA  299

Query  188   SVSIGD  171
             +VSIGD
Sbjct  300   TVSIGD  305



>ref|XP_006433972.1| hypothetical protein CICLE_v10001862mg [Citrus clementina]
 gb|ESR47212.1| hypothetical protein CICLE_v10001862mg [Citrus clementina]
Length=320

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/306 (60%), Positives = 226/306 (74%), Gaps = 4/306 (1%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCST  906
             LR W  G+ +L++ GRLTCA  +   FP   C   S  D IF   DS C I         
Sbjct  3     LRFWETGILMLVLWGRLTCA-VVAVRFP--LCPTESVTDSIFRFQDSFCPISCNDFQDIV  59

Query  905   AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
              VIEGDE SLQ AL++V + SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIE
Sbjct  60    GVIEGDEVSLQMALNMVQKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIE  119

Query  725   ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
             ESAI+PS LSKYGV GFPTLFL+NS+MR RYHGSR+LDSLV FY D+TG  T+S D IS 
Sbjct  120   ESAIRPSILSKYGVHGFPTLFLLNSSMRVRYHGSRTLDSLVAFYSDVTGMNTASLDKISP  179

Query  545   DKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRF  366
             DK+  +SN  +   +E+ESCPFSW+RSP+N L+QETYLALATAFVL+RL+Y+  P +  F
Sbjct  180   DKVGKASNHEKHNNTEEESCPFSWARSPENLLQQETYLALATAFVLLRLVYIFLPTLLVF  239

Query  365   SRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLA  189
             ++ + RR I NL+  S  E+P+   +RA+Q F +L EPCKRSNLQEGA+NA+AWASKSLA
Sbjct  240   AQFTWRRLIRNLKPGSLLEHPRTYLNRAIQLFKTLNEPCKRSNLQEGALNARAWASKSLA  299

Query  188   SVSIGD  171
             +VSIGD
Sbjct  300   TVSIGD  305



>ref|XP_004300651.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   360 bits (923),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/307 (59%), Positives = 228/307 (74%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI-KSSCS  909
             +R W  G+ +L+I GRLT A   T+      C   SA + IF   DS C+I+ + +S  S
Sbjct  3     IRVWGFGILILLIWGRLTSAVEPTS------CPTKSAAEAIFGFRDSVCAINGVTRSVGS  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ SH+YVA+LFYASWCPFSR FKP FSV++SL P +PHFA 
Sbjct  57    NGVIVGDEVSLQRALNLVHKNSHEYVAVLFYASWCPFSRMFKPTFSVLASLYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPTLF++NSTMR RY G+R+  SLV FY D+TG +T S D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTLFILNSTMRVRYQGARTPGSLVAFYSDVTGIKTVSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
              +K+    N  ++  +EQESCPFSW+RSP+N LRQETYLALA+AFV++RLLY+ FP +  
Sbjct  177   PEKVGHPPNHEKNDSNEQESCPFSWARSPENMLRQETYLALASAFVILRLLYIFFPTLIS  236

Query  368   FSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
              ++ A RR I N+R  + +E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   LAQCAWRRHIRNVRFGNLFEHPVAYLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>ref|XP_011016531.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Populus euphratica]
Length=333

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/317 (59%), Positives = 229/317 (72%), Gaps = 15/317 (5%)
 Frame = -2

Query  1094  MARLREWRAGMAL-LMIVGRLTCA----HTLTAPFPALCCSKYSAKDWIFALPDSTCSID  930
             M + R WR  + L +MI G L CA    HT++       C   S KDWIF   D  C + 
Sbjct  10    MMQTRVWRPRILLWMMIYGSLLCATADSHTVS------ICPIESVKDWIFGFRDQNCVVS  63

Query  929   EIKSS-CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLL  753
                 S C   V EGDE SLQ+AL +V + SH+YVALLFYASWCPFS  F+P FS++SSL 
Sbjct  64    GANESPCFAGVTEGDEISLQKALSLVQKNSHEYVALLFYASWCPFSGTFRPSFSILSSLY  123

Query  752   PWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE  573
             P +PHFAIEES+I+PS LSKYGV GFPTLFL+NSTMR RYHGSR+L SLV FYGD+TG +
Sbjct  124   PVIPHFAIEESSIRPSILSKYGVHGFPTLFLLNSTMRVRYHGSRTLGSLVAFYGDVTGIK  183

Query  572   TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLY  393
             T+  D  S+DKI  +S+  +    EQESCPFSW+RSP+N LR+ETYLALATAFVL+RL Y
Sbjct  184   TAFLDEGSVDKIGRASHHEKYDTPEQESCPFSWARSPENLLREETYLALATAFVLLRLFY  243

Query  392   VIFPAVCRFSRAS-RRCILNLRTRSSWEYPQ--LCPSRAVQFFNSLKEPCKRSNLQEGAM  222
               FP +  F++ + RR + N+R  S  E+P+  L  +RA+Q FNSLKEPCK+SNLQEGAM
Sbjct  244   FTFPTMLAFAQFTWRRHVQNMRLGSLLEHPRAYLNINRAIQLFNSLKEPCKKSNLQEGAM  303

Query  221   NAKAWASKSLASVSIGD  171
             NA+AWASKSLA+VS+GD
Sbjct  304   NARAWASKSLATVSMGD  320



>ref|XP_008372920.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Malus domestica]
Length=313

 Score =   354 bits (908),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 223/307 (73%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSC-S  909
             +R W +G+ +L++  RL  A   T+      C   SA D IF    S C ++    S  S
Sbjct  3     IRVWESGIVILVLWVRLISAAEPTS------CPAESAADAIFGFRYSNCPVNGASRSVES  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57    MGVIVGDEVSLQRALNIVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPTLF++NST R RY G+R+  SL+ FY D+TG +T S D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTLFILNSTTRIRYQGARTPGSLIAFYSDVTGIKTVSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI    N  +   +EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY  +PA+  
Sbjct  177   LEKIGYPLNHEKHDSTEQESCPFSWARSPENLLRQETYLALASAFVLLRLLYSFYPALLS  236

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++++ RR I N+R  S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   FAQSAWRRHIQNMRLGSLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>gb|KDO80978.1| hypothetical protein CISIN_1g020846mg [Citrus sinensis]
Length=316

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 225/306 (74%), Gaps = 8/306 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCST  906
             LR W  G+ +L++ GRLTCA  +   FP   C   S  D IF   DS C I         
Sbjct  3     LRFWETGILMLVLWGRLTCA-VVAVRFP--LCPTESVTDSIFRFQDSFCPISCNDFQDIV  59

Query  905   AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
              VIEGDE SLQ AL++VH+ SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIE
Sbjct  60    GVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIE  119

Query  725   ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
             ESAI+PS LSKYGV GFPTLFL+NS+MR RYHGSR+LDSLV FY D+    T+S D IS 
Sbjct  120   ESAIRPSILSKYGVHGFPTLFLLNSSMRVRYHGSRTLDSLVAFYSDV----TASLDKISP  175

Query  545   DKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRF  366
             DK+  +SN  +   +E+ESCPFSW+RSP+N L+QETYLALATAFVL+RL+Y+  P +  F
Sbjct  176   DKVGKASNHEKHNNTEEESCPFSWARSPENLLQQETYLALATAFVLLRLVYIFLPTLLIF  235

Query  365   SRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLA  189
             ++ + RR I NL+  S  E+P+   +RA+Q F +L EPCKRSNLQEGA+NA+AWASKSLA
Sbjct  236   AQFTWRRLIRNLKLGSLLEHPRTYLNRAIQLFKTLNEPCKRSNLQEGALNARAWASKSLA  295

Query  188   SVSIGD  171
             +VSIGD
Sbjct  296   TVSIGD  301



>ref|XP_008383930.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Malus domestica]
Length=313

 Score =   352 bits (902),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 225/307 (73%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCS  909
             +R W +G+ +L++  RL CA       PA C ++ S  D IF    S C +D   +S  S
Sbjct  3     IRVWESGIVILVLWVRLVCAAE-----PASCPTE-SVADTIFGFRYSNCPVDGACRSVES  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57    MGVIVGDEVSLQRALNMVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPTLF++NSTMR RY G+R+  SL+ FY  +TG +T S D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTLFILNSTMRIRYQGARTPGSLIAFYSHVTGFKTVSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI    N  R   +EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY  FPA+  
Sbjct  177   LEKIGYPLNHERHDSTEQESCPFSWARSPENLLRQETYLALASAFVLLRLLYFFFPALLS  236

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++++ R  I ++R  S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   FAQSAWRWHIQDMRLGSLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>ref|XP_002302300.2| thioredoxin-related family protein [Populus trichocarpa]
 gb|EEE81573.2| thioredoxin-related family protein [Populus trichocarpa]
Length=334

 Score =   352 bits (903),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 226/318 (71%), Gaps = 16/318 (5%)
 Frame = -2

Query  1094  MARLREWRAGMAL-LMIVGRLTCA-----HTLTAPFPALCCSKYSAKDWIFALPDSTCSI  933
             M + R WR  + L +MI G L CA     HT++       C   S  DWIF   D  C +
Sbjct  10    MMQTRVWRPRILLSMMIYGSLMCATAADSHTVS------ICPIESVTDWIFGFRDQNCVV  63

Query  932   DEIKSS-CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSL  756
                  S C   V EGDE SLQ+AL +V + SH+YVALLFYASWCPFS  F+P FS++SSL
Sbjct  64    SGANESPCFAGVTEGDEISLQKALSLVQKNSHEYVALLFYASWCPFSGTFRPSFSILSSL  123

Query  755   LPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGA  576
              P +PHFAIEES+I+PS LSKYGV GFPTLFL+NSTMR RYHGSR+L SLV FY D+TG 
Sbjct  124   YPVIPHFAIEESSIRPSILSKYGVHGFPTLFLLNSTMRVRYHGSRTLGSLVAFYSDVTGI  183

Query  575   ETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLL  396
             +T+  D  S+DKI   S+  +    EQESCPFSW+RSP+N LR+ETYLALAT FVL+RL 
Sbjct  184   KTAFLDEGSVDKIGRVSHHEKYDTPEQESCPFSWARSPENLLREETYLALATTFVLLRLF  243

Query  395   YVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQ--LCPSRAVQFFNSLKEPCKRSNLQEGA  225
             Y+ FP +  F++ + RR + N+R  S  E+P+  L  +RA+Q FNSLKEPCK+SNLQEGA
Sbjct  244   YLTFPTMLAFAQFTWRRHVQNMRLGSLLEHPRAYLNLNRAIQLFNSLKEPCKKSNLQEGA  303

Query  224   MNAKAWASKSLASVSIGD  171
             MNA+AWASKSLA+VSIGD
Sbjct  304   MNARAWASKSLATVSIGD  321



>ref|XP_008343322.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Malus domestica]
Length=313

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 222/307 (72%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSC-S  909
             +R W +G+ +L++  RL  A   T+      C   SA D IF    S C ++    S  S
Sbjct  3     IRVWESGIVILVLWVRLISAAEPTS------CPAESAADAIFGFRYSNCPVNGASRSVES  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57    MGVIVGDEVSLQRALNIVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPTLF++NST R RY G+R+  SL+ FY D+TG +T S D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTLFILNSTTRIRYQGARTPGSLIAFYSDVTGIKTVSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI       +   +EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY  +PA+  
Sbjct  177   LEKIGYPLXHEKHDSTEQESCPFSWARSPENLLRQETYLALASAFVLLRLLYSFYPALLS  236

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++++ RR I N+R  S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   FAQSAWRRHIQNMRLGSLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>ref|XP_008219447.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Prunus mume]
Length=313

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 223/307 (73%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE-IKSSCS  909
             +R W+ G+ +L++  RL  A   T+      C   S  D IF    S+C  +   +S  S
Sbjct  3     IRVWQTGIVILVLWVRLISAAEPTS------CPTESVTDAIFGFRYSSCPANGGARSVDS  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ +H+YVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57    IGVIVGDEVSLQRALNMVHKNTHEYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPT+F++NSTMR RY GSR+  SL+ FY D+TG +T   D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTIFILNSTMRVRYQGSRTPGSLIAFYSDITGIKTVLVDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI    N  + G +EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY  FP +  
Sbjct  177   LEKIGYPLNHEKHGSTEQESCPFSWARSPENMLRQETYLALASAFVLLRLLYFFFPTLLS  236

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++++ RR I ++R  S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   FAQSAWRRNIRHMRLGSLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>ref|XP_009372786.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Pyrus x bretschneideri]
Length=313

 Score =   349 bits (896),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 221/307 (72%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSC-S  909
             +R W +G+ +L++  RL  A   T+      C   SA D IF    S C ++    S  S
Sbjct  3     IRVWESGIVILVLWVRLISAAEPTS------CPAESAADAIFGFRYSNCPVNGASRSVES  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57    MGVIVGDEVSLQRALNMVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPTLF++NST R RY G+R+  SL+ FY  +TG +T S D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTLFILNSTTRIRYQGARTPGSLIAFYSHVTGIKTVSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI    N  +   +EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY  +PA+  
Sbjct  177   LEKIGYPLNHEKHDSTEQESCPFSWARSPENLLRQETYLALASAFVLLRLLYSFYPALLS  236

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F +++ RR I N+R  S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   FVQSAWRRHIQNMRLGSLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>ref|XP_002285788.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Vitis vinifera]
Length=321

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 220/307 (72%), Gaps = 6/307 (2%)
 Frame = -2

Query  1076  WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS-TAV  900
             W  G+ LL++ GRLTCA  +      +C ++ S  D I    DS C+++E   S     V
Sbjct  6     WETGIVLLLVFGRLTCAEPVRVSLSPVCPTE-SVADSISGFRDSHCTVNEGDGSLDFVGV  64

Query  899   IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
              EGDE SLQ+ALD+VH+ +H+YVA+LFYASWC FSR  +P FS++SSL P +PHFAIEES
Sbjct  65    TEGDEVSLQKALDMVHKNTHEYVAVLFYASWCAFSRTCRPTFSILSSLYPSMPHFAIEES  124

Query  719   AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
             A++PS LSKYGV GFPTLFL+NSTMR RYHGSR+L S + FYGD+TG +T   +  SLDK
Sbjct  125   AVRPSILSKYGVHGFPTLFLLNSTMRVRYHGSRTLGSFIAFYGDVTGMKTEPLERASLDK  184

Query  539   IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
             +   S+  +   SEQESCPF+W+RSP+N L+QETYLALA  FV++R LY I PA+    +
Sbjct  185   MASPSHHAKRDNSEQESCPFTWARSPENLLQQETYLALAVTFVVLRSLYFILPALLVCVQ  244

Query  359   ASRRCILNLRTR----SSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
              + R  L   +     S WEYP    +RA+Q FNSLKEPCKRSNLQEGAMNA+AWASKSL
Sbjct  245   CAWRRHLQYTSLGGLWSLWEYPLTYLNRAIQLFNSLKEPCKRSNLQEGAMNARAWASKSL  304

Query  191   ASVSIGD  171
             ASVSIGD
Sbjct  305   ASVSIGD  311



>ref|XP_007222969.1| hypothetical protein PRUPE_ppa008937mg [Prunus persica]
 gb|EMJ24168.1| hypothetical protein PRUPE_ppa008937mg [Prunus persica]
Length=313

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 222/307 (72%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE-IKSSCS  909
             +R W+ G+ +L++  RL  A   T+      C   S  D IF    S+C  +   +S  S
Sbjct  3     IRVWQTGIVILLLWVRLISAAEPTS------CPTESVSDAIFGFRYSSCPANGGARSVDS  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ +H+YVA+LFYASWCPFSR FKP FS+++S  P +PHFA 
Sbjct  57    IGVIVGDEVSLQRALNMVHKNTHEYVAVLFYASWCPFSRMFKPTFSILASSYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPT+F++NSTMR RY GSR+  SL+ FY D+TG +T S D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTIFILNSTMRVRYQGSRTPGSLIAFYSDITGIKTVSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI    N  +   +EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY  FP +  
Sbjct  177   LEKIGYPLNHEKHESTEQESCPFSWARSPENMLRQETYLALASAFVLLRLLYFFFPTLLS  236

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++++ RR I N+R  S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   FAQSAWRRNIRNMRLGSLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>ref|XP_009334329.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Pyrus x bretschneideri]
Length=313

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 224/307 (73%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCS  909
             +R W +G+ +L++  RL CA       PA C ++ S  D IF    S C +D   +S  S
Sbjct  3     IRVWESGIVILVLWVRLVCAAE-----PASCPTE-SVADRIFGFRYSNCPVDGACRSVES  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57    MGVIVGDEVSLQRALNMVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPTLF++NSTMR RY G+R+  SL+ FY  +TG +T S D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTLFILNSTMRIRYQGARTPGSLIAFYRHVTGFKTVSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI    N  +   +EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY   PA+  
Sbjct  177   LEKIGYPLNHEKHDSTEQESCPFSWARSPENLLRQETYLALASAFVLLRLLYFFLPALLS  236

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++++ RR I ++   S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   FAQSAWRRHIQDMILGSLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>ref|XP_009334346.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Pyrus x bretschneideri]
Length=313

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 224/307 (73%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCS  909
             +R W +G+ +L++  RL CA       PA C ++ S  D IF    S C +D   +S  S
Sbjct  3     IRVWESGIVILVLWVRLVCAAE-----PASCPTE-SVADRIFGFRYSNCPVDGACRSVES  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57    MGVIVGDEVSLQRALNMVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS LSKYGV GFPTLF++NSTMR RY G+R+  SL+ FY  +TG +T S D +S
Sbjct  117   EESAIRPSILSKYGVHGFPTLFILNSTMRIRYQGARTPGSLIAFYRHVTGFKTVSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI    N  +   +EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY   PA+  
Sbjct  177   LEKIGYPLNHEKHDSTEQESCPFSWARSPENLLRQETYLALASAFVLLRLLYFFLPALLT  236

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++++ RR + ++   S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSL
Sbjct  237   FAQSAWRRHVQDMILGSLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSL  296

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  297   ATVSIGD  303



>ref|XP_007136256.1| hypothetical protein PHAVU_009G031500g [Phaseolus vulgaris]
 gb|ESW08250.1| hypothetical protein PHAVU_009G031500g [Phaseolus vulgaris]
Length=323

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/276 (61%), Positives = 208/276 (75%), Gaps = 5/276 (2%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  813
            C  +S  D++   PDS C + +  S  S AV EGDE SLQ+AL++VH+ +H+YVA+LFYA
Sbjct  43   CPVHSLLDFVLGFPDSICPLPD--SLGSVAVTEGDEVSLQKALNMVHKNNHEYVAVLFYA  100

Query  812  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRY  633
            SWCPFSR F+P+FSV+S+L P +PHFAIEES+++PS LSKYGV GFPTLF++NSTMR RY
Sbjct  101  SWCPFSRVFRPVFSVLSALHPSIPHFAIEESSVRPSILSKYGVHGFPTLFILNSTMRVRY  160

Query  632  HGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNF  453
            HGSR+L SL+ FY D+TG    S D +SL+KI  SS     G  E ESCPFSW+RSP+N 
Sbjct  161  HGSRTLASLIGFYNDVTGIRIDSFDQLSLEKIGRSSTDKSHGNPEPESCPFSWARSPENL  220

Query  452  LRQETYLALATAFVLMRLLYVIFPA--VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQ  279
            LRQETYLALAT FV++RLLY  FP   +C    A RR I N+R  S  E+P +   R +Q
Sbjct  221  LRQETYLALATTFVVLRLLYYFFPTLLIC-IQFAWRRVIQNIRLGSLLEHPLIYLKRLIQ  279

Query  278  FFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             FN LKEPCKRSNLQEGA+NA+AWASKSLA+VSIG+
Sbjct  280  SFNCLKEPCKRSNLQEGALNARAWASKSLATVSIGE  315



>gb|KHN03900.1| 5'-adenylylsulfate reductase-like 4 [Glycine soja]
Length=321

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 220/313 (70%), Gaps = 9/313 (3%)
 Frame = -2

Query  1088  RLREWRAGMAL-LMIVGRLTCA-----HTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE  927
             R+R W   +   + + G L+C      + ++       C   S  D++   PDSTC +  
Sbjct  2     RMRIWVLEIVFAIFLCGTLSCTAQPHHNRVSLSTTTSICHAGSLLDFVLGFPDSTCPL--  59

Query  926   IKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPW  747
             + S  S AVIEGDE SLQ+AL++VH+ +H+YVA+LFYASWCPFSR FKPIFSV+SSL P 
Sbjct  60    LNSLGSIAVIEGDEVSLQKALNMVHKNNHEYVAVLFYASWCPFSRVFKPIFSVLSSLHPS  119

Query  746   VPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETS  567
             +PHFAIEES+++PS LSKYGV GFPTLF++NSTMR RYHGSR+L SL+ FY D+TG    
Sbjct  120   IPHFAIEESSVRPSILSKYGVHGFPTLFILNSTMRVRYHGSRTLGSLIGFYNDVTGIMID  179

Query  566   SKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVI  387
             S D +SL+KI  SS     G +E ESCPFSW+RSP+N LRQETYLALAT FV+ RLLY+ 
Sbjct  180   SLDQLSLEKISRSSADESHGSTEPESCPFSWARSPENLLRQETYLALATTFVVFRLLYLF  239

Query  386   FPAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKA  210
             FP +    R A RR I ++R     E+P +   R  Q FN LK PCKR NLQEGAMNA+A
Sbjct  240   FPTLLICIRYALRRVIQSIRIWCLLEHPLIYLKRLTQSFNCLKVPCKRRNLQEGAMNARA  299

Query  209   WASKSLASVSIGD  171
             WASKSLA+VSIG+
Sbjct  300   WASKSLATVSIGE  312



>gb|KHN19767.1| 5'-adenylylsulfate reductase-like 4 [Glycine soja]
Length=322

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/316 (56%), Positives = 223/316 (71%), Gaps = 14/316 (4%)
 Frame = -2

Query  1088  RLREWRAGMAL-LMIVGRLTCAH-------TLTAPFPALCCSKYSAKDWIFALPDSTCSI  933
             R+R W + +   L++ G L+C         +L+     +C ++ S  D+I   PDSTC +
Sbjct  2     RMRVWGSEIVFALLLCGTLSCTAQAIHNRVSLSTTTTTICPAR-SLLDFILGFPDSTCPL  60

Query  932   DEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLL  753
                 S  S AV EGDE SLQ+AL++VH+ +H+YVA+LFYASWCPFSR F+ +FSV+S+L 
Sbjct  61    P--NSLGSIAVTEGDEVSLQKALNMVHKNNHEYVAVLFYASWCPFSRVFRSVFSVLSALH  118

Query  752   PWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE  573
             P +PHFAIEES ++PS LSKYGV GFPTLF++NSTMR RYHGSR+L SL+ FY D+TG  
Sbjct  119   PSIPHFAIEESLVRPSILSKYGVHGFPTLFILNSTMRVRYHGSRTLGSLIGFYNDVTGIM  178

Query  572   TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLY  393
               S D +SL+KI  SS     G +E ESCPFSW+RSP+N LRQETYLALAT FV++RLLY
Sbjct  179   IDSLDQLSLEKIGRSSADESHGNTEPESCPFSWARSPENLLRQETYLALATTFVVLRLLY  238

Query  392   VIFPA--VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMN  219
             + FP   +C      RR I N+R  S  E+P +   R  Q FN LKEPCKR NLQEGAMN
Sbjct  239   LFFPTLLIC-IQYTWRRVIQNIRIWSLLEHPLVYLKRLTQSFNCLKEPCKRRNLQEGAMN  297

Query  218   AKAWASKSLASVSIGD  171
             A+AWASKSLA+VSIG+
Sbjct  298   ARAWASKSLATVSIGE  313



>ref|XP_006581537.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Glycine 
max]
Length=321

 Score =   337 bits (864),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 220/313 (70%), Gaps = 9/313 (3%)
 Frame = -2

Query  1088  RLREWRAGMAL-LMIVGRLTCA-----HTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE  927
             R+R W   +   + + G L+C      + ++       C   S  D++   PDSTC +  
Sbjct  2     RMRIWVLEIVFAIFLCGTLSCTAQPHHNRVSLSTTTSICPAGSLLDFVLGFPDSTCPL--  59

Query  926   IKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPW  747
             + S  S AVIEGDE SLQ+AL++VH+ +H+YVA+LFYASWCPFSR FKPIFSV+SSL P 
Sbjct  60    LNSLGSIAVIEGDEVSLQKALNMVHKNNHEYVAVLFYASWCPFSRVFKPIFSVLSSLHPS  119

Query  746   VPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETS  567
             +PHFAIEES+++PS LSKYGV GFPTLF++NSTMR RYHGSR+L SL+ FY D+TG    
Sbjct  120   IPHFAIEESSVRPSILSKYGVHGFPTLFILNSTMRVRYHGSRTLGSLIGFYNDVTGIMID  179

Query  566   SKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVI  387
             S D +SL+KI  SS     G +E ESCPFSW+RSP+N LRQETYLALAT FV+ RLLY+ 
Sbjct  180   SLDQLSLEKISRSSADESHGSTEPESCPFSWARSPENLLRQETYLALATTFVVFRLLYLF  239

Query  386   FPAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKA  210
             FP +    R A RR I ++R     E+P +   R  Q FN LK PCKR NLQEGAMNA+A
Sbjct  240   FPTLLICIRYAWRRVIQSIRIWCLLEHPLIYLKRLTQSFNCLKVPCKRRNLQEGAMNARA  299

Query  209   WASKSLASVSIGD  171
             WASKSLA+VSIG+
Sbjct  300   WASKSLATVSIGE  312



>ref|XP_003522795.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Glycine 
max]
Length=324

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/317 (56%), Positives = 219/317 (69%), Gaps = 14/317 (4%)
 Frame = -2

Query  1088  RLREWRAGMAL-LMIVGRLTCAHTLTAPFPAL--------CCSKYSAKDWIFALPDSTCS  936
             R+R W + +   L++ G L+C         +L         C   S  D+I   PDSTC 
Sbjct  2     RMRVWGSEIVFALLLCGTLSCTAQAIHNRVSLSTTTTTTTICPARSLLDFILGFPDSTCP  61

Query  935   IDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSL  756
             +    S  S AV EGDE SLQ+AL++VH+ +H+YVA+LFYASWCPFSR F+ +FSV+S+L
Sbjct  62    LP--NSLGSIAVTEGDEVSLQKALNMVHKNNHEYVAVLFYASWCPFSRVFRSVFSVLSAL  119

Query  755   LPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGA  576
              P +PHFAIEES ++PS LSKYGV GFPTLF++NSTMR RYHGSR+L SL+ FY D+TG 
Sbjct  120   HPSIPHFAIEESLVRPSILSKYGVHGFPTLFILNSTMRVRYHGSRTLGSLIGFYNDVTGI  179

Query  575   ETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLL  396
                S D +SL+KI  SS     G +E ESCPFSW+RSP+N LRQETYLALAT FV++RLL
Sbjct  180   MIDSLDQLSLEKIGRSSADESHGNTEPESCPFSWARSPENLLRQETYLALATTFVVLRLL  239

Query  395   YVIFPA--VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAM  222
             Y+ FP   +C      RR I N+R  S  E+P +   R  Q FN LKEPCKR NLQEGAM
Sbjct  240   YLFFPTLLIC-IQYTWRRVIQNIRIWSLLEHPLVYLKRLTQSFNCLKEPCKRRNLQEGAM  298

Query  221   NAKAWASKSLASVSIGD  171
             NA+AWASKSLA+VSIG+
Sbjct  299   NARAWASKSLATVSIGE  315



>gb|KJB14728.1| hypothetical protein B456_002G140600 [Gossypium raimondii]
Length=319

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 220/307 (72%), Gaps = 7/307 (2%)
 Frame = -2

Query  1082  REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID--EIKSSCS  909
             + W+  M +L+   RLTCA  +  P     C K S  D IF   DS C I     +S   
Sbjct  4     KAWQTRMLILVFWWRLTCA--VFVPLRVPLCPKVSVSDAIFDFRDSYCPITSARTQSIVF  61

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VIEGDE S+Q+AL++V+R  H YVA+LFYASWCPFSR F+  F+++SS  P +PHFAI
Sbjct  62    VGVIEGDEVSMQKALNMVYRNGHGYVAVLFYASWCPFSRSFRRSFNILSSSYPCIPHFAI  121

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EES+++PS LSKYGV GFPTLFL+NSTMR RYHG+RS +SL  FY D+TG + +S D  S
Sbjct  122   EESSVRPSILSKYGVHGFPTLFLLNSTMRARYHGNRSFESLGAFYSDVTGIK-NSLDKTS  180

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI   SN+ +   +EQESCPFSW+RSP+N LRQETYLALAT FVL RLLY+++P    
Sbjct  181   LEKIGHLSNQEKHNSTEQESCPFSWARSPENLLRQETYLALATTFVLFRLLYLLYPTFLV  240

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++ + RR I N++  +  E+P     RA+Q FNSLKEPCKRSNLQ GAMNA+AWASKSL
Sbjct  241   FAQLTWRRLIRNVKLGTLLEHPLAYLKRAIQLFNSLKEPCKRSNLQ-GAMNARAWASKSL  299

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  300   ATVSIGD  306



>ref|XP_009778518.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X2 [Nicotiana 
sylvestris]
Length=299

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 216/305 (71%), Gaps = 28/305 (9%)
 Frame = -2

Query  1094  MARLREWRAG-MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFA--LPDSTCSIDEI  924
             M  L  W A  + LLM+   L    T T  F ++C  K S KD IF     D TC +D I
Sbjct  1     MGLLSVWAAVFVVLLMVFEGLASPETRTMSFRSVCPLK-SIKDSIFMGFHQDLTCPLDGI  59

Query  923   KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
             +SS    VI+GDE +L RAL+++HR +HDYVALLFYASWCPFS  F+P FSV+SSL P +
Sbjct  60    QSSYMAGVIQGDELALHRALNLIHRNTHDYVALLFYASWCPFSGSFRPKFSVLSSLFPSI  119

Query  743   PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSS  564
             PHFAIEESA+KPSTLSKYGV GFPTLFL+NSTMR RYHGSR+LDS+++FY   TG + +S
Sbjct  120   PHFAIEESAVKPSTLSKYGVHGFPTLFLLNSTMRIRYHGSRTLDSVIEFYSGSTGFQIAS  179

Query  563   KDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIF  384
              D+ SL K RCSSN  +  GS+QE+CPFSW+RSP+N L+QETYLALATAFVLMRLLY +F
Sbjct  180   VDDTSLGKTRCSSNHLKLHGSDQENCPFSWARSPENLLQQETYLALATAFVLMRLLYKLF  239

Query  383   PAVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
             PA+        R I +L    SWE             ++L EPCKRSNLQEGAMNAKAWA
Sbjct  240   PAL--------RKIAHL----SWER------------SNLHEPCKRSNLQEGAMNAKAWA  275

Query  203   SKSLA  189
             SKSLA
Sbjct  276   SKSLA  280



>gb|KEH34942.1| 5-adenylylsulfate reductase-like protein [Medicago truncatula]
Length=312

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 214/308 (69%), Gaps = 8/308 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-DEIKSSCS  909
             +R WR+ +   +    L C  T  +      C K S  D++    DS CS+ D + S   
Sbjct  1     MRLWRSEIVFAI----LLCCGTAQSLSTTAVCPKESLSDFVLGFSDSICSLSDSLGSIHY  56

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               V +GDE SLQ+AL++VH+  H+YVA+LFYASWCPFSR F+P+FSV+SSL P +PHFAI
Sbjct  57    VGVTQGDEASLQKALNMVHKNYHEYVAVLFYASWCPFSRIFRPVFSVISSLHPTIPHFAI  116

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EES+++PSTLSKYGV GFPTLF++NSTMR RY GSR+L SLV FY D+TG +  S D +S
Sbjct  117   EESSVRPSTLSKYGVHGFPTLFILNSTMRVRYQGSRTLGSLVGFYNDVTGIKIDSLDQLS  176

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPA--V  375
             L+KI   S       +E ESCPFSW+RSP+N L QETYLALATAFV +RLLY+ FP   +
Sbjct  177   LEKIGNPSANENHVDTEPESCPFSWARSPENLLGQETYLALATAFVALRLLYLFFPTLLI  236

Query  374   CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKS  195
             C    A  R I N+R  S  E+P +   R +Q    LKEPCKRSNLQEGAMNAKAWASKS
Sbjct  237   C-IQYAWGRVIQNVRLWSLLEHPLVYLKRIIQSIYRLKEPCKRSNLQEGAMNAKAWASKS  295

Query  194   LASVSIGD  171
             LA+VSIG+
Sbjct  296   LATVSIGE  303



>ref|XP_010676416.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 215/300 (72%), Gaps = 6/300 (2%)
 Frame = -2

Query  1064  MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDE  885
             + LL++ G +    +     P  C +  S  D I   PDS C   ++  S S AVIEGDE
Sbjct  8     LVLLVVFGEIISGDSARVSEPGYCPAA-SMTDSILGFPDSVC---DLHHSYSIAVIEGDE  63

Query  884   KSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPS  705
              SLQ+AL +V+  S DYVA+LFYASWCPFSR F+P FS +SSL P +PHFAIEES I+PS
Sbjct  64    ASLQKALHLVYSLSQDYVAVLFYASWCPFSRNFRPSFSTLSSLYPSIPHFAIEESTIRPS  123

Query  704   TLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSS  525
              LSKYGV GFPTLFL+NSTMR RY GSRSL SLV FY D+TG +   +D + L+KI   S
Sbjct  124   ILSKYGVHGFPTLFLLNSTMRVRYRGSRSLGSLVAFYSDVTGIKGDPRDQLPLEKIEDLS  183

Query  524   NKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RR  348
             N+  +  +E E+CPFSW+RSP+N LR ETYLALAT FVL+R+LY++FP +  FSR++ RR
Sbjct  184   NRASNDNTELENCPFSWARSPENLLRHETYLALATTFVLLRMLYLLFPYLLEFSRSTWRR  243

Query  347   CILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLAS-VSIGD  171
              + ++R R+ WE+P    +R  Q F+ +K+PCK SN QEGA+NA+AWASKSLAS VSIGD
Sbjct  244   YMQHVRIRTLWEHPLRHLNRVKQLFSFVKDPCKGSNFQEGAINARAWASKSLASAVSIGD  303



>ref|XP_011004793.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Populus euphratica]
Length=325

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 222/313 (71%), Gaps = 6/313 (2%)
 Frame = -2

Query  1094  MARLREWRAGMAL-LMIVGRLT--CAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI  924
             M + R W+  + + LMI G L   CA   ++   ++C  + S  D IF   D  C +  +
Sbjct  1     MMQTRVWQTRILVSLMIYGSLMLMCAAAASSNKVSICPIE-SVADSIFGFRDRNCVVSGV  59

Query  923   -KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPW  747
              +S       EGDE SLQ+AL++V +  H+YVALLFYASWCPFSR F+P FS++SSL P 
Sbjct  60    DESPFFPGFTEGDEVSLQKALNLVQKNRHEYVALLFYASWCPFSRTFRPSFSILSSLYPS  119

Query  746   VPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETS  567
             +PHFAIEES+I+PS LSKYGV GFPTLFL NSTMR  YHGSR+L SLV FY D+TG +T+
Sbjct  120   IPHFAIEESSIRPSILSKYGVHGFPTLFLFNSTMRVCYHGSRTLGSLVSFYSDVTGIKTA  179

Query  566   SKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVI  387
             S D  SLDKI  +S+  +    EQESCPFSW+RSP+N  R+ETYLALAT FVL+RL Y  
Sbjct  180   SLDKESLDKIGRASHHEKHDAPEQESCPFSWARSPENLFREETYLALATTFVLLRLFYWT  239

Query  386   FPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKA  210
             F  +  F++ + RR + N+R  S  E+P+   +RA+Q FNSL EPCK+SNLQEGA+NA+A
Sbjct  240   FTTMLAFAQFTWRRHMQNMRLESLLEHPRAYLNRAIQLFNSLNEPCKKSNLQEGALNARA  299

Query  209   WASKSLASVSIGD  171
             WASKSLA+VSIGD
Sbjct  300   WASKSLATVSIGD  312



>gb|KDP41389.1| hypothetical protein JCGZ_15796 [Jatropha curcas]
Length=323

 Score =   329 bits (844),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 219/309 (71%), Gaps = 3/309 (1%)
 Frame = -2

Query  1091  ARLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-DEIKSS  915
             AR+   R G+  ++++     +     P   L C + S  D IF   D +C + D  +S 
Sbjct  3     ARVWLRRIGILFVLLMMWSPISAAAADPSRVLMCPRESLVDSIFGFLDRSCIVYDTAESP  62

Query  914   CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  735
                 VIEGDE SLQ+AL++VH+  + Y+A+LFYASWCPFSR F+P FS++SSL P +PHF
Sbjct  63    GFVGVIEGDEVSLQKALNMVHKNGYKYLAVLFYASWCPFSRNFRPSFSLLSSLYPSIPHF  122

Query  734   AIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDN  555
             AIEES+++PS LSKYGV GFPTL++ NSTMR RYHGSR+L SLV FY D+TG ET+S   
Sbjct  123   AIEESSVRPSILSKYGVHGFPTLYIFNSTMRDRYHGSRTLGSLVAFYTDVTGIETASLHK  182

Query  554   ISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
              SLDKI   SN  +    EQESCPFSW+RSP+N  RQETYLA ATAFVL+RL+Y  FP +
Sbjct  183   GSLDKIVHPSNHEKHDSDEQESCPFSWARSPENLFRQETYLAFATAFVLLRLVYFFFPPL  242

Query  374   CRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASK  198
               F++ A  R   N+R RS  E+P++  ++ +Q  NSLKEPC++SNLQ GAMNA+AWASK
Sbjct  243   LVFAKFAWGRHFRNMRLRSLLEHPRVYLNQIIQVLNSLKEPCRKSNLQ-GAMNARAWASK  301

Query  197   SLASVSIGD  171
             SLA+VSIGD
Sbjct  302   SLATVSIGD  310



>ref|XP_012067882.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Jatropha curcas]
Length=324

 Score =   329 bits (843),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 171/312 (55%), Positives = 219/312 (70%), Gaps = 5/312 (2%)
 Frame = -2

Query  1094  MARLREW--RAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-DEI  924
             M   R W  R G+  ++++     +     P   L C + S  D IF   D +C + D  
Sbjct  1     MMGARVWLRRIGILFVLLMMWSPISAAAADPSRVLMCPRESLVDSIFGFLDRSCIVYDTA  60

Query  923   KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
             +S     VIEGDE SLQ+AL++VH+  + Y+A+LFYASWCPFSR F+P FS++SSL P +
Sbjct  61    ESPGFVGVIEGDEVSLQKALNMVHKNGYKYLAVLFYASWCPFSRNFRPSFSLLSSLYPSI  120

Query  743   PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSS  564
             PHFAIEES+++PS LSKYGV GFPTL++ NSTMR RYHGSR+L SLV FY D+TG ET+S
Sbjct  121   PHFAIEESSVRPSILSKYGVHGFPTLYIFNSTMRDRYHGSRTLGSLVAFYTDVTGIETAS  180

Query  563   KDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIF  384
                 SLDKI   SN  +    EQESCPFSW+RSP+N  RQETYLA ATAFVL+RL+Y  F
Sbjct  181   LHKGSLDKIVHPSNHEKHDSDEQESCPFSWARSPENLFRQETYLAFATAFVLLRLVYFFF  240

Query  383   PAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAW  207
             P +  F++ A  R   N+R RS  E+P++  ++ +Q  NSLKEPC++SNLQ GAMNA+AW
Sbjct  241   PPLLVFAKFAWGRHFRNMRLRSLLEHPRVYLNQIIQVLNSLKEPCRKSNLQ-GAMNARAW  299

Query  206   ASKSLASVSIGD  171
             ASKSLA+VSIGD
Sbjct  300   ASKSLATVSIGD  311



>ref|XP_010089873.1| 5'-adenylylsulfate reductase-like 4 [Morus notabilis]
 gb|EXB38514.1| 5'-adenylylsulfate reductase-like 4 [Morus notabilis]
Length=1609

 Score =   354 bits (909),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 183/307 (60%), Positives = 227/307 (74%), Gaps = 8/307 (3%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-DEIKSSCS  909
             +R W +G+  L++   L      +A  P +C S +S    IF  P+  CS+  + +S   
Sbjct  1298  VRVWISGIFTLLLWQSLN-----SAAEPNIC-SPHSLIYSIFGFPEGICSLYGDSRSFAF  1351

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VIEGDE SLQRAL++VH+ S+DYVA+LFYASWCPFSR F+P FS++SSL P +PHFAI
Sbjct  1352  NGVIEGDEVSLQRALNMVHKNSYDYVAVLFYASWCPFSRTFRPTFSILSSLYPSIPHFAI  1411

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             +ESAI+P  LSKYGV GFPTLF++NSTMR RYHGSR+  SL+ FYGD+TG +T+S D IS
Sbjct  1412  QESAIRPRILSKYGVHGFPTLFILNSTMRVRYHGSRTPGSLIAFYGDVTGIKTASLDQIS  1471

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             LD I       + G +EQESCPFSW+RSP+N LRQETYLALATAFV++RLL++IFP++  
Sbjct  1472  LDNIGSPPTHEKHGSAEQESCPFSWARSPENLLRQETYLALATAFVVLRLLHLIFPSLLL  1531

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F R + RR I N+R  S  E+P     RAVQ  NSLKEPCKRSNLQ GAMNAKAWASKSL
Sbjct  1532  FVRCAWRRYIRNMRFGSLLEHPMAYLKRAVQLSNSLKEPCKRSNLQGGAMNAKAWASKSL  1591

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  1592  ATVSIGD  1598



>ref|XP_007018757.1| APR-like 4 isoform 1 [Theobroma cacao]
 gb|EOY15982.1| APR-like 4 isoform 1 [Theobroma cacao]
Length=320

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 224/307 (73%), Gaps = 6/307 (2%)
 Frame = -2

Query  1082  REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCS-  909
             + W+ G+ +L++ GRL CA  ++ P     C K+S  D IF   DS C I+ E   S   
Sbjct  4     KAWQTGILMLVLWGRLACA--VSVPVRVPLCPKHSVSDTIFDFRDSYCPINSEFSESVDF  61

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               V EGDE SLQ+AL++VH+ S +YVA+LFYASWCPFSR F+P FS++SSL P +PHFAI
Sbjct  62    VGVTEGDEVSLQKALNMVHKNSREYVAVLFYASWCPFSRSFRPSFSILSSLYPSIPHFAI  121

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             +ES ++PS LSKYGV GFPTLFL+NSTMR RYHG+RS +SL  FY D+TG +  S D  S
Sbjct  122   KESTVRPSILSKYGVHGFPTLFLLNSTMRVRYHGNRSFESLGAFYSDVTGIKNKSLDKTS  181

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             LDKI   SN  +   +EQESCPFSW+RSP+N LRQETYLALAT FVL+RLLY+++P +  
Sbjct  182   LDKIGRLSNHEKHNSTEQESCPFSWARSPENLLRQETYLALATTFVLLRLLYLLYPTLLV  241

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++ + RR I N++  S  E+      RA+Q FNSLKEPCKRSNLQ  AMNA+AWASKSL
Sbjct  242   FAQFTWRRLIRNMKLGSLLEHSLAYLKRAIQLFNSLKEPCKRSNLQR-AMNARAWASKSL  300

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  301   ATVSIGD  307



>ref|XP_002513930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48513.1| conserved hypothetical protein [Ricinus communis]
Length=326

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/311 (56%), Positives = 220/311 (71%), Gaps = 4/311 (1%)
 Frame = -2

Query  1091  ARLREWRAGM--ALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKS  918
             AR+ + R  M   L++I+G    A     P   L C + S  D IF   D +C +    +
Sbjct  3     ARVWQRRIAMFFVLIIILGSSISASAAVNPSWDLMCPRESVLDSIFGFLDRSCVVLPTPN  62

Query  917   SCST-AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  741
             S     V EGDE SLQ+AL++VH+ S  + A+LFYASWCPFSR F+P FS++SSL P + 
Sbjct  63    SPGFFGVTEGDEVSLQKALNLVHKNSQKHAAVLFYASWCPFSRSFRPSFSLLSSLYPSIA  122

Query  740   HFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSK  561
             HFAIEES+++PS LSKYGV GFPTLFL+NSTMR RY GSR+L SLV FY D+TG +T S 
Sbjct  123   HFAIEESSVRPSILSKYGVHGFPTLFLLNSTMRERYQGSRTLGSLVAFYTDVTGIKTVSL  182

Query  560   DNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
             +  SLDKI   S+  +   +EQE+CPFSW+RSP+N  RQETYLALATAFVL+RL+Y+ FP
Sbjct  183   NKESLDKIVRPSHHEKHENNEQENCPFSWARSPENLFRQETYLALATAFVLVRLVYLFFP  242

Query  380   AVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
              +  F++ A RR I NLR  S  E+P+   +  +Q FNSLKEPC++ NLQEGAMNA+AWA
Sbjct  243   TLLLFAQFAWRRHIQNLRLGSLLEHPRAYLNGVMQVFNSLKEPCRKRNLQEGAMNARAWA  302

Query  203   SKSLASVSIGD  171
             SKSLA+VSIGD
Sbjct  303   SKSLATVSIGD  313



>ref|XP_010267539.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Nelumbo nucifera]
Length=324

 Score =   326 bits (836),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 217/309 (70%), Gaps = 6/309 (2%)
 Frame = -2

Query  1082  REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS--  909
             R W  G  LL++ GRLTC+  +      +C    S  D I   PD     + + +  S  
Sbjct  4     RVWHTGFVLLLLFGRLTCSEPVRVSSSEVCPVP-SVADSILRSPDLCAHSNWLSNGDSDG  62

Query  908   --TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  735
                 V EGDE SLQRAL++VH+ S++YV+L FYASWCPFSR  +P F+++SS+ P +PHF
Sbjct  63    DLVGVTEGDEVSLQRALNLVHKNSNEYVSLFFYASWCPFSRACRPTFTILSSMYPSIPHF  122

Query  734   AIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDN  555
             A+EES+I+PS LS+YGV GFPTLFL+NSTMR RYHGSR+++SLV FY D+TG + +S D 
Sbjct  123   AVEESSIRPSILSRYGVHGFPTLFLLNSTMRVRYHGSRTINSLVAFYIDVTGIKPASLDR  182

Query  554   ISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
             +SL+K+   SN      SE+E+CPFSW+RSP+N LRQETYLALAT FVL+RLL+   P +
Sbjct  183   MSLEKMGNPSNLAHLEDSEKENCPFSWARSPENLLRQETYLALATTFVLLRLLHFFLPTL  242

Query  374   CRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASK  198
                 R A RR I N    S W+YP    ++A+Q FN LK PCKRSNLQEGAM+A+AWASK
Sbjct  243   LACVRCAWRRHIQNASLVSLWKYPLTYLNQAIQVFNVLKVPCKRSNLQEGAMSARAWASK  302

Query  197   SLASVSIGD  171
             SLASVSIGD
Sbjct  303   SLASVSIGD  311



>ref|XP_004500630.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like isoform X1 
[Cicer arietinum]
Length=319

 Score =   324 bits (831),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 179/311 (58%), Positives = 223/311 (72%), Gaps = 9/311 (3%)
 Frame = -2

Query  1085  LREWRAGM--ALLMIVGRLTC-AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS  915
             +R W + +  A+L+  G L+C A +LT       C   S  D+I   PDS+CS+ +   S
Sbjct  1     MRLWGSEIFFAILLCCGTLSCTAQSLTTA--TNVCPTESLLDFILGFPDSSCSLSDSLGS  58

Query  914   CS-TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  738
                  V EGDE SLQ+AL++VH+  H+YVA+LFYASWCPFSR F+P+FSV+SSL P +PH
Sbjct  59    IHYIGVTEGDEVSLQKALNMVHKNYHEYVAVLFYASWCPFSRIFRPVFSVLSSLYPSIPH  118

Query  737   FAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKD  558
             FAIEES+++PSTLSKYGV GFPTLF++NSTMR RYHGSR+L SLV FY D+TG    S D
Sbjct  119   FAIEESSVRPSTLSKYGVHGFPTLFILNSTMRDRYHGSRTLGSLVGFYNDVTGIRIDSLD  178

Query  557   NISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPA  378
              +SL+KI   S       +E ESCPFSW+RSP+N LRQETYLALATAFV++RLLY+ FP 
Sbjct  179   QLSLEKIGRPSANENHCKTEPESCPFSWARSPENLLRQETYLALATAFVVLRLLYLFFPT  238

Query  377   --VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
               +C    A RR   N+R     E+P +   R +Q F+ LKEPCKRSNLQEGAMNAKAWA
Sbjct  239   LLIC-IQYAWRRVNQNVRLWCLLEHPLVYLKRIIQSFHRLKEPCKRSNLQEGAMNAKAWA  297

Query  203   SKSLASVSIGD  171
             SKSLA+VSIG+
Sbjct  298   SKSLATVSIGE  308



>ref|XP_004500631.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like isoform X2 
[Cicer arietinum]
Length=317

 Score =   324 bits (831),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 179/311 (58%), Positives = 223/311 (72%), Gaps = 9/311 (3%)
 Frame = -2

Query  1085  LREWRAGM--ALLMIVGRLTC-AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS  915
             +R W + +  A+L+  G L+C A +LT       C   S  D+I   PDS+CS+ +   S
Sbjct  1     MRLWGSEIFFAILLCCGTLSCTAQSLTTA--TNVCPTESLLDFILGFPDSSCSLSDSLGS  58

Query  914   CS-TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  738
                  V EGDE SLQ+AL++VH+  H+YVA+LFYASWCPFSR F+P+FSV+SSL P +PH
Sbjct  59    IHYIGVTEGDEVSLQKALNMVHKNYHEYVAVLFYASWCPFSRIFRPVFSVLSSLYPSIPH  118

Query  737   FAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKD  558
             FAIEES+++PSTLSKYGV GFPTLF++NSTMR RYHGSR+L SLV FY D+TG    S D
Sbjct  119   FAIEESSVRPSTLSKYGVHGFPTLFILNSTMRDRYHGSRTLGSLVGFYNDVTGIRIDSLD  178

Query  557   NISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPA  378
              +SL+KI   S       +E ESCPFSW+RSP+N LRQETYLALATAFV++RLLY+ FP 
Sbjct  179   QLSLEKIGRPSANENHCKTEPESCPFSWARSPENLLRQETYLALATAFVVLRLLYLFFPT  238

Query  377   --VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
               +C    A RR   N+R     E+P +   R +Q F+ LKEPCKRSNLQEGAMNAKAWA
Sbjct  239   LLIC-IQYAWRRVNQNVRLWCLLEHPLVYLKRIIQSFHRLKEPCKRSNLQEGAMNAKAWA  297

Query  203   SKSLASVSIGD  171
             SKSLA+VSIG+
Sbjct  298   SKSLATVSIGE  308



>gb|KDO80980.1| hypothetical protein CISIN_1g020846mg [Citrus sinensis]
Length=250

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 191/234 (82%), Gaps = 1/234 (0%)
 Frame = -2

Query  869  ALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKY  690
            AL++VH+ SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIEESAI+PS LSKY
Sbjct  2    ALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIEESAIRPSILSKY  61

Query  689  GVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRD  510
            GV GFPTLFL+NS+MR RYHGSR+LDSLV FY D+TG  T+S D IS DK+  +SN  + 
Sbjct  62   GVHGFPTLFLLNSSMRVRYHGSRTLDSLVAFYSDVTGMNTASLDKISPDKVGKASNHEKH  121

Query  509  GGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNL  333
              +E+ESCPFSW+RSP+N L+QETYLALATAFVL+RL+Y+  P +  F++ + RR I NL
Sbjct  122  NNTEEESCPFSWARSPENLLQQETYLALATAFVLLRLVYIFLPTLLIFAQFTWRRLIRNL  181

Query  332  RTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            +  S  E+P+   +RA+Q F +L EPCKRSNLQEGA+NA+AWASKSLA+VSIGD
Sbjct  182  KLGSLLEHPRTYLNRAIQLFKTLNEPCKRSNLQEGALNARAWASKSLATVSIGD  235



>ref|XP_002306572.2| hypothetical protein POPTR_0005s17150g [Populus trichocarpa]
 gb|EEE93568.2| hypothetical protein POPTR_0005s17150g [Populus trichocarpa]
Length=326

 Score =   324 bits (830),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 220/321 (69%), Gaps = 21/321 (7%)
 Frame = -2

Query  1094  MARLREWRAGMAL-LMIVGRLT--CAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI  924
             M + R W+  + + LMI G L   CA   ++   ++C  + S  D IF   D  C +  +
Sbjct  1     MMQTRVWQTRILVSLMIYGSLMLMCATAASSNTVSICPIE-SVTDSIFGFRDRNCVVSGV  59

Query  923   KSS---------CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
               S             V++GDE SLQ+AL++V + SH+YVALLFYASWCPFSR F+P FS
Sbjct  60    DESPFFPGFTEKFMFVVVKGDEVSLQKALNLVQKNSHEYVALLFYASWCPFSRTFRPSFS  119

Query  770   VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             ++SSL P +PHFAIEES+I+PS LSKYGV GFPTLFL NSTMR  YHGSR+L SL+ FY 
Sbjct  120   ILSSLYPSIPHFAIEESSIRPSILSKYGVHGFPTLFLFNSTMRVCYHGSRTLGSLIAFYS  179

Query  590   DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
             D+TG         SLDKI  +S+  +    EQESCPFSW+RSP+N  R+ETYLALAT FV
Sbjct  180   DVTGKG-------SLDKIGRASHHEKHDAPEQESCPFSWARSPENLFREETYLALATTFV  232

Query  410   LMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQ  234
             L+RL Y  FP +  F++ + RR + N+R  S  E+P+   +RA+Q FNSL EPCK+SNLQ
Sbjct  233   LLRLFYWTFPTMLAFAQFTWRRHMQNMRLESLLEHPRAYLNRAIQLFNSLNEPCKKSNLQ  292

Query  233   EGAMNAKAWASKSLASVSIGD  171
             EGAMNA+AWASKSLA+VSIGD
Sbjct  293   EGAMNARAWASKSLATVSIGD  313



>ref|XP_004500632.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like isoform X3 
[Cicer arietinum]
Length=319

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 222/311 (71%), Gaps = 9/311 (3%)
 Frame = -2

Query  1085  LREWRAGM--ALLMIVGRLTC-AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS  915
             +R W + +  A+L+  G L+C A +LT       C   S  D+I   PDS+CS+ +   S
Sbjct  1     MRLWGSEIFFAILLCCGTLSCTAQSLTTA--TNVCPTESLLDFILGFPDSSCSLSDSLGS  58

Query  914   CS-TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  738
                  V EGDE SLQ+AL++VH+  H+YVA+LFYASWCPFSR F+P+FSV+SSL P +PH
Sbjct  59    IHYIGVTEGDEVSLQKALNMVHKNYHEYVAVLFYASWCPFSRIFRPVFSVLSSLYPSIPH  118

Query  737   FAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKD  558
             FAIEES+++PSTLSKYGV G PTLF++NSTMR RYHGSR+L SLV FY D+TG    S D
Sbjct  119   FAIEESSVRPSTLSKYGVHGXPTLFILNSTMRDRYHGSRTLGSLVGFYNDVTGIRIDSLD  178

Query  557   NISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPA  378
              +SL+KI   S       +E ESCPFSW+RSP+N LRQETYLALATAFV++RLLY+ FP 
Sbjct  179   QLSLEKIGRPSANENHCKTEPESCPFSWARSPENLLRQETYLALATAFVVLRLLYLFFPT  238

Query  377   --VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
               +C    A RR   N+R     E+P +   R +Q F+ LKEPCKRSNLQEGAMNAKAWA
Sbjct  239   LLIC-IQYAWRRVNQNVRLWCLLEHPLVYLKRIIQSFHRLKEPCKRSNLQEGAMNAKAWA  297

Query  203   SKSLASVSIGD  171
             SKSLA+VSIG+
Sbjct  298   SKSLATVSIGE  308



>gb|KJB64265.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64266.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64267.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64268.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64269.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64270.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
Length=321

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 204/286 (71%), Gaps = 4/286 (1%)
 Frame = -2

Query  1019  LTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTAVIEGDEKSLQRALDVVHRR  846
             ++ P     C K S  D IF   DS C I  D  +S     V EGDE SLQ+ L++VH+ 
Sbjct  24    VSGPVRVPFCLKESISDAIFDFRDSYCPINSDFTESIDFVGVTEGDEVSLQKVLNMVHKN  83

Query  845   SHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTL  666
             SHDYVA+LFYASWCPFSR F+P FS++SS  P +PHFAIEESA++PS LSKYGV GFPTL
Sbjct  84    SHDYVAVLFYASWCPFSRSFRPTFSILSSSYPSIPHFAIEESAVRPSILSKYGVHGFPTL  143

Query  665   FLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESC  486
             FL+NSTM  RY G+R+ +SL  FY D+TG    S D  S++KI   SN  +   +E ESC
Sbjct  144   FLLNSTMHVRYLGNRTFESLGAFYCDVTGIRKKSLDKASINKIGHLSNHEKHNSTEPESC  203

Query  485   PFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCIL-NLRTRSSWEY  309
             PF W+RSP+N LRQETYLALAT FVL+R LY+++P +  F+  + R ++ NL+  S  E+
Sbjct  204   PFPWARSPENLLRQETYLALATTFVLLRSLYLLYPTLLVFAHFTWRLLIRNLKLGSLLEH  263

Query  308   PQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             P     RA+Q FNSLKEPCKRSNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  264   PLAYLKRAIQLFNSLKEPCKRSNLQ-GAMNARAWASKSLATVSIGD  308



>ref|XP_008444841.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Cucumis melo]
Length=321

 Score =   316 bits (809),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 209/291 (72%), Gaps = 6/291 (2%)
 Frame = -2

Query  1028  AHTLTAPFPALCCSKYSAKDWIFALPDS--TCSID-EIKSSCSTAVIEGDEKSLQRALDV  858
             AH++ AP     C   S  D IF   DS   C    +++      V EGDE SLQ AL++
Sbjct  23    AHSVRAPDSPPFCPAESFLDTIFRFRDSYSNCPFHGDVRHYEFIGVSEGDEASLQMALNM  82

Query  857   VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIG  678
             VH   ++YV++LFYASWCPFS+ F+P FS++SSL   +PHFAI+ESA++PS LSKYGV G
Sbjct  83    VHSNRYEYVSVLFYASWCPFSKSFRPSFSILSSLYASIPHFAIQESAVRPSILSKYGVHG  142

Query  677   FPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHR-DGGS  501
             FPTLFL+NSTMR RY+GSR+L SLV FY D+TG +T+S D IS D+I    N+ + D  S
Sbjct  143   FPTLFLLNSTMRARYYGSRTLSSLVAFYNDVTGIQTASLDQISPDRIGQVWNREKHDDNS  202

Query  500   EQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR-ASRRCILNLRTR  324
             EQE+CPFSW+RSP+N LR+ETYLALATAFVLMRL+Y+ FP +  ++R   RR + N+R  
Sbjct  203   EQENCPFSWARSPENLLREETYLALATAFVLMRLVYIFFPTLLVYARYVWRRHLRNMRLG  262

Query  323   SSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             + WE P  C   A+Q F+  K+PCKRSNLQ GAMNAKAWA KS A+VSIGD
Sbjct  263   TLWERPLTCMKGAIQLFSHFKDPCKRSNLQGGAMNAKAWA-KSFATVSIGD  312



>ref|XP_007222968.1| hypothetical protein PRUPE_ppa008937mg [Prunus persica]
 gb|EMJ24167.1| hypothetical protein PRUPE_ppa008937mg [Prunus persica]
Length=241

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 183/231 (79%), Gaps = 1/231 (0%)
 Frame = -2

Query  860  VVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVI  681
            +VH+ +H+YVA+LFYASWCPFSR FKP FS+++S  P +PHFA EESAI+PS LSKYGV 
Sbjct  1    MVHKNTHEYVAVLFYASWCPFSRMFKPTFSILASSYPSIPHFAFEESAIRPSILSKYGVH  60

Query  680  GFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGS  501
            GFPT+F++NSTMR RY GSR+  SL+ FY D+TG +T S D +SL+KI    N  +   +
Sbjct  61   GFPTIFILNSTMRVRYQGSRTPGSLIAFYSDITGIKTVSLDQLSLEKIGYPLNHEKHEST  120

Query  500  EQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTR  324
            EQESCPFSW+RSP+N LRQETYLALA+AFVL+RLLY  FP +  F++++ RR I N+R  
Sbjct  121  EQESCPFSWARSPENMLRQETYLALASAFVLLRLLYFFFPTLLSFAQSAWRRNIRNMRLG  180

Query  323  SSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            S  E+P     RAVQ FNSLKEPCKRSNLQEGAMNA+ WASKSLA+VSIGD
Sbjct  181  SLLEHPLAFLKRAVQLFNSLKEPCKRSNLQEGAMNARVWASKSLATVSIGD  231



>ref|XP_011074264.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Sesamum indicum]
Length=306

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 204/289 (71%), Gaps = 15/289 (5%)
 Frame = -2

Query  1034  TCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVV  855
             TCA+T+  P   L C   S KD+IFA  D  CS+ E + + +T V EG+E +LQ+AL+++
Sbjct  19    TCAYTVRVP---LVCPVNSVKDFIFASQDDMCSLGEAEFAYTTGVTEGNEITLQKALNII  75

Query  854   HRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGF  675
             H+  H YVALLFY+SWCPFS  F+P FS++SS+ P+VPHFAIEESA++PS LSKYGV GF
Sbjct  76    HKNEHAYVALLFYSSWCPFSGPFRPSFSMLSSIFPYVPHFAIEESAVRPSILSKYGVHGF  135

Query  674   PTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQ  495
             PTL L+NSTMR RY GSR+LDSL+ FYG+ TG +  +    S DK  CS     +  S Q
Sbjct  136   PTLILLNSTMRMRYQGSRTLDSLISFYGEFTGIKPLAHGG-SFDKTGCSGYD-ENHESYQ  193

Query  494   ESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR-ASRRCILNLRTRSS  318
             ESCPF W+RSP         LALAT FV++RLL+  FP + R +R A RR  +N+   S 
Sbjct  194   ESCPFPWARSP---------LALATIFVILRLLHFAFPTIRRCTRLAWRRYTINVSLSSL  244

Query  317   WEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             WE+P +   + +Q FNSLKEPCKRSNLQEGA NAKAWASKSLA+VS GD
Sbjct  245   WEHPVVYLKQVIQLFNSLKEPCKRSNLQEGAKNAKAWASKSLATVSFGD  293



>ref|XP_004152636.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Cucumis sativus]
 gb|KGN62696.1| hypothetical protein Csa_2G368970 [Cucumis sativus]
Length=321

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/307 (54%), Positives = 213/307 (69%), Gaps = 8/307 (3%)
 Frame = -2

Query  1076  WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI---DEIKSSCST  906
             W  G+ L  ++  L   H++        C   S  D IF   DS  +     +++     
Sbjct  9     WVIGILLFSLL--LGFTHSVRVSDSPPFCPAESFLDTIFRFRDSNSNCPFHGDVRHYEFI  66

Query  905   AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
              V EGDE SLQ AL++VH   ++YV++LFYASWCPFS+ F+P FS++SSL   +PHFAI+
Sbjct  67    GVSEGDEASLQMALNMVHSNRYEYVSVLFYASWCPFSKSFRPSFSILSSLYASIPHFAIQ  126

Query  725   ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
             ESA++PS LSKYGV GFPTLFL+NSTMR RY+GSR+L SLV FY D+TG +T+S D IS 
Sbjct  127   ESAVRPSILSKYGVHGFPTLFLLNSTMRARYYGSRTLSSLVAFYNDVTGIQTASLDQISS  186

Query  545   DKIRCSSNKHR-DGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             D+I    N+ + D  SEQE+CPFSW+RSP+N LR+ETYLALATAFVLMRL+Y+ FP +  
Sbjct  187   DRIGQVWNREKHDDNSEQENCPFSWARSPENLLREETYLALATAFVLMRLIYIFFPTLLV  246

Query  368   FSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             ++R   RR + N+R  + WE P  C   A+Q F+  K+PCKRSNLQ GAMNAKAWA KS 
Sbjct  247   YARYVWRRHLRNMRLGTLWERPLTCMKGAIQLFSHFKDPCKRSNLQGGAMNAKAWA-KSF  305

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  306   ATVSIGD  312



>gb|KHN08939.1| 5'-adenylylsulfate reductase-like 4 [Glycine soja]
Length=314

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 214/311 (69%), Gaps = 13/311 (4%)
 Frame = -2

Query  1085  LREWRAGMAL-LMIVGRLTC---AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKS  918
             +R W + +   +++ G L+C   AH +TA      C   S  D++    D TC +    S
Sbjct  1     MRIWGSEIVFAILLCGTLSCTAQAHHITAS----TCPARSILDFVLGFSDFTCQLP--NS  54

Query  917   SCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  738
               S AV EGDE SLQ+ L++VH+ +H++VA+LFYASWCPFS+  +P+FS++S+L P + H
Sbjct  55    LGSIAVTEGDEVSLQKVLNMVHKNNHEHVAVLFYASWCPFSQVSRPVFSILSALYPSILH  114

Query  737   FAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKD  558
              AIEES++ PSTLSKYGV  FPTL+++NSTMR RYHGSR+L SL+ FY D+TG    S D
Sbjct  115   LAIEESSVWPSTLSKYGVHSFPTLYILNSTMRVRYHGSRTLGSLIGFYNDVTGIRIDSLD  174

Query  557   NISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPA  378
              +SL++I  SS     G SE ES PFS +RSP+N L QETYLALAT FV++RLLY+ FP 
Sbjct  175   ELSLEEIGRSSADKSHGNSESESSPFSQARSPENLLYQETYLALATTFVILRLLYLFFPN  234

Query  377   --VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
               +C    A RR I N+R  S  E+P +   R  Q FN LKEP KRSNLQEGAMNA+AWA
Sbjct  235   LLIC-IQYAWRRVIQNIRLGSLLEHPLIYLKRLTQSFNRLKEPYKRSNLQEGAMNARAWA  293

Query  203   SKSLASVSIGD  171
             SKSLA+VSIG+
Sbjct  294   SKSLATVSIGE  304



>ref|XP_007018758.1| APR-like 4 isoform 2 [Theobroma cacao]
 gb|EOY15983.1| APR-like 4 isoform 2 [Theobroma cacao]
Length=350

 Score =   312 bits (800),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 224/337 (66%), Gaps = 36/337 (11%)
 Frame = -2

Query  1082  REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCS-  909
             + W+ G+ +L++ GRL CA  ++ P     C K+S  D IF   DS C I+ E   S   
Sbjct  4     KAWQTGILMLVLWGRLACA--VSVPVRVPLCPKHSVSDTIFDFRDSYCPINSEFSESVDF  61

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               V EGDE SLQ+AL++VH+ S +YVA+LFYASWCPFSR F+P FS++SSL P +PHFAI
Sbjct  62    VGVTEGDEVSLQKALNMVHKNSREYVAVLFYASWCPFSRSFRPSFSILSSLYPSIPHFAI  121

Query  728   EESAIKP------------------------------STLSKYGVIGFPTLFLMNSTMRF  639
             +ES ++P                              S LSKYGV GFPTLFL+NSTMR 
Sbjct  122   KESTVRPRFANEYCHLVFACYEYLYLVKLMSGGVVYFSILSKYGVHGFPTLFLLNSTMRV  181

Query  638   RYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQ  459
             RYHG+RS +SL  FY D+TG +  S D  SLDKI   SN  +   +EQESCPFSW+RSP+
Sbjct  182   RYHGNRSFESLGAFYSDVTGIKNKSLDKTSLDKIGRLSNHEKHNSTEQESCPFSWARSPE  241

Query  458   NFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAV  282
             N LRQETYLALAT FVL+RLLY+++P +  F++ + RR I N++  S  E+      RA+
Sbjct  242   NLLRQETYLALATTFVLLRLLYLLYPTLLVFAQFTWRRLIRNMKLGSLLEHSLAYLKRAI  301

Query  281   QFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             Q FNSLKEPCKRSNLQ  AMNA+AWASKSLA+VSIGD
Sbjct  302   QLFNSLKEPCKRSNLQR-AMNARAWASKSLATVSIGD  337



>gb|KHG11609.1| 5'-adenylylsulfate reductase-like 4 [Gossypium arboreum]
Length=319

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 218/307 (71%), Gaps = 7/307 (2%)
 Frame = -2

Query  1082  REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS--  909
             + W+  M +L+   RLTCA  +  P     C K S  D IF   DS C I   ++     
Sbjct  4     KAWQTRMLILVFWWRLTCA--VFVPLRIPLCPKVSVSDAIFDFRDSYCPIISARTQSIDF  61

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               V EGDE S+Q+AL++V++  H YVA+LFYASWCPFSR F+P  +++SS  P +PHF I
Sbjct  62    VGVTEGDEVSMQKALNMVYKNGHGYVAVLFYASWCPFSRSFRPSINILSSSYPCIPHFTI  121

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EES+++PS LSKYGV GFPTLFL+NSTMR RYHG+RS +SL  FY D+TG + +S D  S
Sbjct  122   EESSVRPSILSKYGVHGFPTLFLLNSTMRARYHGNRSFESLGAFYSDVTGIK-NSLDKTS  180

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             L+KI   SN+ +   +EQESCPFSW+RSP+N LRQETYL+LAT FVL RLLY+++P +  
Sbjct  181   LEKIGHLSNQEKHNSTEQESCPFSWARSPENLLRQETYLSLATTFVLCRLLYLLYPTLLV  240

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F++ +  R I N++  +  E+P     RA+Q FNS+KEPCKRSNLQ GAMNA+AWASKSL
Sbjct  241   FAQLTWGRLIRNVKLGTLLEHPLAYLKRAIQLFNSMKEPCKRSNLQ-GAMNARAWASKSL  299

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  300   ATVSIGD  306



>ref|NP_001240132.1| uncharacterized protein LOC100796765 precursor [Glycine max]
 gb|ACU18131.1| unknown [Glycine max]
Length=314

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 213/311 (68%), Gaps = 13/311 (4%)
 Frame = -2

Query  1085  LREWRAGMAL-LMIVGRLTC---AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKS  918
             +R W + +   +++ G L+C   AH +TA      C   S  D++    D TC +    S
Sbjct  1     MRIWGSEIVFAILLCGTLSCTAQAHHITAS----TCPARSILDFVLGFSDFTCQLP--NS  54

Query  917   SCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  738
               S AV EGDE SLQ+ L++VH+ +H++VA+LFYAS CPFS+  +P+FS++S+L P + H
Sbjct  55    LGSIAVTEGDEVSLQKVLNMVHKNNHEHVAVLFYASLCPFSQVSRPVFSILSALYPSILH  114

Query  737   FAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKD  558
              AIEES++ PSTLSKYGV  FPTL+++NSTMR RYHGSR+L SL+ FY D+TG    S D
Sbjct  115   LAIEESSVWPSTLSKYGVHSFPTLYILNSTMRVRYHGSRTLGSLIGFYNDVTGIRIDSLD  174

Query  557   NISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPA  378
              +SL++I  SS     G SE ES PFS +RSP+N L QETYLALAT FV++RLLY+ FP 
Sbjct  175   ELSLEEIGRSSADKSHGNSESESSPFSQARSPENLLYQETYLALATTFVILRLLYLFFPN  234

Query  377   --VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWA  204
               +C    A RR I N+R  S  E+P +   R  Q FN LKEP KRSNLQEGAMNA+AWA
Sbjct  235   LLIC-IQYAWRRVIQNIRLGSLLEHPLIYLKRLTQSFNRLKEPYKRSNLQEGAMNARAWA  293

Query  203   SKSLASVSIGD  171
             SKSLA+VSIG+
Sbjct  294   SKSLATVSIGE  304



>gb|KHG10185.1| 5'-adenylylsulfate reductase-like 4 [Gossypium arboreum]
Length=321

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 206/286 (72%), Gaps = 4/286 (1%)
 Frame = -2

Query  1019  LTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTAVIEGDEKSLQRALDVVHRR  846
             +T P     C K S  D IF   DS C I  D  +S     V EGDE SLQ+ L++VH+ 
Sbjct  24    VTGPVRVPFCLKESISDAIFDFRDSYCPINSDFTESIDFVGVTEGDEVSLQKVLNMVHKN  83

Query  845   SHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTL  666
             SHDYVA+LFYASWCPFSR F+  F+++SS  P +PHFAIEESA++PS LSKYGV GFPTL
Sbjct  84    SHDYVAVLFYASWCPFSRSFRLTFAILSSSYPSIPHFAIEESAVRPSILSKYGVHGFPTL  143

Query  665   FLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESC  486
             FL+NSTM  RY G+R+ +SL  FYG +TG + SS D  S++KI   SN  +   +E ESC
Sbjct  144   FLLNSTMHVRYLGNRTFESLGAFYGLVTGIKKSSLDKASMNKIGHLSNHEKHSSTEPESC  203

Query  485   PFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCIL-NLRTRSSWEY  309
             PF W+RSP+N LRQETYLALAT FVL+RLLY+++P +  F+  + R ++ NL+  S  E+
Sbjct  204   PFPWARSPENLLRQETYLALATTFVLLRLLYLLYPTLLVFAHFTWRLLIRNLKLGSLLEH  263

Query  308   PQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             P     RA+Q FNSLKEPCKRSNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  264   PLAYLKRAIQLFNSLKEPCKRSNLQ-GAMNARAWASKSLATVSIGD  308



>ref|NP_564452.1| 5'-adenylylsulfate reductase-like 4 [Arabidopsis thaliana]
 sp|Q9SA00.1|APRL4_ARATH RecName: Full=5'-adenylylsulfate reductase-like 4; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 4; Short=APR-like 
4; Short=AtAPRL4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD46003.1|AC007894_1 Contains similarity to gi|729436 protein disulfide isomerase-related 
protein precursor from Rattus norvegicus [Arabidopsis 
thaliana]
 gb|AAL24358.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13357.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31738.1| 5'-adenylylsulfate reductase-like 4 [Arabidopsis thaliana]
Length=310

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/280 (57%), Positives = 197/280 (70%), Gaps = 15/280 (5%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVHRRSHDYVALL  822
            C+  SAKD IF L D TCS+  ++S       AV EGDE+ LQ ALD++H+   DYVALL
Sbjct  28   CATKSAKDSIFGLRDQTCSVSGVESDERPRFVAVTEGDERWLQIALDMIHKNKCDYVALL  87

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFSR F+P F V+SSL   +PHFAI+ES+IKPSTLSKYGV GFPTL L+NSTMR
Sbjct  88   FYASWCPFSRSFRPSFDVISSLYSSIPHFAIKESSIKPSTLSKYGVHGFPTLLLLNSTMR  147

Query  641  FRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSP  462
             RY G+R LDSLV FY D+TG ET   D  SL++     +   +  +E E+CPF+W+RSP
Sbjct  148  ARYRGTRMLDSLVAFYSDVTGIET--LDKTSLERSVSVPHLGNENNTEPENCPFTWARSP  205

Query  461  QNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRA  285
            +N LRQETYLALA  FVL+RLL++I+P +  F + + RR   N+R  S  E+     SRA
Sbjct  206  ENMLRQETYLALAIVFVLLRLLHLIYPTLVVFMKFTWRRIAQNMRLESLLEHTVGFLSRA  265

Query  284  VQFFNSLKEPC--KRSNLQEGAMNAKAWASKSLASVSIGD  171
            VQ        C  +RSNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  266  VQL-------CMHRRSNLQGGAMNARAWASKSLATVSIGD  298



>ref|XP_006397424.1| hypothetical protein EUTSA_v10001824mg [Eutrema salsugineum]
 gb|ESQ38877.1| hypothetical protein EUTSA_v10001824mg [Eutrema salsugineum]
Length=322

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 157/297 (53%), Positives = 196/297 (66%), Gaps = 9/297 (3%)
 Frame = -2

Query  1052  MIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-----DEIKSSCS-TAVIEG  891
             +++G +T             C+  S KD+ F   D TC +     DE+       +V EG
Sbjct  12    IVIGNITSTTVAAFSVRVPICATRSVKDYAFGFRDQTCPVSGAVGDELDERPHFLSVTEG  71

Query  890   DEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIK  711
             DE+ LQ ALD++H+   DYVALLFYASWCPFSR F+P F VVSSL   +PHFAI+ES++K
Sbjct  72    DERWLQTALDMIHKNKCDYVALLFYASWCPFSRSFRPSFDVVSSLYSSIPHFAIKESSVK  131

Query  710   PSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRC  531
             PSTLSKYGV GFPTL L+NSTMR RY G+R LDSL+ FY D+TG ET   D  SL+K   
Sbjct  132   PSTLSKYGVHGFPTLLLLNSTMRARYRGTRMLDSLIAFYTDVTGIET--LDKTSLEKSVL  189

Query  530   SSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-  354
               +      +E E+CPF+W+RSP+N  RQETYL LA  FVL RLL+++FP +  F+R + 
Sbjct  190   VPHLGNQNNTEPENCPFTWARSPENMFRQETYLTLAIIFVLFRLLHLVFPTLVVFTRFTW  249

Query  353   RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASV  183
             RR   N+R  S  E+     SR VQ    LKEPCKRSNLQ GAMNA+AWASKSLA+V
Sbjct  250   RRIAQNMRLESLQEHTVGFLSRTVQLCMHLKEPCKRSNLQGGAMNARAWASKSLATV  306



>emb|CDX91762.1| BnaC08g06810D [Brassica napus]
Length=313

 Score =   295 bits (755),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 193/278 (69%), Gaps = 9/278 (3%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSI--DEIKSSCS-TAVIEGDEKSLQRALDVVHRRSHDYVALL  822
            C+  S KD+     + TC    DE+       AV EGDE+ LQ ALD++H+   DYVALL
Sbjct  29   CAMRSVKDYALGFREQTCPFYGDELAERPHFVAVTEGDERWLQTALDMIHKNKCDYVALL  88

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFSR F P F ++SSL   +PHFAI+ESA+KPSTLSKYGV GFPTL LMNSTMR
Sbjct  89   FYASWCPFSRSFTPSFDLISSLYSSIPHFAIKESAVKPSTLSKYGVHGFPTLLLMNSTMR  148

Query  641  FRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSP  462
             RY G+R +DSLV FY D+TG ET   D  SL+K     +   +  +E E+CPF+W+RSP
Sbjct  149  ARYRGTRMVDSLVAFYRDVTGIET--LDKTSLEKSLLVPHLGNENNTEPENCPFTWARSP  206

Query  461  QNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRA  285
            +N LRQETYL LAT FVL+RLLY +FPA+  F++ +  R   N+R  S  E+     SR 
Sbjct  207  ENMLRQETYLTLATVFVLLRLLYFVFPALVVFAKFTWPRIAQNMRLESLQEHTVGFLSRL  266

Query  284  VQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              +   L+EPCKRSNLQ GAMNA+AWASKSLA+V+IGD
Sbjct  267  CMY---LREPCKRSNLQGGAMNARAWASKSLATVTIGD  301



>ref|XP_010060013.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Eucalyptus grandis]
 gb|KCW66534.1| hypothetical protein EUGRSUZ_F00332 [Eucalyptus grandis]
Length=309

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 192/278 (69%), Gaps = 4/278 (1%)
 Frame = -2

Query  995  CCSKYSAKDWIFALPDSTCSIDEIKSSCS-TAVIEGDEKSLQRALDVVHRRSHDYVALLF  819
             C K +    I    DS CS+D    S     V EGDE SLQRAL +VH+ S +YVA+LF
Sbjct  26   VCEKETLAGSIVGFRDSRCSLDGRSESVEFVGVTEGDELSLQRALSMVHKNSEEYVAVLF  85

Query  818  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRF  639
            YASWCPFSR  +P FS++SSL P + HFAIEES+++PS LSKYGV GFPTLF++NST+R 
Sbjct  86   YASWCPFSRVIRPRFSLLSSLYPSIAHFAIEESSVRPSILSKYGVHGFPTLFILNSTVRV  145

Query  638  RYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQ  459
            RYHG R+LDSLV FY D+ G + S+ +  SL++I+  SN  +   +E ESCPF W+RSP+
Sbjct  146  RYHGPRTLDSLVTFYNDVAGMKPSTSEWPSLEEIKTLSNYEKHDTTELESCPFWWARSPE  205

Query  458  NFLRQETYLALATAFVLMRLLYVIFP--AVCRFSRASRRCILNLRTRSSWEYPQLCPSRA  285
            N LR ETYLALAT FVL+RLLY ++P  A+C    A RR I N+   S   +      RA
Sbjct  206  NMLRHETYLALATTFVLLRLLYFLYPTLAIC-VQWAWRRHIQNMGLLSLLGHFLAYFKRA  264

Query  284  VQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             Q   S+KEP KRSNLQEGA NA  WASKSLA+VSIGD
Sbjct  265  TQLSKSIKEPRKRSNLQEGARNAGVWASKSLATVSIGD  302



>emb|CDY41863.1| BnaA08g06360D [Brassica napus]
Length=317

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/304 (53%), Positives = 204/304 (67%), Gaps = 13/304 (4%)
 Frame = -2

Query  1064  MALLMIVGRL--TCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTAVI  897
             + L+++ G L  T    ++   P   C+  S KD+     + +C    DE+       V+
Sbjct  8     LVLVILFGNLMFTAVDGVSVRVP--ICAMRSVKDYALGFREQSCPFYGDELADRPHFVVV  65

Query  896   -EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
              EGDE+ LQ ALD++H+   DYVALLFYASWCPFSR F P F ++SSL   +PHFAI+ES
Sbjct  66    TEGDERWLQTALDMIHKNKCDYVALLFYASWCPFSRSFTPSFDLISSLYSSIPHFAIKES  125

Query  719   AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
             ++KPSTLSKYGV GFPTL LMNSTMR RY G+R LDSLV FY D+TG ET   D  SL+K
Sbjct  126   SVKPSTLSKYGVHGFPTLLLMNSTMRARYRGTRMLDSLVAFYRDVTGIET--LDKTSLEK  183

Query  539   IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
                  +   +  +E E+CPF+W+RSP+N LRQETYL LAT FVL+RLLY +FPA+  F++
Sbjct  184   SLLVPHLGNENNTEPENCPFTWARSPENMLRQETYLTLATVFVLLRLLYFVFPALVVFAK  243

Query  359   AS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASV  183
              +  R   N+R  S  E+     SR   +   LKEPCKRSNLQ GAMNA+AWASKSLA+V
Sbjct  244   FTWPRIAQNMRLESLQEHTVGFLSRLCMY---LKEPCKRSNLQGGAMNARAWASKSLATV  300

Query  182   SIGD  171
             SIG+
Sbjct  301   SIGE  304



>ref|XP_009107920.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Brassica rapa]
Length=317

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 156/281 (56%), Positives = 194/281 (69%), Gaps = 9/281 (3%)
 Frame = -2

Query  1001  ALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTAVI-EGDEKSLQRALDVVHRRSHDYV  831
             A  C+  S KD+     + +C    DE+       V+ EGDE+ LQ ALD++H+   DYV
Sbjct  29    APICAMRSVKDYALGFREQSCPFYGDELADRPHFVVVTEGDERWLQTALDMIHKNKCDYV  88

Query  830   ALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNS  651
             ALLFYASWCPFSR F P F ++SSL   +PHFAI+ES++KPSTLSKYGV GFPTL LMNS
Sbjct  89    ALLFYASWCPFSRSFTPSFDLISSLYSSIPHFAIKESSVKPSTLSKYGVHGFPTLLLMNS  148

Query  650   TMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS  471
             TMR RY G+R LDSLV FY D+TG ET   D  SL+K     +   +  +E E+CPF+W+
Sbjct  149   TMRARYRGTRMLDSLVAFYRDVTGIET--LDKTSLEKSLLVPHLGNENNTEPENCPFTWA  206

Query  470   RSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCP  294
             RSP+N LRQETYL LAT FVL+RLLY +FPA+  F++ +  R   N+R  S  E+     
Sbjct  207   RSPENMLRQETYLTLATVFVLLRLLYFVFPALVVFAKFTWPRIAQNMRLESLQEHTVGFL  266

Query  293   SRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             SR   +   LKEPCKRSNLQ GAMNA+AWASKSLA+VSIG+
Sbjct  267   SRLCMY---LKEPCKRSNLQGGAMNARAWASKSLATVSIGE  304



>ref|XP_006305413.1| hypothetical protein CARUB_v10009812mg [Capsella rubella]
 gb|EOA38311.1| hypothetical protein CARUB_v10009812mg [Capsella rubella]
Length=312

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 201/303 (66%), Gaps = 15/303 (5%)
 Frame = -2

Query  1064  MALLMIVGRLTCAHTLTAPFPALC--CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEG  891
             M L+M+   LT  +     F      C+  S KD+IF   D TC ++  +      V EG
Sbjct  8     MLLVMVFWNLTFINADADDFSVRVPFCATRSIKDYIFGFRDQTC-VESSQRPRFVVVTEG  66

Query  890   DEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIK  711
             DE+ LQ ALD++H+   DYVALLFYASWCPFSR F+P F VVSSL   +PHFAI+ES++K
Sbjct  67    DERWLQIALDMIHKNKCDYVALLFYASWCPFSRSFRPSFDVVSSLYSSIPHFAIKESSVK  126

Query  710   PSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRC  531
             PSTLSKYGV GFPTL L+NSTMR RY GSR LDSLV FY D+TG ET   D  SL++   
Sbjct  127   PSTLSKYGVHGFPTLLLLNSTMRARYRGSRMLDSLVAFYSDVTGIET--LDKTSLERSVS  184

Query  530   SSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-  354
               +      +E E+CPF+W+RSP+N LRQETYLALA  FVL+RLL++I+P +  F + + 
Sbjct  185   VLHLENQNNTEPENCPFTWARSPENMLRQETYLALAIVFVLLRLLHLIYPTLVVFMKFTW  244

Query  353   RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPC--KRSNLQEGAMNAKAWASKSLASVS  180
             RR   N+R  S  E+     SRAVQ        C  +RSNLQ GAMNA+AWASKSLA+VS
Sbjct  245   RRIAQNMRLESLLEHTVGFLSRAVQL-------CMHRRSNLQGGAMNARAWASKSLATVS  297

Query  179   IGD  171
             IGD
Sbjct  298   IGD  300



>gb|KFK23381.1| hypothetical protein AALP_AAs59400U000300 [Arabis alpina]
Length=316

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 202/310 (65%), Gaps = 11/310 (4%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCA-HTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSS  915
             + +W   +   M+   L+    ++  PF    C   S KD+       TC +  DE+   
Sbjct  1     MEKWILLLLFFMVFSNLSFGVFSVRVPF----CPTRSVKDYTLGFRHQTCPVSGDELAQR  56

Query  914   CS-TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  738
                 AV EGDE+ LQ ALD++H+   DYVALLFYASWCPFSR  +P F V++S+   +PH
Sbjct  57    PHFVAVTEGDERWLQTALDMIHKNKCDYVALLFYASWCPFSRSLRPSFDVIASIYSSIPH  116

Query  737   FAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKD  558
             FAI+ES++KPSTLSKYGV GFPTL ++NSTMR RY G+R LDSLV FY D+TG ET   D
Sbjct  117   FAIKESSVKPSTLSKYGVHGFPTLLVLNSTMRARYRGTRMLDSLVAFYSDVTGIET--LD  174

Query  557   NISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPA  378
               SL+K     +   +  +E E+CPF+W+RSP+N LRQETYL LA  FVL+RLL++I+P 
Sbjct  175   KTSLEKSVTVPHLGNESNTEPENCPFTWARSPENMLRQETYLTLAIVFVLLRLLHLIYPT  234

Query  377   VCRFSRASRRCIL-NLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWAS  201
             +  F +   R I  N+   S  E+     SR VQ    LKEPCKRSNLQ GAMNA+AWAS
Sbjct  235   LVVFMKYIWRGIAQNMSLESLLEHTVGFLSRVVQLCMHLKEPCKRSNLQGGAMNARAWAS  294

Query  200   KSLASVSIGD  171
             KSLA+VSIG+
Sbjct  295   KSLATVSIGE  304



>ref|XP_010269310.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Nelumbo nucifera]
Length=319

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 200/299 (67%), Gaps = 4/299 (1%)
 Frame = -2

Query  1076  WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS--TA  903
             W+ G ALL++ GRLTCA  +        C   S  D++    D       + +       
Sbjct  6     WQTGFALLLVFGRLTCAEPVRVS-SVEVCPMPSLADYLLLSRDLCVDSSWLSNGAGDLIG  64

Query  902   VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  723
             V EGDE SLQRAL++VH+  H+Y++LLF+ASWCPFSR  +P FS++SSL P + H A+EE
Sbjct  65    VTEGDEVSLQRALNLVHKNGHEYISLLFHASWCPFSRACRPTFSILSSLYPSIRHLAVEE  124

Query  722   SAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLD  543
             S+I+PS LS+YGV GFPTLFL+NSTMR RY GSR+L+SLV FY D+TG + +S D  SL+
Sbjct  125   SSIRPSILSRYGVHGFPTLFLLNSTMRVRYQGSRTLNSLVAFYNDVTGIKPASLDGTSLE  184

Query  542   KIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRF-  366
             KI   SN       + E CPFSW+RSP+N LRQETYLALAT FV++RLL+ + P +  F 
Sbjct  185   KIENPSNLAYLEDPDLEGCPFSWARSPENLLRQETYLALATTFVVLRLLHFLLPTLLAFV  244

Query  365   SRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLA  189
               A RR + N    S W+YP      A+  FN  KEPCKR+NLQEGAM+A+AWASKSLA
Sbjct  245   QHAWRRYVQNASLMSLWKYPLAYLKHAIHVFNVPKEPCKRNNLQEGAMSARAWASKSLA  303



>gb|KCW66535.1| hypothetical protein EUGRSUZ_F00332 [Eucalyptus grandis]
Length=310

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 192/279 (69%), Gaps = 5/279 (2%)
 Frame = -2

Query  995  CCSKYSAKDWIFALPDSTCSIDEIKSSCS-TAVIE-GDEKSLQRALDVVHRRSHDYVALL  822
             C K +    I    DS CS+D    S     V E GDE SLQRAL +VH+ S +YVA+L
Sbjct  26   VCEKETLAGSIVGFRDSRCSLDGRSESVEFVGVTEVGDELSLQRALSMVHKNSEEYVAVL  85

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFSR  +P FS++SSL P + HFAIEES+++PS LSKYGV GFPTLF++NST+R
Sbjct  86   FYASWCPFSRVIRPRFSLLSSLYPSIAHFAIEESSVRPSILSKYGVHGFPTLFILNSTVR  145

Query  641  FRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSP  462
             RYHG R+LDSLV FY D+ G + S+ +  SL++I+  SN  +   +E ESCPF W+RSP
Sbjct  146  VRYHGPRTLDSLVTFYNDVAGMKPSTSEWPSLEEIKTLSNYEKHDTTELESCPFWWARSP  205

Query  461  QNFLRQETYLALATAFVLMRLLYVIFP--AVCRFSRASRRCILNLRTRSSWEYPQLCPSR  288
            +N LR ETYLALAT FVL+RLLY ++P  A+C    A RR I N+   S   +      R
Sbjct  206  ENMLRHETYLALATTFVLLRLLYFLYPTLAIC-VQWAWRRHIQNMGLLSLLGHFLAYFKR  264

Query  287  AVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            A Q   S+KEP KRSNLQEGA NA  WASKSLA+VSIGD
Sbjct  265  ATQLSKSIKEPRKRSNLQEGARNAGVWASKSLATVSIGD  303



>gb|KHN19769.1| 5'-adenylylsulfate reductase-like 4 [Glycine soja]
Length=322

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 205/314 (65%), Gaps = 11/314 (4%)
 Frame = -2

Query  1088  RLREWRAGMAL-LMIVGRLTC---AHT--LTAPFPALCCSKYSAKDWIFALPDSTCSIDE  927
             R+  W + +   +++ G L+C   AH   ++       C      D+I    DSTCS+  
Sbjct  2     RIMVWGSEIVFAILLCGTLSCTAQAHHNRVSLSSTTAICPARPLLDFILGFSDSTCSLP-  60

Query  926   IKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPW  747
               S  S AV EGDE  L +AL++VH+ +H+YVA+LFYASWCPFSR F+P+FS++S+L P 
Sbjct  61    -NSLGSIAVTEGDEFFLHKALNMVHKNNHEYVAVLFYASWCPFSRVFRPVFSILSALYPS  119

Query  746   VPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETS  567
             + H AIEES++ PS LSKYGV   PTLF++NSTMR RYHGSR   SL+ FY D+TG    
Sbjct  120   ITHLAIEESSVWPSILSKYGVHSVPTLFILNSTMRVRYHGSRRFGSLIGFYNDVTGIRID  179

Query  566   SKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMR--LLY  393
             S D +SL+KI  SS     G +E ES PFS +RSP N LRQETYLALA  FV++R   L+
Sbjct  180   SLDQLSLEKIGHSSANESHGNTEPESSPFSRARSPDNLLRQETYLALAITFVVLRLLYLF  239

Query  392   VIFPAVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAK  213
             +    +C    A RR I N+R  S  E+P +   R  Q FN LKEP KRSNLQEGAMNA+
Sbjct  240   LPTLLIC-IQYAWRRVIQNIRIGSLLEHPLIYLKRLTQSFNCLKEPYKRSNLQEGAMNAR  298

Query  212   AWASKSLASVSIGD  171
              WASKSLA+VSIG+
Sbjct  299   VWASKSLATVSIGE  312



>ref|XP_002893853.1| hypothetical protein ARALYDRAFT_473651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70112.1| hypothetical protein ARALYDRAFT_473651 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/278 (56%), Positives = 190/278 (68%), Gaps = 11/278 (4%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVHRRSHDYVALL  822
            C+  S KD IF   D TC +  ++S       AV EGDE+ LQ ALD++H+   DYVALL
Sbjct  18   CATRSVKDSIFGFRDQTCPVSGVESDERPHFGAVTEGDERWLQLALDMIHKNKCDYVALL  77

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFSR F+P F V++SL   +PHFAI+ES++KPSTLSKYGV GFPTL L+NSTMR
Sbjct  78   FYASWCPFSRSFRPSFDVIASLYSSIPHFAIKESSVKPSTLSKYGVHGFPTLLLLNSTMR  137

Query  641  FRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSP  462
             RY G+R LDSLV FY D+TG  T   D  SLDK     +       E E+CPF+W+RSP
Sbjct  138  ARYRGTRMLDSLVAFYSDVTGIVT--LDKTSLDKSVSVPHLGNQNNIEPENCPFTWARSP  195

Query  461  QNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRA  285
            +N LRQETYLALA  FVL+RLL++I+P +  F + + RR   N+R  S  E+     SRA
Sbjct  196  ENMLRQETYLALAIVFVLLRLLHLIYPTLVMFMKFTWRRIAQNMRLESLLEHTIGFLSRA  255

Query  284  VQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            VQ         +RSNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  256  VQLCMH-----RRSNLQGGAMNARAWASKSLATVSIGD  288



>gb|EYU36495.1| hypothetical protein MIMGU_mgv1a0105141mg, partial [Erythranthe 
guttata]
Length=250

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 183/242 (76%), Gaps = 6/242 (2%)
 Frame = -2

Query  893  GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAI  714
            GDE +LQ+AL+++H+  HDYVALLFY+SWCPFS  F+P FS++SS+ P +PHFAIEESA+
Sbjct  1    GDEVTLQKALNIIHKNEHDYVALLFYSSWCPFSGPFRPSFSLLSSIFPSIPHFAIEESAV  60

Query  713  KPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIR  534
            +PS LSKYGV GFPTL L+NSTMR RY GSR+LDSL+ FY + TG + +S + +S DKI 
Sbjct  61   RPSILSKYGVHGFPTLLLLNSTMRMRYQGSRTLDSLISFYDEFTGIK-ASDNGVSFDKIG  119

Query  533  CSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR-A  357
            CS N  ++  + QE+CPF W++SP+N  +QETYL LAT FV++RLL+ IFP + R +R A
Sbjct  120  CSGNNKKN-ENYQETCPFPWAKSPENLFQQETYLTLATIFVILRLLHYIFPTIRRCTRLA  178

Query  356  SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSI  177
             RR  +++   + WE+  +  +   Q  N +K P K+SNLQEGA NAKAWASKSLA+VS 
Sbjct  179  WRRYTVHVSVSNLWEHLSVYLN---QVLNYIKNPRKKSNLQEGAKNAKAWASKSLATVSF  235

Query  176  GD  171
            GD
Sbjct  236  GD  237



>ref|XP_010538940.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Tarenaya hassleriana]
Length=323

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 200/303 (66%), Gaps = 10/303 (3%)
 Frame = -2

Query  1064  MALLMIVGRLTCAHTLTAPFPALC--CSKYSAKDWIFALPDSTCSIDEIKSSCS------  909
             +  ++++G LTCA   ++        CS  SA+D+I    D   S+              
Sbjct  6     LLFVVVLGNLTCAAFSSSSSVDRFSFCSLVSAEDYILGFRDRYGSLSLDDGDELDEDPGF  65

Query  908   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
              +V EGDE+SL  ALD++H +  DYVALLFYASWCPFSR F+     +SSL P +PHFAI
Sbjct  66    VSVTEGDERSLIIALDMIHTKECDYVALLFYASWCPFSRSFRLSLDALSSLYPSIPHFAI  125

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             E+S ++PS LSKYGV GFPTLFLMNSTMR R+ GSRSL SLV FY D+TG E   + + S
Sbjct  126   EDSTVRPSILSKYGVHGFPTLFLMNSTMRVRHRGSRSLGSLVAFYSDVTGIEKLDEAS-S  184

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             +++ R   N      +EQE+CPFSW+RSP+N LRQETYLALAT FVL+RLL+++FP +  
Sbjct  185   VEENRLVPNLGNQSTTEQENCPFSWARSPENLLRQETYLALATVFVLLRLLHLVFPTLVV  244

Query  368   FSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             F + +  R   N+   S  E+     SR V+    LKEPCKRSNLQEGAMNA+AWASKSL
Sbjct  245   FVKFTWGRVAQNMSLESLSEHTVSYLSRVVRLRMQLKEPCKRSNLQEGAMNARAWASKSL  304

Query  191   ASV  183
             A+V
Sbjct  305   ATV  307



>ref|XP_010478919.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Camelina sativa]
Length=314

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/288 (55%), Positives = 198/288 (69%), Gaps = 15/288 (5%)
 Frame = -2

Query  1022  TLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVH  852
             T+  PF    C+  S KD+IF   D TC +  ++S+       V EGDE+ LQ ALD++H
Sbjct  26    TVRVPF----CATRSTKDYIFGFRDQTCPVSGVESAERPHFVVVTEGDERWLQIALDMIH  81

Query  851   RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFP  672
             +   DYVALLFYASWCPFSR F+P F V+SSL   +PHFAI+ES++KPSTLSKYGV GFP
Sbjct  82    KNKCDYVALLFYASWCPFSRSFRPSFDVISSLFSSIPHFAIKESSVKPSTLSKYGVHGFP  141

Query  671   TLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQE  492
             TL L+NSTMR RY G+R LDSLV FY D+TG ET   D  SL++     +   +  +E E
Sbjct  142   TLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIET--LDKTSLERSVLVPHLENENNTEPE  199

Query  491   SCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSW  315
             +CPF+W+RSP+N LRQETYLALA  FVL+RLL++I+P +  F + + RR   N+R  S  
Sbjct  200   NCPFTWARSPENMLRQETYLALAIVFVLLRLLHLIYPTLVVFMKFTWRRIAQNMRLESLL  259

Query  314   EYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             E+     SRAVQ         +RSNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  260   EHTVGFLSRAVQLCMH-----RRSNLQGGAMNARAWASKSLATVSIGD  302



>gb|ACU23635.1| unknown [Glycine max]
Length=322

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 204/314 (65%), Gaps = 11/314 (4%)
 Frame = -2

Query  1088  RLREWRAGMAL-LMIVGRLTC---AHT--LTAPFPALCCSKYSAKDWIFALPDSTCSIDE  927
             R+  W + +   +++ G L+C   AH   ++       C      D+I    DSTCS+  
Sbjct  2     RIMVWGSEIVFAILLCGTLSCTAQAHHNRVSLSSTTAICPARPLLDFILGFSDSTCSLP-  60

Query  926   IKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPW  747
               S  S AV EGDE  L +AL++VH+ + +YVA+LFYASWCPFSR F+P+FS++S+L P 
Sbjct  61    -NSLGSIAVTEGDEFFLHKALNMVHKNNREYVAVLFYASWCPFSRVFRPVFSILSALYPS  119

Query  746   VPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETS  567
             + H AIEES++ PS LSKYGV   PTLF++NSTMR RYHGSR   SL+ FY D+TG    
Sbjct  120   ITHLAIEESSVWPSILSKYGVHSVPTLFILNSTMRVRYHGSRRFGSLIGFYNDVTGIRID  179

Query  566   SKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMR--LLY  393
             S D +SL+KI  SS     G +E ES PFS +RSP N LRQETYLALA  FV++R   L+
Sbjct  180   SLDQLSLEKIGHSSANESHGNTEPESSPFSRARSPDNLLRQETYLALAITFVVLRLLYLF  239

Query  392   VIFPAVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAK  213
             +    +C    A RR I N+R  S  E+P +   R  Q FN LKEP KRSNLQEGAMNA+
Sbjct  240   LPTLLIC-IQYAWRRVIQNIRIGSLLEHPLIYLKRLTQSFNCLKEPYKRSNLQEGAMNAR  298

Query  212   AWASKSLASVSIGD  171
              WASKSLA+VSIG+
Sbjct  299   VWASKSLATVSIGE  312



>ref|XP_010939664.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Elaeis guineensis]
Length=315

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 146/283 (52%), Positives = 195/283 (69%), Gaps = 4/283 (1%)
 Frame = -2

Query  1010  PFPALCCSKYSAKDWIFALPDSTCSIDE-IKSSCSTAVIEGDEKSLQRALDVVHRRSHDY  834
             P  A  C + S  + I   PD+   +D  +       V+EG E ++QRAL++V++   DY
Sbjct  21    PAAATVCPRVSVGESILGRPDACSLLDAPVLGGDLIGVVEGGEAAMQRALNLVYKNREDY  80

Query  833   VALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMN  654
             VA+LFYASWCPFS+ F+P   V+SSL P + HFA EES I+PS LS+YGV GFPTLFL+N
Sbjct  81    VAVLFYASWCPFSKVFRPNLQVLSSLFPTIRHFAFEESVIRPSILSRYGVHGFPTLFLLN  140

Query  653   STMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK-IRCSSNKHRDGGSEQESCPFS  477
             ST+R RY GSR+++SLV FY D+TGA  +S D I L+K +  S++     G EQE+CPFS
Sbjct  141   STLRVRYQGSRTINSLVAFYNDVTGANPASLDTIHLEKTVDPSNDTELKEGDEQENCPFS  200

Query  476   WSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR-FSRASRRCILNLRTRSSWEYPQL  300
             W+RSP+  L+Q+TYLALA++FV++RLLY++ P +     RA RR +      +  ++ Q 
Sbjct  201   WARSPEKLLQQDTYLALASSFVILRLLYILLPKLNACVKRAWRRHMRYASLTNLQDHLQA  260

Query  299   CPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             C  +A Q FN L  PCKR NLQ GAMNA+AWASKSLASVSIG+
Sbjct  261   CLEQAKQGFNRLN-PCKRGNLQVGAMNARAWASKSLASVSIGE  302



>ref|XP_010500009.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Camelina sativa]
Length=314

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 155/288 (54%), Positives = 197/288 (68%), Gaps = 15/288 (5%)
 Frame = -2

Query  1022  TLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVH  852
             T+  PF    C+   AKD+IF   D TC +  ++S+       V EGDE+ LQ A D++H
Sbjct  26    TVRVPF----CATRFAKDYIFGFRDQTCPVSGVESAHRPHFVVVTEGDERWLQIAFDMIH  81

Query  851   RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFP  672
             +   DYVALLFYASWCPFSR F+P F V+SSL   +PHFAI+ES++KPSTLSKYGV GFP
Sbjct  82    KNKCDYVALLFYASWCPFSRSFRPSFDVISSLYSSIPHFAIKESSVKPSTLSKYGVHGFP  141

Query  671   TLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQE  492
             TL L+NSTMR RY G+R LDSLV FY D+TG ET   D  SL++     +   +  +E E
Sbjct  142   TLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIET--LDKTSLERSVLVPHLENENNTEPE  199

Query  491   SCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSW  315
             +CPF+W+RSP+N LRQETYLALA  FVL+RLL++++P +  F + + RR   N+R  S  
Sbjct  200   NCPFTWARSPENMLRQETYLALAIVFVLLRLLHLMYPTLVVFMKFTWRRIAQNMRLESLL  259

Query  314   EYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             E+     SRAVQ         +RSNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  260   EHTVGFLSRAVQLCMH-----RRSNLQGGAMNARAWASKSLATVSIGD  302



>ref|XP_010461284.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Camelina sativa]
 ref|XP_010461285.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Camelina sativa]
Length=314

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 197/288 (68%), Gaps = 15/288 (5%)
 Frame = -2

Query  1022  TLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVH  852
             T+  PF    C+   AKD+IF   D TC +  ++S+       V EGDE+ LQ ALD++H
Sbjct  26    TVRVPF----CATRFAKDYIFGFRDQTCPVSGVESAHRPHFVVVTEGDERWLQIALDMIH  81

Query  851   RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFP  672
             +   DYVALLFYASWCPFSR F+P F V+SSL   +PHFAI+ES++KPSTLSKYGV GFP
Sbjct  82    KNKCDYVALLFYASWCPFSRSFRPSFDVISSLFSSIPHFAIKESSVKPSTLSKYGVHGFP  141

Query  671   TLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQE  492
             TL L+NSTMR RY G+R LDSLV FY D+TG ET   D  SL++     +   +  +E E
Sbjct  142   TLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIET--LDKTSLERSVLVPHLENENNTEPE  199

Query  491   SCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSW  315
             +CPF+W+RSP+N LRQETYLALA  FVL+RL+++++P +  F + +  R   N+R  S  
Sbjct  200   NCPFTWARSPENMLRQETYLALAIVFVLLRLIHLLYPTLVVFMKFTWGRIAQNMRLESLL  259

Query  314   EYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             E+     SRAVQ         +RSNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  260   EHTVGFLSRAVQLCMH-----RRSNLQGGAMNARAWASKSLATVSIGD  302



>ref|XP_008790885.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Phoenix dactylifera]
 ref|XP_008790886.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Phoenix dactylifera]
Length=315

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 191/295 (65%), Gaps = 20/295 (7%)
 Frame = -2

Query  1022  TLTAPFPALCCSKYSAKDWIFALPDSTCSIDE-IKSSCSTAVIEGDEKSLQRALDVVHRR  846
             T+  P  A  C + SA + I   PD+   +D  +       V+EG E  L RAL++V+R 
Sbjct  17    TVVGPAAATVCPRVSAGESILGRPDACSHLDAPVLGGELIGVVEGGEAVLLRALNLVYRN  76

Query  845   SHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTL  666
               DYVA+LFYASWCPFS+  +P F V+SSL P + HFA EES I+PS LS+YGV GFPTL
Sbjct  77    KEDYVAVLFYASWCPFSKILRPNFQVLSSLFPTIRHFAFEESVIRPSILSRYGVHGFPTL  136

Query  665   FLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK-IRCSSNKHRDGGSEQES  489
             FL+NSTMR RYHGSR+++SLV F+  +TGA  +S   I L+K +  S++     G+EQE+
Sbjct  137   FLLNSTMRVRYHGSRTINSLVAFHNGVTGANPASLYPIHLEKTVDPSNDTELKEGNEQEN  196

Query  488   CPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCILNLRTRSSWEY  309
             CPFSW+RSP+  L+Q+TYLALA+ FV++RLLYV+ P +         C+     R  W Y
Sbjct  197   CPFSWARSPEKLLQQDTYLALASTFVILRLLYVLLPKL-------NACVKRAWGRHMW-Y  248

Query  308   PQLCP---------SRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               L            +A Q FN L  PCKR NLQ GAMNA+AWASKSLASVSIG+
Sbjct  249   ASLTGLQDRLLAYLEQAKQGFNRLN-PCKRGNLQVGAMNARAWASKSLASVSIGE  302



>ref|XP_010937429.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Elaeis guineensis]
Length=319

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 203/313 (65%), Gaps = 12/313 (4%)
 Frame = -2

Query  1094  MARLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE-IKS  918
             M   R WRAG ALL+++  +       A      C + SA + I   PDS  +++  +  
Sbjct  1     MEGRRVWRAGAALLVLLLVVVGPAAAAASV----CPRVSASESILGRPDSCSALESPVLG  56

Query  917   SCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  738
                  V+EGDE  LQRAL++V+ +  DYVA+LFYASWCPFS+  +P F V+SSL P + H
Sbjct  57    GDLIGVVEGDEAILQRALNLVYSKREDYVAVLFYASWCPFSKICRPNFQVLSSLFPTIRH  116

Query  737   FAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKD  558
             FA EES I+PS LS+YGV GFPTLFL+NSTMR RYHGSR+++SLV FY D+TGA  +  D
Sbjct  117   FAFEESVIRPSMLSRYGVHGFPTLFLLNSTMRVRYHGSRTINSLVAFYNDVTGANPALLD  176

Query  557   NISLDKIRCSSNKH---RDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVI  387
              I ++KI   SN +    D G  QE+CPFS +RSP+  L+Q+TYL LA++FVLMRLL ++
Sbjct  177   PIPVEKIVDPSNDNGLKEDNG--QENCPFSGARSPEKLLQQDTYLVLASSFVLMRLLCIL  234

Query  386   FPAVCR-FSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKA  210
              P +     RA RR +      S  +  Q       Q FN L  PCKR NLQEGAMNA+A
Sbjct  235   LPKLNACVKRAWRRHMQYASLMSLQDRSQAYVDHVKQGFNRLN-PCKRGNLQEGAMNARA  293

Query  209   WASKSLASVSIGD  171
             WASKSLASVSIG+
Sbjct  294   WASKSLASVSIGE  306



>ref|XP_008811170.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Phoenix dactylifera]
Length=319

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/280 (53%), Positives = 182/280 (65%), Gaps = 4/280 (1%)
 Frame = -2

Query  1001  ALCCSKYSAKDWIFALPDSTCSI-DEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVAL  825
             A  C + SA   I   PDS   +   +       VIEGDE  LQRAL++V+R+  DY+A+
Sbjct  28    ASVCPRVSACQSILGRPDSCPRLASPVLGGNLIGVIEGDEVVLQRALNIVYRKREDYIAM  87

Query  824   LFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTM  645
             LFYA WCPFSR   P F V+SSL P + HFA EES I+ S LS+YGV GFPTLFL+NSTM
Sbjct  88    LFYAPWCPFSRICWPNFQVLSSLFPTIRHFAFEESVIRSSILSRYGVHGFPTLFLLNSTM  147

Query  644   RFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKI-RCSSNKHRDGGSEQESCPFSWSR  468
             R RY GSR++ SLV FY D+TGA  +  D I ++KI   S++      +EQE+CPFSW R
Sbjct  148   RVRYRGSRNITSLVAFYNDVTGANPAVLDPIPVEKIVDPSTDTELKEDNEQENCPFSWGR  207

Query  467   SPQNFLRQETYLALATAFVLMRLLYVIFPAVCR-FSRASRRCILNLRTRSSWEYPQLCPS  291
             SP+  L+Q+TYL LA +FVLMRLLY++ P +     RA RR +      S  +  Q    
Sbjct  208   SPEKLLQQDTYLVLAWSFVLMRLLYILLPKLNACVKRAWRRHMQYASLMSLQDRSQAYVD  267

Query  290   RAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                Q FN L  PCKR NLQEGAMNAK WASKSLASVSIG+
Sbjct  268   HVKQGFNRLN-PCKRGNLQEGAMNAKVWASKSLASVSIGE  306



>gb|KJB29322.1| hypothetical protein B456_005G094200 [Gossypium raimondii]
Length=266

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 175/263 (67%), Gaps = 5/263 (2%)
 Frame = -2

Query  1076  WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTA  903
             W   + +L +  RLTCA  +T P  A  C K S  + +F   DS CSI  D I+S  S  
Sbjct  6     WEMRILILFLWWRLTCA--VTVPVRAPLCPKNSVFEAVFDFRDSFCSIHSDFIESIDSVG  63

Query  902   VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  723
             V EGDE SLQ+AL++VHR  H+YVA+LFYASWCPFSR F+P F  +SS  P +PHFAI+E
Sbjct  64    VTEGDEISLQKALNMVHRNIHEYVAVLFYASWCPFSRSFRPSFLTLSSSYPSIPHFAIKE  123

Query  722   SAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLD  543
             SA++PS LSKYGV GFPTLFL+NS MR RYHG+RS +SL  FY D+TG +  S      D
Sbjct  124   SAVRPSILSKYGVHGFPTLFLLNSKMRVRYHGNRSFESLSTFYNDVTGFQIKSLGKTLRD  183

Query  542   KIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFS  363
             K R      +   SEQES  FSW+RSPQN LRQETYLALAT FVL RLLY+ +P +  F+
Sbjct  184   KTRHVLKHEKHKSSEQESWSFSWARSPQNLLRQETYLALATTFVLFRLLYLFYPTLLVFA  243

Query  362   RAS-RRCILNLRTRSSWEYPQLC  297
             R + +R   +++  +  E+P L 
Sbjct  244   RFTWKRINRDVKLGTMLEHPLLI  266



>ref|XP_002452534.1| hypothetical protein SORBIDRAFT_04g027510 [Sorghum bicolor]
 gb|EES05510.1| hypothetical protein SORBIDRAFT_04g027510 [Sorghum bicolor]
Length=322

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 190/308 (62%), Gaps = 21/308 (7%)
 Frame = -2

Query  1040  RLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS-------CST--------  906
             RL C   L  PF  +    Y+A +   +LP   C +  I  S       CST        
Sbjct  4     RLPCWTALLLPFLLVGVGPYAAAE---SLPHDACLVPTIVESVLGTPGTCSTLDRRPGDP  60

Query  905   -AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               VIEGDE +L RA++++H    DY+A+LFYA+WCPFS++ KP F  ++SL P + HFA 
Sbjct  61    VGVIEGDEVTLARAVNLLHANKDDYIAVLFYATWCPFSQECKPNFETLASLFPTIRHFAF  120

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
             EESAI+PS +S+YG+ GFPTLFL+NSTMR RYHG R++ SL  FY D++G   S K    
Sbjct  121   EESAIRPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSLAAFYTDVSGINASVKSTAG  180

Query  548   LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
                +    +      +EQE+CPF W+RSP+  L+Q+TYLALATAFV++RLLY ++P +  
Sbjct  181   EAMVHPLDDIEPKKEAEQENCPFWWARSPEKILQQDTYLALATAFVILRLLYHLYPKINS  240

Query  368   FSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSL-KEPCKRSNLQEGAMNAKAWASKS  195
             F+R A RR  L      + EY      +A Q F+ L     KR NLQEGAMNA AWASKS
Sbjct  241   FARWAWRRHNLFSNLMGAHEYFLTYLEQARQKFHRLYPSSSKRGNLQEGAMNATAWASKS  300

Query  194   LASVSIGD  171
             LASVSIG+
Sbjct  301   LASVSIGE  308



>gb|ACG42026.1| APRL3 - Zea mays adenosine 5'-phosphosulfate reductase-like [Zea 
mays]
Length=324

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 177/267 (66%), Gaps = 3/267 (1%)
 Frame = -2

Query  965  IFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  786
            +   PD TCS  + +      VIEGDE +L RA++++H    DY+A+LFYASWCPFS++ 
Sbjct  45   VLRTPD-TCSTLDRRLGDPVGVIEGDEVTLARAVNLLHANKDDYIAVLFYASWCPFSQEC  103

Query  785  KPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSL  606
            KP F  ++ L P + HFA EESAI+PS +S+YG+ GFPTLFL+NSTMR RYHG R++ SL
Sbjct  104  KPNFETLAYLFPAIRHFAFEESAIRPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSL  163

Query  605  VDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLAL  426
              FY D++G   S K       +    +      +EQE+CPF W+RSP+N L+Q+TYLAL
Sbjct  164  AAFYTDVSGINASVKSTAGEAMVHPLDDIEHKKDAEQENCPFWWARSPENILQQDTYLAL  223

Query  425  ATAFVLMRLLYVIFPAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSL-KEPC  252
            AT FV++RLLY IFP +  F+R A RR  +  +   + EY      +A Q F+ L     
Sbjct  224  ATVFVILRLLYRIFPKIDSFTRWAWRRHNMFAKLMGAHEYFLTYLEQARQKFHRLYPSSS  283

Query  251  KRSNLQEGAMNAKAWASKSLASVSIGD  171
            KR NLQEGAMNA AWASKSLASVSIG+
Sbjct  284  KRGNLQEGAMNATAWASKSLASVSIGE  310



>ref|NP_001105765.1| adenosine 5'-phosphosulfate reductase-like3 precursor [Zea mays]
 gb|AAW63053.1| adenosine 5'-phosphosulfate reductase 3 [Zea mays]
 gb|ACF85092.1| unknown [Zea mays]
 gb|AFW64433.1| adenosine 5'-phosphosulfate reductase 3 [Zea mays]
Length=323

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 177/267 (66%), Gaps = 3/267 (1%)
 Frame = -2

Query  965  IFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  786
            +   PD TCS  + +      VIEGDE +L RA++++H    DY+A+LFYASWCPFS++ 
Sbjct  44   VLRTPD-TCSTLDRRLGDPVGVIEGDEVTLARAVNLLHANKDDYIAVLFYASWCPFSQEC  102

Query  785  KPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSL  606
            KP F  ++ L P + HFA EESAI+PS +S+YG+ GFPTLFL+NSTMR RYHG R++ SL
Sbjct  103  KPNFETLAYLFPAIRHFAFEESAIRPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSL  162

Query  605  VDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLAL  426
              FY D++G   S K       +    +      +EQE+CPF W+RSP+N L+Q+TYLAL
Sbjct  163  AAFYTDVSGINASVKSTAGEAMVHPLDDIEHKKDAEQENCPFWWARSPENILQQDTYLAL  222

Query  425  ATAFVLMRLLYVIFPAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSL-KEPC  252
            AT FV++RLLY IFP +  F+R A RR  +  +   + EY      +A Q F+ L     
Sbjct  223  ATVFVILRLLYRIFPKIDSFTRWAWRRHNMFAKLMGAHEYFLTYLEQARQKFHRLYPSSS  282

Query  251  KRSNLQEGAMNAKAWASKSLASVSIGD  171
            KR NLQEGAMNA AWASKSLASVSIG+
Sbjct  283  KRGNLQEGAMNATAWASKSLASVSIGE  309



>ref|XP_004953961.1| PREDICTED: 5'-adenylylsulfate reductase-like 3-like isoform X1 
[Setaria italica]
Length=320

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/300 (46%), Positives = 186/300 (62%), Gaps = 4/300 (1%)
 Frame = -2

Query  1064  MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDE  885
             MALL+         +  A  P   C   +  + +   P+   ++D +       VIEGDE
Sbjct  9     MALLLPFLLAGVGSSAAASVPTDACRVPTTVESVLGTPEMCSTLDRLGDPV--GVIEGDE  66

Query  884   KSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPS  705
              +L +A++++H    DY+A+LFYASWCPFS++ KP F  ++SL P + HFA EESAI+PS
Sbjct  67    VTLAKAVNLLHMNKDDYIAILFYASWCPFSQECKPNFETLASLFPTIRHFAFEESAIRPS  126

Query  704   TLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSS  525
              +S+YG+ GFPTLFL+NSTMR RYHG R++ SL  FY D++G     K       +    
Sbjct  127   IISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSLAAFYTDVSGINALVKSTAGEAMVHSLD  186

Query  524   NKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR-ASRR  348
             +      +EQE+CPF W+RSP+  L+Q+TYLALAT FV++RLLY++FP +  F+R A RR
Sbjct  187   DIEHKKDAEQENCPFWWARSPEKILQQDTYLALATTFVILRLLYLLFPKIDSFARWAWRR  246

Query  347   CILNLRTRSSWEYPQLCPSRAVQFFNSL-KEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               L      + EY      +A Q F+ L     KR NLQEGAMNA AWASKSLASVSIG+
Sbjct  247   HNLFANLTGAHEYFLNYLEQARQKFHRLYPSSSKRGNLQEGAMNATAWASKSLASVSIGE  306



>ref|XP_010421807.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Camelina sativa]
Length=294

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 180/276 (65%), Gaps = 23/276 (8%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  813
            C + SAKD+I    D + S        S +V EGD++ LQ A D++ +   DYVALLFYA
Sbjct  28   CPRGSAKDYILGFRDRSASYR------SGSVTEGDDRWLQVASDMIDKNKCDYVALLFYA  81

Query  812  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRY  633
            SWCPFSR  +P F ++S L   +PHFAIEES++K STLSKYGV GFPT+ LMNSTM   Y
Sbjct  82   SWCPFSRLLRPSFDLISLLYSSIPHFAIEESSVKSSTLSKYGVHGFPTIILMNSTMLVAY  141

Query  632  HGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS-RSPQN  456
             GSR+LDSLV FY D+TG E    D   ++K     + H    +E E+CPF W+ RSP+N
Sbjct  142  RGSRTLDSLVTFYSDVTGIE--KLDETWVEKNMLVPHFH----TEPENCPFPWARRSPEN  195

Query  455  FLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQ  279
             LRQETYL LAT FVL+RLL++I P +   ++ +  R  +N+R       PQ        
Sbjct  196  LLRQETYLTLATVFVLLRLLHLISPTMVMLAKFTWGRVTMNMR-------PQNLLEHTAA  248

Query  278  FFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             +  LKEPC  SNLQEGAMNA+AWASKSLASVSIG+
Sbjct  249  LY--LKEPCMSSNLQEGAMNARAWASKSLASVSIGE  282



>ref|XP_004953962.1| PREDICTED: 5'-adenylylsulfate reductase-like 3-like isoform X2 
[Setaria italica]
Length=310

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 189/301 (63%), Gaps = 16/301 (5%)
 Frame = -2

Query  1064  MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDE  885
             MALL+         +  A  P   C   +  + +   P+   ++D +       VIEGDE
Sbjct  9     MALLLPFLLAGVGSSAAASVPTDACRVPTTVESVLGTPEMCSTLDRLGDPV--GVIEGDE  66

Query  884   KSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPS  705
              +L +A++++H    DY+A+LFYASWCPFS++ KP F  ++SL P + HFA EESAI+PS
Sbjct  67    VTLAKAVNLLHMNKDDYIAILFYASWCPFSQECKPNFETLASLFPTIRHFAFEESAIRPS  126

Query  704   TLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTG-AETSSKDNISLDKIRCS  528
              +S+YG+ GFPTLFL+NSTMR RYHG R++ SL  FY D++G A   S D+I   K    
Sbjct  127   IISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSLAAFYTDVSGEAMVHSLDDIEHKK----  182

Query  527   SNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR-ASR  351
                     +EQE+CPF W+RSP+  L+Q+TYLALAT FV++RLLY++FP +  F+R A R
Sbjct  183   -------DAEQENCPFWWARSPEKILQQDTYLALATTFVILRLLYLLFPKIDSFARWAWR  235

Query  350   RCILNLRTRSSWEYPQLCPSRAVQFFNSL-KEPCKRSNLQEGAMNAKAWASKSLASVSIG  174
             R  L      + EY      +A Q F+ L     KR NLQEGAMNA AWASKSLASVSIG
Sbjct  236   RHNLFANLTGAHEYFLNYLEQARQKFHRLYPSSSKRGNLQEGAMNATAWASKSLASVSIG  295

Query  173   D  171
             +
Sbjct  296   E  296



>gb|EAY87573.1| hypothetical protein OsI_08985 [Oryza sativa Indica Group]
Length=311

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 194/300 (65%), Gaps = 15/300 (5%)
 Frame = -2

Query  1061  ALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEK  882
             ALL+ +   T A    +P P  C    +A++ +   P  TC+  + +      VIEGDE 
Sbjct  10    ALLLPIIAATAA---ASPLPEACPVPTAAEEILG--PGGTCTPLDRRGD-PVGVIEGDEV  63

Query  881   SLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPST  702
             +L +A+ +VH    DY+A+LFYASWCPFS++ KP F +++SL P + HFA EES+I+PS 
Sbjct  64    TLAKAITLVHMNKDDYIAVLFYASWCPFSQECKPNFEILASLFPSIRHFAFEESSIRPSI  123

Query  701   LSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSN  522
             +S+YG+ GFPTLFL+NSTMR RYHG R++ SL  FY D++G + S      L  +     
Sbjct  124   ISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSLAAFYRDVSGFDVSMTSEAVLHSVDGIEL  183

Query  521   KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFS-RASRRC  345
             K     +EQE+CPF W+RSP+  L+Q+TYLALATAFV++RLLY++FP +  F+ RA RR 
Sbjct  184   KK---DAEQENCPFWWARSPEKILQQDTYLALATAFVILRLLYLLFPKIGSFAKRAWRRH  240

Query  344   IL--NLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              L  NL     + +  L  +R  +FF     P KR NLQEGA NA AWASKSLASVSIG+
Sbjct  241   TLFPNLVGVHEYFFTYLEQARH-KFFRLY--PSKRGNLQEGARNATAWASKSLASVSIGE  297



>ref|XP_010436141.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Camelina sativa]
Length=296

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 181/276 (66%), Gaps = 21/276 (8%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  813
            C + SAKD+I    D +     +  S   +V EGD++ LQ A D++ +   DYVALLFYA
Sbjct  28   CPRGSAKDYILGFRDRSA----LHRSGFVSVTEGDDRWLQVASDMIDKNRCDYVALLFYA  83

Query  812  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRY  633
            SWCPFSR  +P F ++S L   +PHFAIEES++K STLSKYGV GFP++ +MNSTM   Y
Sbjct  84   SWCPFSRLLRPSFDLISLLYSSIPHFAIEESSVKSSTLSKYGVHGFPSIIIMNSTMLVAY  143

Query  632  HGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS-RSPQN  456
             GSR+LDSLV FY D+TG   +  D   ++K R   + H    +E E+CPF W+ RSP+N
Sbjct  144  RGSRTLDSLVAFYSDVTG--ITKLDETWVEKNRLVPHFH----TEPENCPFPWARRSPEN  197

Query  455  FLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQ  279
             LRQETYL LAT FVL+RLL++I P +   ++ +  R   N+R       PQ      V 
Sbjct  198  LLRQETYLTLATVFVLLRLLHLISPTMVMLAKFTWGRVAKNMR-------PQNLLEHTVA  250

Query  278  FFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             +  LKEPC  SNLQEGAMNA+AWASKSLA+VSIG+
Sbjct  251  VY--LKEPCMSSNLQEGAMNARAWASKSLATVSIGE  284



>ref|NP_001048159.1| Os02g0754900 [Oryza sativa Japonica Group]
 sp|Q84P95.1|APRL3_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 3; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 3; Short=APR-like 
3; Short=OsAPRL3; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAO72589.1| disulfide isomerase-like protein [Oryza sativa Japonica Group]
 dbj|BAD17244.1| disulfide isomerase [Oryza sativa Japonica Group]
 dbj|BAF10073.1| Os02g0754900 [Oryza sativa Japonica Group]
 gb|EAZ24661.1| hypothetical protein OsJ_08430 [Oryza sativa Japonica Group]
Length=311

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 194/300 (65%), Gaps = 15/300 (5%)
 Frame = -2

Query  1061  ALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEK  882
             ALL+ +   T A    +P P  C    +A++ +   P  TC+  + +      VIEGDE 
Sbjct  10    ALLLPIIAATAA---ASPLPEACPVPTAAEEILG--PGGTCTTLDRRGD-PVGVIEGDEV  63

Query  881   SLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPST  702
             +L +A+ ++H    DY+A+LFYASWCPFS++ KP F +++SL P + HFA EES+I+PS 
Sbjct  64    TLAKAITLLHMNKDDYIAVLFYASWCPFSQECKPNFEILASLFPSIRHFAFEESSIRPSI  123

Query  701   LSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSN  522
             +S+YG+ GFPTLFL+NSTMR RYHG R++ SL  FY D++G + S      L  +     
Sbjct  124   ISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSLAAFYRDVSGFDVSMTSEAVLHSVDGIEL  183

Query  521   KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFS-RASRRC  345
             K     +EQE+CPF W+RSP+  L+Q+TYLALATAFV++RLLY++FP +  F+ RA RR 
Sbjct  184   KK---DAEQENCPFWWARSPEKILQQDTYLALATAFVILRLLYLLFPKIGSFAKRAWRRH  240

Query  344   IL--NLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              L  NL     + +  L  +R  +FF     P KR NLQEGA NA AWASKSLASVSIG+
Sbjct  241   TLFPNLVGVHEYFFTYLEQARH-KFFRLY--PSKRGNLQEGARNATAWASKSLASVSIGE  297



>ref|XP_006397245.1| hypothetical protein EUTSA_v10028636mg [Eutrema salsugineum]
 gb|ESQ38698.1| hypothetical protein EUTSA_v10028636mg [Eutrema salsugineum]
Length=470

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 181/279 (65%), Gaps = 17/279 (6%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVHRRSHDYVALL  822
            C + SAKD+I    D  C   +  +S      +V EGD++ LQ A D++H    DYVALL
Sbjct  191  CHRGSAKDYILGFRDRNCPCSDESASRRPRFVSVTEGDDRWLQMASDMIHEDKCDYVALL  250

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFS   +P F V+S +   VPHFAIEES++K STLSKYGV GFPT+ L+NSTMR
Sbjct  251  FYASWCPFSGSIRPSFDVISLIYSSVPHFAIEESSVKASTLSKYGVHGFPTIILLNSTMR  310

Query  641  FRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS-RS  465
              Y GSR+LDS+V FY D+TG ET   D  S++K R           E E+CP SW+ RS
Sbjct  311  LAYRGSRTLDSIVTFYRDITGIET--LDETSVEKNRLVPQFGNQNSIEPENCPVSWARRS  368

Query  464  PQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSR  288
            P N  RQETYLALAT FV++RLL++IFP +   ++ +  R   N+R  +  E+       
Sbjct  369  PDNLFRQETYLALATVFVVLRLLHLIFPVLVTLAKFTWGRIARNMRPGNFLEH-------  421

Query  287  AVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             V  +  LKEPC  SNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  422  VVAMY--LKEPCMSSNLQ-GAMNARAWASKSLATVSIGD  457



>ref|XP_009391309.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/303 (49%), Positives = 195/303 (64%), Gaps = 11/303 (4%)
 Frame = -2

Query  1067  GMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKS--SCSTAVIE  894
             G+AL+ ++  +  A +  +P     C + SA D I   PDS   +D           V+E
Sbjct  7     GVALVFLIALV--AASAGSP----VCPRPSAGDSIMGRPDSCWDLDPTAELRGYQIGVVE  60

Query  893   GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAI  714
             GDE  LQ+AL +V +   +YVALLFYASWCPFS+  +P F ++S+L P + HFA EES I
Sbjct  61    GDEAVLQKALSIVQKNREEYVALLFYASWCPFSKICRPNFQILSNLFPTIHHFAFEESVI  120

Query  713   KPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIR  534
             +PS +SKYGV GFPTLFL+NSTMR RYHGSR+++SLV FY  +TG   SS  ++SLDK  
Sbjct  121   RPSIISKYGVHGFPTLFLLNSTMRVRYHGSRNVNSLVAFYNHITGVGPSSVKSMSLDKFV  180

Query  533   CSSNKHRDGGSE-QESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR-FSR  360
                N       + QESCPFSW+RSP+  L+Q+ YLALA+ F+LMRLLY + P++     R
Sbjct  181   DPPNDTEPKEEDVQESCPFSWARSPEKLLQQDGYLALASCFLLMRLLYFLLPSLNACLQR  240

Query  359   ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVS  180
             A RR +      + W + +     A Q    L  PCKRSNLQEGAMNA+AWAS+SLASVS
Sbjct  241   AWRRQMRYASLINFWNHLRAYTEEAKQGVGRLY-PCKRSNLQEGAMNARAWASQSLASVS  299

Query  179   IGD  171
             +G+
Sbjct  300   LGE  302



>ref|NP_001105802.1| adenosine 5'-phosphosulfate reductase-like4 precursor [Zea mays]
 gb|AAW63054.1| adenosine 5'-phosphosulfate reductase 4 [Zea mays]
 gb|AFW73496.1| adenosine 5'-phosphosulfate reductase 4 [Zea mays]
Length=321

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 190/314 (61%), Gaps = 18/314 (6%)
 Frame = -2

Query  1088  RLREWRAGMALLMIVGRLTCAHTLTA----PFPALCCSKYSAKDWIFALPDSTCSIDEIK  921
             RL  W A +   ++ G  T A         P P +  S    +D        TCS  ++ 
Sbjct  4     RLPLWTALLLPFLLTGVGTAAAASPPHDECPVPTIVESVLGTRD--------TCSTLDLG  55

Query  920   SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  741
             +     V+EGDE +L  A++++H    DY+A+LFYASWCPFS++ KP F  ++SL P + 
Sbjct  56    NPV--GVVEGDEFTLATAVNLLHANKDDYIAVLFYASWCPFSQECKPNFETLASLFPTIR  113

Query  740   HFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTG--AETS  567
             HFA EESAI+PS +S+YG+ GFPTLFL+NSTMR RYHG R++  L  FY D++G  A  +
Sbjct  114   HFAFEESAIRPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKPLAAFYTDVSGINASVN  173

Query  566   SKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVI  387
              K       +    +  R   +EQE+CPF W+RSP+  L+Q+TYLALATAFV++RLLY +
Sbjct  174   VKSTAGETMVHPLHDIERQKDAEQENCPFWWARSPEKILQQDTYLALATAFVILRLLYRL  233

Query  386   FPAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSL-KEPCKRSNLQEGAMNAK  213
             FP +  F+R A RR  L      + EY      +  Q F+ L     KR NLQEGAMNA 
Sbjct  234   FPKIDSFARWAWRRHNLFANLMGAHEYFLTYLEQGRQKFHRLYPSSSKRGNLQEGAMNAT  293

Query  212   AWASKSLASVSIGD  171
             AWASKSLASVSIG+
Sbjct  294   AWASKSLASVSIGE  307



>ref|XP_010455301.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Camelina sativa]
Length=294

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/272 (52%), Positives = 179/272 (66%), Gaps = 23/272 (8%)
 Frame = -2

Query  980  SAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCP  801
            SAKD+I    D +          S +V EGD++ LQ A D++ +   DYVALLFYASWCP
Sbjct  32   SAKDYILGFRDRSALYR------SGSVTEGDDRWLQVASDMIDKNKCDYVALLFYASWCP  85

Query  800  FSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSR  621
            FSR  +P F ++S L   +PHFA+EES++K STLSKYGV GFPT+ LMNSTM   Y GSR
Sbjct  86   FSRLLRPSFDLISLLYSSIPHFAVEESSVKSSTLSKYGVHGFPTIILMNSTMLVAYRGSR  145

Query  620  SLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS-RSPQNFLRQ  444
            +LDSLV FY D+TG E    D   ++K       H    +E E+CPF W+ RSP+N LRQ
Sbjct  146  TLDSLVTFYSDVTGIE--KLDETWVEKNMLVPQFH----TEPENCPFPWARRSPENLLRQ  199

Query  443  ETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNS  267
            ETYL LAT FVL+RLL++I P +   ++ +  R   N+R ++  E+     + AV     
Sbjct  200  ETYLTLATVFVLLRLLHLISPTMVMLAKFTWGRVAKNMRPQNLLEH-----TAAVY----  250

Query  266  LKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            LKEPC  SNLQEGAMNA+AWASKSLASVSIG+
Sbjct  251  LKEPCMSSNLQEGAMNARAWASKSLASVSIGE  282



>emb|CDY54942.1| BnaCnng27720D [Brassica napus]
Length=288

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 196/302 (65%), Gaps = 21/302 (7%)
 Frame = -2

Query  1085  LREWRAGMALLMIVGRLTCAHTLTAPFPALC-----CSKYSAKDWIFALPDSTCSI-DEI  924
             + +W   + L+++ G+LT        F A C     C+  S KD+ F L D TC + DE+
Sbjct  1     MEKWNFLLLLVIVFGKLT--------FVAFCARVPICAPRSVKDYTFELRDPTCRLSDEL  52

Query  923   KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
                       GDE+ LQ ALD++H+   +YVALLFYASWCPFS  F+P F V+SSL   +
Sbjct  53    HERLHF----GDERWLQTALDMIHKNKCNYVALLFYASWCPFSISFRPSFHVISSLYSSI  108

Query  743   PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSS  564
             PHFAI+ES++K STLSKYGV GFPTL L+NSTMR RY G+R LDSLV FY D+TG ET  
Sbjct  109   PHFAIKESSVKRSTLSKYGVHGFPTLLLVNSTMRARYRGTRMLDSLVAFYTDVTGIET--  166

Query  563   KDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIF  384
              D  S+++     +   +  ++ E+CPF+W+RSP+N +RQET LALA  FVL+RLLY+++
Sbjct  167   LDKTSIEESVPVPHLGNENNTDPENCPFTWARSPENMIRQETCLALAVVFVLLRLLYLVY  226

Query  383   PAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAW  207
             PA+    + + RR   NLR  S  E+     SR+VQ    L EPCKR NLQ GAMNA+AW
Sbjct  227   PALVVLMKYTWRRIAHNLRQESLQEHTVGLLSRSVQLCMHLIEPCKRRNLQGGAMNARAW  286

Query  206   AS  201
             AS
Sbjct  287   AS  288



>ref|NP_001117412.1| 5'-adenylylsulfate reductase-like 4 [Arabidopsis thaliana]
 gb|AEE31739.1| 5'-adenylylsulfate reductase-like 4 [Arabidopsis thaliana]
Length=281

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 141/278 (51%), Positives = 173/278 (62%), Gaps = 40/278 (14%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVHRRSHDYVALL  822
            C+  SAKD IF L D TCS+  ++S       AV EGDE+ LQ ALD++H+   DYVALL
Sbjct  28   CATKSAKDSIFGLRDQTCSVSGVESDERPRFVAVTEGDERWLQIALDMIHKNKCDYVALL  87

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFS                             STLSKYGV GFPTL L+NSTMR
Sbjct  88   FYASWCPFS-----------------------------STLSKYGVHGFPTLLLLNSTMR  118

Query  641  FRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSP  462
             RY G+R LDSLV FY D+TG ET   D  SL++     +   +  +E E+CPF+W+RSP
Sbjct  119  ARYRGTRMLDSLVAFYSDVTGIET--LDKTSLERSVSVPHLGNENNTEPENCPFTWARSP  176

Query  461  QNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRA  285
            +N LRQETYLALA  FVL+RLL++I+P +  F + + RR   N+R  S  E+     SRA
Sbjct  177  ENMLRQETYLALAIVFVLLRLLHLIYPTLVVFMKFTWRRIAQNMRLESLLEHTVGFLSRA  236

Query  284  VQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            VQ         +RSNLQ GAMNA+AWASKSLA+VSIGD
Sbjct  237  VQLCMH-----RRSNLQGGAMNARAWASKSLATVSIGD  269



>ref|XP_006647922.1| PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfate reductase-like 
3-like [Oryza brachyantha]
Length=312

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/282 (48%), Positives = 185/282 (66%), Gaps = 6/282 (2%)
 Frame = -2

Query  1013  APFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDY  834
             +P P  C    +A++ +   P  TC+  + +      VIEGDE +L +A+ ++H    DY
Sbjct  22    SPLPESCPVPTAAEEVLG--PQRTCAPLDRRGD-PVGVIEGDEVTLAKAVALLHMNKDDY  78

Query  833   VALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMN  654
             +A+LFYASWCPFS++ KP F +++SL P + HF  EES+I+PS +S+YG+ GFPTLFL+N
Sbjct  79    IAVLFYASWCPFSQECKPNFEILASLFPAIRHFTFEESSIRPSIISRYGIHGFPTLFLLN  138

Query  653   STMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSW  474
             STMR RYHG R++ SL  FY D++G +  S  + +L+ +           +EQE+CPF W
Sbjct  139   STMRVRYHGPRTVKSLAAFYRDVSGFDI-SMTSANLEAVDSLDGIELKKDTEQENCPFWW  197

Query  473   SRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR-ASRRCILNLRTRSSWEYPQLC  297
             +RSP+  L+Q+TYLALATAFV++RLLY++FP +  F++ A RR  L        EY    
Sbjct  198   ARSPEKILQQDTYLALATAFVILRLLYLLFPKIGSFAKQAWRRHTLFPNLVGVHEYFFTY  257

Query  296   PSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               +A Q F  L  P KR NLQEGA NA AWASKSLASVSIG+
Sbjct  258   LEQARQKFFRLY-PSKRGNLQEGARNATAWASKSLASVSIGE  298



>ref|XP_002874503.1| hypothetical protein ARALYDRAFT_911058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50762.1| hypothetical protein ARALYDRAFT_911058 [Arabidopsis lyrata subsp. 
lyrata]
Length=296

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/274 (51%), Positives = 177/274 (65%), Gaps = 27/274 (10%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTA--VIEGDEKSLQRALDVVHRRSHDYVALLF  819
            C K SAKD+I    D        KS+      V EGD++ LQ A +++ +   DYVALLF
Sbjct  30   CPKGSAKDYILGFQD--------KSALHRPAFVTEGDDQWLQMASEMIDKNKCDYVALLF  81

Query  818  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRF  639
            YASWCPFSR  +P F ++S L   VPHFAIEES++K STLSKYGV GFPT+ LMNSTM  
Sbjct  82   YASWCPFSRLLRPSFDLMSLLYSSVPHFAIEESSVKASTLSKYGVHGFPTIILMNSTMGV  141

Query  638  RYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSW-SRSP  462
             Y GSR+LDSLV FY D+TG ET   D   ++K R   + H    ++ E+CPF W +RSP
Sbjct  142  VYRGSRTLDSLVAFYSDVTGIET--LDETWVEKNRLVHHFH----TKPENCPFPWATRSP  195

Query  461  QNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRA  285
            +N LRQETYL  AT FVL+RLL +I P +   ++++  R   N+R R+  E+        
Sbjct  196  ENLLRQETYLTFATVFVLLRLLQLISPTMIVLAKSTWGRVAQNMRPRNLLEH--------  247

Query  284  VQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASV  183
              F   LKEPC  SNLQEGAMNA+AWASKSLA+V
Sbjct  248  -TFAMYLKEPCMSSNLQEGAMNARAWASKSLATV  280



>ref|XP_003570613.2| PREDICTED: probable pectin methyltransferase QUA2 [Brachypodium 
distachyon]
Length=1014

 Score =   259 bits (662),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 193/314 (61%), Gaps = 4/314 (1%)
 Frame = -2

Query  1106  FNSGMARLRE-WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID  930
              +S MAR    W A + LL+ +      H+  A  P   C   +A + I   P  TCS  
Sbjct  689   LHSPMARRSPCWPALLLLLLHISPAAVGHSSAASAPPDACPVPTAVESILG-PSYTCSPP  747

Query  929   EIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLP  750
             + +      VIEGDE +L RA++++H    DY+A+LFYASWCPFS++ KP F  ++ L P
Sbjct  748   DRRLGDPVGVIEGDEATLARAINLLHMNKDDYIAILFYASWCPFSQECKPNFEALAHLFP  807

Query  749   WVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAET  570
              + HFA EESAI+PS +S+YG+ GFPTLFL+NSTMR RYHG R++  L  FY D++G   
Sbjct  808   TIRHFAFEESAIRPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKPLAAFYSDVSGINA  867

Query  569   SSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYV  390
             S K       +    +       EQE+CPF W+RSP+N L+Q+TYLALAT+FV++RLLY+
Sbjct  868   SVKSTAEEAMVHSLEDIEPKKDVEQENCPFWWARSPENILQQDTYLALATSFVILRLLYL  927

Query  389   IFPAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAK  213
             +FP +   ++ A RR  L        EY      +A Q FN L  P KR NLQEGA NA 
Sbjct  928   LFPKIVSLAKQAWRRHTLFGNLMGVHEYFFTYLDQARQKFNRLY-PSKRGNLQEGARNAT  986

Query  212   AWASKSLASVSIGD  171
             AWASKSLASVSIG+
Sbjct  987   AWASKSLASVSIGE  1000



>dbj|BAK05689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=321

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 192/315 (61%), Gaps = 15/315 (5%)
 Frame = -2

Query  1094  MARLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS  915
             M R   WRA  ALL+++  +    +  AP     C   +A + +   P  TCS  + +  
Sbjct  1     MGRGSPWRAAAALLLLLLLVAAGRSSAAPARPGACPVPAAAEAVLG-PPRTCSPLDRRLG  59

Query  914   CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  735
                 VIEGDE +L RA+++++    +Y+A+LFYASWCPFS++ KP F  ++ L P + HF
Sbjct  60    DPVGVIEGDEATLARAVNLLYLNKDEYIAVLFYASWCPFSQECKPNFEKLAHLFPTIRHF  119

Query  734   AIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDN  555
             A EESAI+PS +S+YG+ GFPTLFL+NSTMR RYHG R++  L  FY D++G   S +  
Sbjct  120   AFEESAIRPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKPLAAFYSDVSGINASMEST  179

Query  554   IS------LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLY  393
                     LD+I    N       E E+CPF W+RSP+N L+Q+TYLALA +FV++RLLY
Sbjct  180   TGEAVPHPLDEIEPKKN------VEPENCPFWWARSPENILQQDTYLALAASFVILRLLY  233

Query  392   VIFPAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNA  216
             ++FP +   ++ A RR  L        EY      +A Q FN L  P KR NL EGA NA
Sbjct  234   LLFPRIVSAAKWAWRRHTLFANLMGVHEYFFSYLEQARQIFNRLY-PSKRGNLHEGARNA  292

Query  215   KAWASKSLASVSIGD  171
              AWASKSLASVSIG+
Sbjct  293   TAWASKSLASVSIGE  307



>ref|XP_006288344.1| hypothetical protein CARUB_v10001592mg [Capsella rubella]
 gb|EOA21242.1| hypothetical protein CARUB_v10001592mg [Capsella rubella]
Length=297

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 179/276 (65%), Gaps = 20/276 (7%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  813
            C + SAKD+I    D +     +  S   +V EGD++ LQ A D++ +   DYVALLFYA
Sbjct  28   CPRGSAKDYILGFRDRSA----LHRSSFVSVTEGDDRWLQVASDMIDKNKCDYVALLFYA  83

Query  812  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRY  633
            SWCPFSR  +P F ++S +   +PHFAIEES++K STLSKYGV GFP++ L+NSTM   Y
Sbjct  84   SWCPFSRLVRPSFDLISLMYSSIPHFAIEESSVKTSTLSKYGVHGFPSIILLNSTMLVAY  143

Query  632  HGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS-RSPQN  456
             GSR+LDSLV FY D+TG +    D   ++K R   + H    +E E+CPF W+ RSP+N
Sbjct  144  RGSRTLDSLVAFYSDITGIK--KLDETWVEKNRLIPHIH----AEPENCPFPWARRSPEN  197

Query  455  FLRQETYLALATAFVLMRLLYVIFPAVCRFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQ  279
             L QETYL LAT FVL+RLL++I P +  F +    R   N+R +      +L       
Sbjct  198  LLGQETYLTLATVFVLLRLLHLISPTMFLFLKFIWGRIAKNMRPQR-----KLLEHTVAV  252

Query  278  FFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            +   LKEPC  SNLQEGAMNAKAWASKSLA+VSIG+
Sbjct  253  Y---LKEPCMSSNLQEGAMNAKAWASKSLATVSIGE  285



>gb|KFK32103.1| hypothetical protein AALP_AA6G199200 [Arabis alpina]
Length=301

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/277 (49%), Positives = 174/277 (63%), Gaps = 22/277 (8%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDS-TCSIDEIKSSCS----TAVIEGDEKSLQRALDVVHRRSHDYVA  828
            C   S KD++    D   C +   +S+       +V EGD++ LQ A D++H+   DYVA
Sbjct  24   CPTTSPKDYLLGFRDPPICPVSGDESTSLRPRFVSVTEGDDRWLQSASDMIHKNKCDYVA  83

Query  827  LLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNST  648
            LLFYASWCPFSR F+P F  +S L   +PHFAIEES+++ STLSKYGV GFPT+ L NST
Sbjct  84   LLFYASWCPFSRSFRPSFDALSLLHSSIPHFAIEESSVRASTLSKYGVRGFPTIILFNST  143

Query  647  MRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS-  471
            +R  Y GSR+LDSLV FY D+TG ET   D+ S +      +      +E E+CP SW+ 
Sbjct  144  IRIAYRGSRTLDSLVGFYSDVTGIET--LDDSSPELTGLFPHLGNLNNTEPENCPVSWAK  201

Query  470  RSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCIL-NLRTRSSWEYPQLCP  294
            RSP+N  RQETYLALAT FVL+RLL++I P +   ++ + R +  N+R            
Sbjct  202  RSPENLFRQETYLALATVFVLLRLLHLISPTIVMLAKLTWRLVAQNMRL-----------  250

Query  293  SRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASV  183
                     LKEPC  SNLQEGAMNA+AWASKSLA+V
Sbjct  251  --GYIVAMHLKEPCMSSNLQEGAMNARAWASKSLATV  285



>ref|NP_192632.2| protein APR-like 6 [Arabidopsis thaliana]
 sp|Q9ZPE9.2|APRL6_ARATH RecName: Full=5'-adenylylsulfate reductase-like 6; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 6; Short=APR-like 
6; Short=AtAPRL6; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE82697.1| protein APR-like 6 [Arabidopsis thaliana]
Length=295

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/273 (51%), Positives = 178/273 (65%), Gaps = 27/273 (10%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTA--VIEGDEKSLQRALDVVHRRSH-DYVALL  822
            C + SAKD+I    D        KS+      V EGD++ LQ A D+V +++  DY ALL
Sbjct  29   CPRESAKDYILGFRD--------KSALHRPGFVTEGDDRWLQMAADMVDKKNKCDYAALL  80

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFSR  +P F ++S L   VPHFAIEES++K STLSKYGV GFPT+ LMNSTM 
Sbjct  81   FYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEESSVKASTLSKYGVHGFPTIILMNSTML  140

Query  641  FRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS-RS  465
              Y GSR+LDSLV FY D+TG ET   D   +++ R   + H    +E E+CPF W+ RS
Sbjct  141  VVYRGSRTLDSLVAFYTDVTGIET--MDERWVERNRLVPHFH----AEPENCPFPWARRS  194

Query  464  PQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCILNLRTRSSWEYPQLCPSRA  285
            P+N LRQETYL LAT FVL+RLL++I P +  F + +   + N+R  +  E+        
Sbjct  195  PENLLRQETYLTLATVFVLLRLLHLISPTMVVFVKFTWGRVSNMRLGNPLEH-------T  247

Query  284  VQFFNSLKEPCKRSNLQEGAMNAKAWASKSLAS  186
            V  +  LKEPC  SNLQEGAMNA+AWASKSLA+
Sbjct  248  VTMY--LKEPCMSSNLQEGAMNARAWASKSLAT  278



>gb|KJB29321.1| hypothetical protein B456_005G094200 [Gossypium raimondii]
Length=213

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -2

Query  893  GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAI  714
            GDE SLQ+AL++VHR  H+YVA+LFYASWCPFSR F+P F  +SS  P +PHFAI+ESA+
Sbjct  14   GDEISLQKALNMVHRNIHEYVAVLFYASWCPFSRSFRPSFLTLSSSYPSIPHFAIKESAV  73

Query  713  KPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIR  534
            +PS LSKYGV GFPTLFL+NS MR RYHG+RS +SL  FY D+TG +  S      DK R
Sbjct  74   RPSILSKYGVHGFPTLFLLNSKMRVRYHGNRSFESLSTFYNDVTGFQIKSLGKTLRDKTR  133

Query  533  CSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS  354
                  +   SEQES  FSW+RSPQN LRQETYLALAT FVL RLLY+ +P +  F+R +
Sbjct  134  HVLKHEKHKSSEQESWSFSWARSPQNLLRQETYLALATTFVLFRLLYLFYPTLLVFARFT  193

Query  353  -RRCILNLRTRSSWEYPQLC  297
             +R   +++  +  E+P L 
Sbjct  194  WKRINRDVKLGTMLEHPLLI  213



>gb|EPS62898.1| hypothetical protein M569_11894, partial [Genlisea aurea]
Length=286

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 175/275 (64%), Gaps = 19/275 (7%)
 Frame = -2

Query  995  CCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFY  816
             C   +  +++F   +  CS     +     VI+G+E +LQ+ L  +HR  ++Y ALLFY
Sbjct  27   VCPLNTVPEFVFPSKNDVCS-----AGGGGGVIQGNEITLQKTLSSIHRNEYEYAALLFY  81

Query  815  ASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFR  636
            +SWCPFS   +PIFS++SS+ P +PHFAIEES+I+PS LSKYGV GFP+L L+NSTMR R
Sbjct  82   SSWCPFSLPLRPIFSMLSSIFPSIPHFAIEESSIRPSILSKYGVHGFPSLILLNSTMRVR  141

Query  635  YHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQN  456
            Y GSR+LDSL+ FY + TG     + N S    RCS    +    E+E CPF W+RSP+N
Sbjct  142  YQGSRTLDSLIAFYKEFTGNLVPLEGNGSSS--RCSVKDEKSF--EEEGCPFPWARSPEN  197

Query  455  FLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQF  276
             LRQETYL LAT FV+ RL+++IFP   R++R++ R   +    +++   Q+     +  
Sbjct  198  LLRQETYLTLATIFVISRLVHLIFPTFRRYARSAWRRYSSSTVPAAYYVNQIL----LVL  253

Query  275  FNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              S K    R+ LQEG   AK WASKSL++VS+ D
Sbjct  254  VQSFK---GRNLLQEG---AKTWASKSLSTVSLAD  282



>emb|CDY28407.1| BnaA05g18330D [Brassica napus]
Length=263

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 158/227 (70%), Gaps = 7/227 (3%)
 Frame = -2

Query  992  CSKYSAKDW-IFALPDSTCSI-DEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLF  819
            C+  S KD+  F L D TC + DE+        + GDE+ LQ ALD++H+   +YVALLF
Sbjct  26   CTPRSVKDYYTFELRDPTCPLSDELHER--LPFVAGDERWLQTALDMIHKNKCNYVALLF  83

Query  818  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRF  639
            YASWCPFS  F+P F V+SSL   +PHFAI+ES++KPSTLSKYGV GFPTL L+NSTMR 
Sbjct  84   YASWCPFSISFRPSFHVISSLYSSIPHFAIKESSVKPSTLSKYGVHGFPTLLLVNSTMRA  143

Query  638  RYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQ  459
            RY G+R LDSLV FY D+TG ET   D  S++K     +   +  +E E+CPF+W+RSP+
Sbjct  144  RYRGTRMLDSLVAFYTDVTGIET--LDKTSIEKSVPVPHLGNEDNTEPENCPFTWARSPE  201

Query  458  NFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRS  321
            N +RQET LALA AF+L+RLLY+++PA+    + + RR   NLR  S
Sbjct  202  NMIRQETCLALAVAFILLRLLYLVYPALVVLMKYTWRRIAHNLRQES  248



>ref|XP_010543933.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010543938.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X2 [Tarenaya 
hassleriana]
Length=297

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 183/307 (60%), Gaps = 30/307 (10%)
 Frame = -2

Query  1064  MALLMIVGRLTCA--HTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTA----  903
             +  ++++G LTCA   + ++      C   S+KD I    D  C +       S A    
Sbjct  6     LLFVVVLGNLTCAAVSSSSSSKRVSSCPLGSSKDHILGFRDRYCPVSWPGGEESDAHPSF  65

Query  902   --VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
               V  G+E+ LQ  LD++H+R   YVA+LF+ASWCPFSR F+P FS++SSL   +PHFAI
Sbjct  66    GSVTRGNERCLQIMLDMIHKRECKYVAVLFFASWCPFSRSFRPTFSIISSLYSSIPHFAI  125

Query  728   EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHG-SRSLDSLVDFYGDLTGAETSSKDNI  552
             EES++  S LSKYGV GFPTLF+MNSTMR RY G SRSL SLV FY D+TG      +  
Sbjct  126   EESSVGSSVLSKYGVHGFPTLFIMNSTMRVRYQGPSRSLSSLVAFYRDVTG------EGF  179

Query  551   SLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC  372
                 +  SS +  D  S +E+          N LRQET LALAT FVL+RLL+ +FP   
Sbjct  180   KFKPMELSSIEKLDEASVEEN-------RLVNLLRQETCLALATVFVLLRLLHSVFP---  229

Query  371   RFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
                  +R    N+   S  E+  +  SR VQ    LKEP KR NLQEGAMNA AWASKSL
Sbjct  230   -----TRLFAQNMSLDSLLEHTVVYLSRVVQLCIRLKEPRKRRNLQEGAMNAGAWASKSL  284

Query  191   ASVSIGD  171
             A+VSIGD
Sbjct  285   ATVSIGD  291



>ref|XP_009417587.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417588.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Musa acuminata 
subsp. malaccensis]
Length=450

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/277 (49%), Positives = 179/277 (65%), Gaps = 5/277 (2%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIK--SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLF  819
            C + S  D I   PDS    D      +    V+EGDE +LQ+A  +V +   DYVALLF
Sbjct  154  CPRPSVVDTILGRPDSCWDSDSTLPLGAYQIGVVEGDEATLQKASSMVQKNREDYVALLF  213

Query  818  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRF  639
            YASWCPFS+   P F ++S+L P + HFA EES I+PS LS+YGV GFPTLFL+NSTMR 
Sbjct  214  YASWCPFSKICHPNFQILSNLFPTIRHFAFEESVIRPSILSRYGVHGFPTLFLLNSTMRV  273

Query  638  RYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQ  459
            +YHGSR+ +SLV FY  +TG   S K  + LD +    +        QE+CPFSW+RSP+
Sbjct  274  QYHGSRTRNSLVAFYNHVTGVGPSPK-LVFLDNVMDPPDDTELKEDMQENCPFSWARSPE  332

Query  458  NFLRQETYLALATAFVLMRLLYVIFPAVCR-FSRASRRCILNLRTRSSWEYPQLCPSRAV  282
              L+Q+ YLALA+ F+LMRLLY + P +   F RA RR +     R+ W Y Q    +A 
Sbjct  333  KLLQQDGYLALASGFLLMRLLYFLLPRLNACFQRAWRRQMRYASVRNLWNYFQAYTEQAK  392

Query  281  QFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            +  + L  PC+R +LQEGAM+A+AWAS+SLASV++G+
Sbjct  393  REGSRL-HPCERHHLQEGAMSARAWASQSLASVTLGE  428



>gb|AAD17368.1| contains similarity to protein disulfide isomerases [Arabidopsis 
thaliana]
 emb|CAB78017.1| putative protein disulfide isomerase [Arabidopsis thaliana]
Length=327

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 180/299 (60%), Gaps = 47/299 (16%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTA--VIEGDEKSLQRALDVVHRRSH-DYVALL  822
            C + SAKD+I    D        KS+      V EGD++ LQ A D+V +++  DY ALL
Sbjct  29   CPRESAKDYILGFRD--------KSALHRPGFVTEGDDRWLQMAADMVDKKNKCDYAALL  80

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFSR  +P F ++S L   VPHFAIEES++K STLSKYGV GFPT+ LMNSTM 
Sbjct  81   FYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEESSVKASTLSKYGVHGFPTIILMNSTML  140

Query  641  FRYHGSRSLDSLVDFYGDLT-------------------GAETSSKDNI------SLDKI  537
              Y GSR+LDSLV FY D+T                    A+ +++D        ++D+ 
Sbjct  141  VVYRGSRTLDSLVAFYTDVTVLLWLLLCSCYRLYIPIKISADETNQDKFIHVGIETMDER  200

Query  536  RCSSNKHRDG-GSEQESCPFSWS-RSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFS  363
                N+      +E E+CPF W+ RSP+N LRQETYL LAT FVL+RLL++I P +  F 
Sbjct  201  WVERNRLVPHFHAEPENCPFPWARRSPENLLRQETYLTLATVFVLLRLLHLISPTMVVFV  260

Query  362  RASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLAS  186
            + +   + N+R  +  E+        V  +  LKEPC  SNLQEGAMNA+AWASKSLA+
Sbjct  261  KFTWGRVSNMRLGNPLEH-------TVTMY--LKEPCMSSNLQEGAMNARAWASKSLAT  310



>ref|XP_010543943.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X3 [Tarenaya 
hassleriana]
Length=250

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 159/243 (65%), Gaps = 22/243 (9%)
 Frame = -2

Query  896  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESA  717
            +G+E+ LQ  LD++H+R   YVA+LF+ASWCPFSR F+P FS++SSL   +PHFAIEES+
Sbjct  23   QGNERCLQIMLDMIHKRECKYVAVLFFASWCPFSRSFRPTFSIISSLYSSIPHFAIEESS  82

Query  716  IKPSTLSKYGVIGFPTLFLMNSTMRFRYHG-SRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  S LSKYGV GFPTLF+MNSTMR RY G SRSL SLV FY D+TG      +      
Sbjct  83   VGSSVLSKYGVHGFPTLFIMNSTMRVRYQGPSRSLSSLVAFYRDVTG------EGFKFKP  136

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
            +  SS +  D  S +E+          N LRQET LALAT FVL+RLL+ +FP       
Sbjct  137  MELSSIEKLDEASVEEN-------RLVNLLRQETCLALATVFVLLRLLHSVFP-------  182

Query  359  ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVS  180
             +R    N+   S  E+  +  SR VQ    LKEP KR NLQEGAMNA AWASKSLA+VS
Sbjct  183  -TRLFAQNMSLDSLLEHTVVYLSRVVQLCIRLKEPRKRRNLQEGAMNAGAWASKSLATVS  241

Query  179  IGD  171
            IGD
Sbjct  242  IGD  244



>ref|XP_008782161.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Phoenix dactylifera]
Length=314

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 189/306 (62%), Gaps = 10/306 (3%)
 Frame = -2

Query  1082  REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCST  906
             R W AG  LL+    L   H   AP     C + SA D I    +S  ++D    +  S+
Sbjct  4     RVWTAGFLLLLGAASLPGGHACGAPPTEGLCPRVSAGDSILGHRNSCTAVDFPAHNEHSS  63

Query  905   AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
             +VIEG E +L RAL +++      VA+LFYASWCPFS+ F+P F V+SSL P V HFA+E
Sbjct  64    SVIEGGEHALSRALQLIYSMQGASVAVLFYASWCPFSKIFRPSFDVLSSLYPTVRHFAVE  123

Query  725   ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
             ES I+ S LS+YGV GFPTLF+MN T R +YHGSR  +SLV FY D+TG +  S D  SL
Sbjct  124   ESLIRRSILSRYGVRGFPTLFIMNCTYRVQYHGSRRTNSLVAFYSDITGIKPESLDPSSL  183

Query  545   D-KIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
             +  +  SS       + +++CP+SWSR+P+  L+Q TYLALAT F+L+RLLY +   +  
Sbjct  184   EVTVGSSSLVEFVEETNRKNCPYSWSRTPEKLLQQNTYLALATFFLLLRLLYFLLSKL--  241

Query  368   FSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLA  189
                A  RC  +    S W+  Q    +A Q F  L  PCKRS   +GAMNAK+WASK+LA
Sbjct  242   --NAWWRCTRHASLMSLWDCSQAYFVQAKQVFCRLN-PCKRS---KGAMNAKSWASKTLA  295

Query  188   SVSIGD  171
             SVSIG+
Sbjct  296   SVSIGE  301



>gb|EMS61645.1| putative pectin methyltransferase QUA2 [Triticum urartu]
Length=730

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 163/248 (66%), Gaps = 14/248 (6%)
 Frame = -2

Query  893  GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAI  714
            GDE +L RA+++++    +Y+A+LFYASWCPFS++ KP F  ++ L P + HFA EESAI
Sbjct  476  GDEATLARAVNLLYLNKDEYIAVLFYASWCPFSQECKPNFEKLAHLFPTIRHFAFEESAI  535

Query  713  KPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS-----  549
            +PS +S+YG+ GFPTLFL+NSTMR RYHG R++  L  FY D++G   S +         
Sbjct  536  RPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKPLAAFYSDVSGISASVESTTGEAMPH  595

Query  548  -LDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC  372
             LD+I    +       E E+CPF W+RSP+N L+Q+TYLALA +FV++RLLY++FP + 
Sbjct  596  PLDEIEPKKD------VEPENCPFWWARSPENILQQDTYLALAASFVILRLLYLLFPRIV  649

Query  371  RFSR-ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKS  195
              ++ A RR  L        EY      +A Q  + L  P KR NLQEGA NA AWASKS
Sbjct  650  SAAKWAWRRHTLFANLMGVHEYFFTYLEQARQKLSRLY-PSKRGNLQEGARNATAWASKS  708

Query  194  LASVSIGD  171
            LASVSIG+
Sbjct  709  LASVSIGE  716



>gb|KHG08455.1| 5'-adenylylsulfate reductase-like 4 [Gossypium arboreum]
Length=252

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 159/263 (60%), Gaps = 19/263 (7%)
 Frame = -2

Query  1076  WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTA  903
             W   + +L +  RLTCA  ++ P     C K S  + +F   DS CSI  D I+S  S  
Sbjct  6     WEMRILILFLWWRLTCA--VSVPVRVPLCPKNSVLEAVFDFRDSFCSIHSDFIESIDSVG  63

Query  902   VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  723
             V EGDE SLQ+AL++V       + +    S       F+P F  +SS  P +PHFA++E
Sbjct  64    VTEGDEISLQKALNMV-------MGIFMNMS-------FRPSFLTLSSSYPSIPHFAVKE  109

Query  722   SAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLD  543
             SA++PS LSKYGV GFPTLFL+NS MR RYHG+RS +SL  FY ++TG +  S D  S D
Sbjct  110   SAVRPSILSKYGVHGFPTLFLLNSKMRVRYHGNRSFESLSTFYNEVTGFQIKSLDKTSRD  169

Query  542   KIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFS  363
             K R          SEQES  FSW+RSPQN LRQETYLALAT FVL RLLY+ +P +  F+
Sbjct  170   KTRHVPKHENHKSSEQESWSFSWARSPQNLLRQETYLALATTFVLFRLLYLFYPTLLVFA  229

Query  362   RAS-RRCILNLRTRSSWEYPQLC  297
             R + +R   +++  +  E+P L 
Sbjct  230   RFTWKRINRDVKLGTMLEHPLLI  252



>gb|KDO80981.1| hypothetical protein CISIN_1g020846mg [Citrus sinensis]
 gb|KDO80982.1| hypothetical protein CISIN_1g020846mg [Citrus sinensis]
Length=175

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = -2

Query  647  MRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSR  468
            MR RYHGSR+LDSLV FY D+TG  T+S D IS DK+  +SN  +   +E+ESCPFSW+R
Sbjct  1    MRVRYHGSRTLDSLVAFYSDVTGMNTASLDKISPDKVGKASNHEKHNNTEEESCPFSWAR  60

Query  467  SPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPS  291
            SP+N L+QETYLALATAFVL+RL+Y+  P +  F++ + RR I NL+  S  E+P+   +
Sbjct  61   SPENLLQQETYLALATAFVLLRLVYIFLPTLLIFAQFTWRRLIRNLKLGSLLEHPRTYLN  120

Query  290  RAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            RA+Q F +L EPCKRSNLQEGA+NA+AWASKSLA+VSIGD
Sbjct  121  RAIQLFKTLNEPCKRSNLQEGALNARAWASKSLATVSIGD  160



>gb|ABK24398.1| unknown [Picea sitchensis]
Length=317

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/254 (45%), Positives = 161/254 (63%), Gaps = 17/254 (7%)
 Frame = -2

Query  902  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  723
            V E D  SL+ A D++ R S+ Y+A+LFYASWCPFS++ +P+F+V+SS+ P + H A+EE
Sbjct  58   VRELDAVSLEAAFDILQRSSNTYIAVLFYASWCPFSKQCRPVFNVLSSMFPTIHHVAVEE  117

Query  722  SAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLD  543
            SA KP    +YGV  FP LFL N T R RYHGSR LDS++ FY ++TG ++ S D  +  
Sbjct  118  SASKP----RYGVHSFPALFLQNQTSRVRYHGSRKLDSILHFYENITGIKSISPDFAT--  171

Query  542  KIRCSSNKHRDGGSEQES---CPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC  372
            +   SS +  D   + E+   CP+SW++SP+  L+Q+TYL LA  F+++R+L+ +FP V 
Sbjct  172  QASGSSLRGLDRVKDVENGVHCPYSWAKSPEKLLQQDTYLILAILFLVLRMLHFLFPKVL  231

Query  371  R-FSRASRRCILNLRTRSSWEYPQLCPSRAVQFFN------SLKEPCKRSNLQEGAMNAK  213
                R  +R +  +      E       + +  FN      SLK  CK  N QEGAMNA+
Sbjct  232  IWLKRVWKRHVWPVNGAILRENHPTFIEQILYIFNVNRIKTSLKL-CKGRNFQEGAMNAR  290

Query  212  AWASKSLASVSIGD  171
            AWASKSLASVS+G+
Sbjct  291  AWASKSLASVSLGE  304



>gb|EEC80244.1| hypothetical protein OsI_22194 [Oryza sativa Indica Group]
Length=282

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 150/247 (61%), Gaps = 21/247 (9%)
 Frame = -2

Query  905  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
             V EGD+  L RA++++H    D+ A+LFYASWCPFS++ +  F  ++ + P + H AIE
Sbjct  51   GVTEGDDAILARAVNLLHANKEDFAAVLFYASWCPFSQECRLRFEKLACIFPTIRHLAIE  110

Query  725  ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
            ES +K  T  +YG+ G+PTLFL+NST+R RYHG R++ SL  FY D++G   S    +  
Sbjct  111  ESTVKLRTRYRYGIHGYPTLFLINSTVRVRYHGPRTVKSLAAFYNDVSGINPSMDPAVGD  170

Query  545  DKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRF  366
            D I       RD   EQE C F  +R+P+N L+ +TYL LA +FV++RLLY+ +P +  F
Sbjct  171  DNI----EPKRD--CEQEKCLFWSARTPENILQPDTYLTLAASFVILRLLYLFYPKITAF  224

Query  365  SRA--SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             +   SRR +              C  +    FN +  P K+ NL +GA +A AWASKSL
Sbjct  225  VKRTWSRRTLFT------------CLEQGKHKFNRVY-PSKQGNLHDGARHATAWASKSL  271

Query  191  ASVSIGD  171
            ASVSIG+
Sbjct  272  ASVSIGE  278



>ref|NP_001057172.1| Os06g0220800 [Oryza sativa Japonica Group]
 sp|Q67VZ8.1|APRL2_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 2; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 2; Short=APR-like 
2; Short=OsAPRL2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD37671.1| disulfide isomerase-like protein [Oryza sativa Japonica Group]
 dbj|BAD37254.1| disulfide isomerase-like protein [Oryza sativa Japonica Group]
 gb|AAX14677.1| adenosine 5'-phosphosulfate reductase-like [Oryza sativa Japonica 
Group]
 dbj|BAF19086.1| Os06g0220800 [Oryza sativa Japonica Group]
 gb|EEE65349.1| hypothetical protein OsJ_20625 [Oryza sativa Japonica Group]
Length=282

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/247 (43%), Positives = 150/247 (61%), Gaps = 21/247 (9%)
 Frame = -2

Query  905  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
             V EGD+  L RA++++H    D+ A+LFYASWCPFS++ +  F  ++ + P + H AIE
Sbjct  51   GVTEGDDAILARAVNLLHANKEDFAAVLFYASWCPFSQECRLRFEKLACIFPTIRHLAIE  110

Query  725  ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
            ES ++  T  +YG+ G+PTLFL+NST+R RYHG R++ SL  FY D++G   S    +  
Sbjct  111  ESTVRLRTRYRYGIHGYPTLFLINSTVRVRYHGPRTVKSLAAFYNDVSGINPSMDPAVGD  170

Query  545  DKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRF  366
            D I       RD   EQE C F  +R+P+N L+ +TYL LA +FV++RLLY+ +P +  F
Sbjct  171  DNI----EPKRD--CEQEKCLFWSARTPENILQPDTYLTLAASFVILRLLYLFYPKITAF  224

Query  365  SRA--SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSL  192
             +   SRR +              C  +    FN +  P K+ NL +GA +A AWASKSL
Sbjct  225  VKRTWSRRTLFT------------CLEQGKHKFNRVY-PSKQGNLHDGARHATAWASKSL  271

Query  191  ASVSIGD  171
            ASVSIG+
Sbjct  272  ASVSIGE  278



>ref|XP_006656789.1| PREDICTED: 5'-adenylylsulfate reductase-like 2-like [Oryza brachyantha]
Length=298

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/310 (38%), Positives = 168/310 (54%), Gaps = 23/310 (7%)
 Frame = -2

Query  1088  RLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS  909
             RL  W A + LL     L+ A T+ A   A  C + SA   I    D  C    ++    
Sbjct  2     RLLWWWAALPLL-----LSVAGTVVASSTAPACPRPSAAVVIVGSHDEACWPLPLRRPLG  56

Query  908   T--AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  735
                 VIEGD+ +L RA+ +++    D+ A+LFYASWCPFS++ +  F  ++ + P + HF
Sbjct  57    DRLGVIEGDDATLARAVKLLNMNKEDFAAVLFYASWCPFSQECRLRFEKLAFIFPTIRHF  116

Query  734   AIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDN  555
             A EES ++ ST  +YG+  +PT FL+NST+R RYHG R++ SL  FY D++G   S+   
Sbjct  117   AFEESTVRSSTRFRYGIHAYPTFFLINSTVRVRYHGPRTVKSLAAFYSDVSGINPSTDLT  176

Query  554   ISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
             I  D I    N      S+ ESCP    R+  N  +Q+ YLALA +FV++RLL++++P  
Sbjct  177   IG-DDIPSLDNIELKKDSDPESCPLWSERTSDNIPQQDNYLALAISFVILRLLFLLYPTT  235

Query  374   CRFSRASRRCILNLRTRSSWEYPQLCP--SRAVQFFNSLKEPCKRSNLQEGAMNAKAWAS  201
               F             + +W  P L     +  Q  N +  P K+ +L  GA NA AWAS
Sbjct  236   IAF------------VKRTWSGPTLFTYLEQGRQKINRVY-PSKQGSLHHGAKNATAWAS  282

Query  200   KSLASVSIGD  171
             KSLASVSI +
Sbjct  283   KSLASVSIEE  292



>gb|KJB29323.1| hypothetical protein B456_005G094200 [Gossypium raimondii]
Length=199

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 118/167 (71%), Gaps = 4/167 (2%)
 Frame = -2

Query  1076  WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTA  903
             W   + +L +  RLTCA  +T P  A  C K S  + +F   DS CSI  D I+S  S  
Sbjct  6     WEMRILILFLWWRLTCA--VTVPVRAPLCPKNSVFEAVFDFRDSFCSIHSDFIESIDSVG  63

Query  902   VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  723
             V EGDE SLQ+AL++VHR  H+YVA+LFYASWCPFSR F+P F  +SS  P +PHFAI+E
Sbjct  64    VTEGDEISLQKALNMVHRNIHEYVAVLFYASWCPFSRSFRPSFLTLSSSYPSIPHFAIKE  123

Query  722   SAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLT  582
             SA++PS LSKYGV GFPTLFL+NS MR RYHG+RS +SL  FY D+T
Sbjct  124   SAVRPSILSKYGVHGFPTLFLLNSKMRVRYHGNRSFESLSTFYNDVT  170



>ref|XP_006853185.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Amborella trichopoda]
 gb|ERN14652.1| hypothetical protein AMTR_s00038p00202780 [Amborella trichopoda]
Length=255

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 127/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  950  DSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            DS C I       + AV+  +E SL+RAL+++H+ S  YVA+LFYASWCPFS+  K  F+
Sbjct  51   DSICPIASRVEVPTVAVV--NEISLERALNLIHKNSEKYVAILFYASWCPFSKICKTSFA  108

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
            ++ SL P + HFA+EES IKPS+LSKYGV GFPTLFL N+T R RY G+R++ +   FY 
Sbjct  109  ILPSLFPTIHHFAVEESTIKPSSLSKYGVRGFPTLFLQNATTRVRYRGARNVRAFARFYK  168

Query  590  DLTGAETSSKDNISLDKIR-CSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAF  414
              TG    S +     ++     +  R G  E E CPFSW+R P+  +RQETYLALA +F
Sbjct  169  STTGINPISPNYFEQKQMESLLLSLSRLGDDEAEHCPFSWARYPEKLVRQETYLALACSF  228

Query  413  VLMRLLYVIFPAV  375
            +L+RLLY + P +
Sbjct  229  LLVRLLYFVSPTL  241



>ref|XP_003574474.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X1 [Brachypodium 
distachyon]
Length=257

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 123/180 (68%), Gaps = 1/180 (1%)
 Frame = -2

Query  911  STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFA  732
            +  V+EGD+  LQRA+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+
Sbjct  55   NVGVVEGDDGVLQRAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFS  114

Query  731  IEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNI  552
             EES IKP  LS+YGV  FPTLFL+NST+R RYHGSR+++SLV FY D+TG    S D I
Sbjct  115  FEESHIKPRMLSRYGVRAFPTLFLVNSTVRVRYHGSRAMNSLVMFYKDVTGINPVSLDAI  174

Query  551  SLDKIRCSSN-KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
            SL++++   N    +  +EQE   F W+RSP   L Q+T LA A+ FV++RL + + P +
Sbjct  175  SLERMQDIVNIVENEKKTEQEDSLFLWARSPDRLLHQDTCLAFASTFVILRLFFFLLPKL  234



>ref|XP_004974687.1| PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfate reductase-like 
4-like [Setaria italica]
Length=373

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 123/178 (69%), Gaps = 1/178 (1%)
 Frame = -2

Query  905  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
             V+EGD+ +LQ+A+ +V     D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ E
Sbjct  173  GVVEGDDGALQKAIALVLHNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFE  232

Query  725  ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
            ES IKP  LS+YGV  FPTLFL+NSTMR RYHGSR+++SL  FY D+TG    S D +SL
Sbjct  233  ESHIKPRILSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLAMFYKDVTGMNPVSLDALSL  292

Query  545  DKIRCS-SNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
            +++  + +    D  SE E    SW+RSP   L Q+T LALA++FVL+RLL+ I P +
Sbjct  293  ERVEDTVTTIDNDKKSEMEDSLLSWARSPDRLLHQDTCLALASSFVLLRLLHFILPKL  350



>ref|XP_010235118.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X2 [Brachypodium 
distachyon]
Length=220

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 120/175 (69%), Gaps = 1/175 (1%)
 Frame = -2

Query  896  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESA  717
            EGD+  LQRA+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES 
Sbjct  23   EGDDGVLQRAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEESH  82

Query  716  IKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKI  537
            IKP  LS+YGV  FPTLFL+NST+R RYHGSR+++SLV FY D+TG    S D ISL+++
Sbjct  83   IKPRMLSRYGVRAFPTLFLVNSTVRVRYHGSRAMNSLVMFYKDVTGINPVSLDAISLERM  142

Query  536  RCSSN-KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
            +   N    +  +EQE   F W+RSP   L Q+T LA A+ FV++RL + + P +
Sbjct  143  QDIVNIVENEKKTEQEDSLFLWARSPDRLLHQDTCLAFASTFVILRLFFFLLPKL  197



>gb|EEC83570.1| hypothetical protein OsI_29227 [Oryza sativa Indica Group]
Length=274

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 122/179 (68%), Gaps = 1/179 (1%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
              V+EGD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ 
Sbjct  73   VGVVEGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSF  132

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
            EES IKP  LS+YGV  FPTLFL+NSTMR RYHGSR+++SL  FY D+TG    S D IS
Sbjct  133  EESRIKPRMLSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLAMFYKDVTGMNPVSLDAIS  192

Query  548  LDKIRCSSN-KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
            L+++  + N    D  +EQ    F ++RSP   L Q+T LALA++FVLMRLL  + P +
Sbjct  193  LERMEEAVNIIENDKKTEQGDSLFMFARSPDRLLHQDTCLALASSFVLMRLLCFLLPKL  251



>sp|Q5DJV7.1|APRL4_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 4; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 4; Short=APR-like 
4; Short=OsAPRL4; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX14678.1| adenosine 5'-phosphosulfate reductase-like [Oryza sativa Japonica 
Group]
Length=264

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 121/179 (68%), Gaps = 1/179 (1%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
              V+EGD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ 
Sbjct  63   VGVVEGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSF  122

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
            EES IKP  LS+YGV  FPTLFL+NSTMR RYHGSR+++SL  FY D+TG    S D IS
Sbjct  123  EESRIKPRMLSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLAMFYKDVTGMNPVSLDAIS  182

Query  548  LDKIRCSSN-KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
            L+++    N    D  +EQ    F ++RSP   L Q+T LALA++FVLMRLL  + P +
Sbjct  183  LERMEEVVNIIENDKKTEQGDSLFMFARSPDRLLHQDTCLALASSFVLMRLLCFLLPKL  241



>gb|EEE68672.1| hypothetical protein OsJ_27290 [Oryza sativa Japonica Group]
Length=200

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = -2

Query  896  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESA  717
            +GD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES 
Sbjct  3    QGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEESR  62

Query  716  IKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKI  537
            IKP  LS+YGV  FPTLFL+NSTMR RYHGSR+++SL  FY D+TG    S D ISL+++
Sbjct  63   IKPRMLSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLAMFYKDVTGMNPVSLDAISLERM  122

Query  536  RCSSN-KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
                N    D  +EQ    F ++RSP   L Q+T LALA++FVLMRLL  + P +
Sbjct  123  EEVVNIIENDKKTEQGDSLFMFARSPDRLLHQDTCLALASSFVLMRLLCFLLPKL  177



>ref|XP_006660127.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like, partial 
[Oryza brachyantha]
Length=204

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 115/167 (69%), Gaps = 1/167 (1%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
              V+EGD+  LQ+A+ +V +   D++A+LFYASWCPFS+ F+  F  +SSL P + HF+ 
Sbjct  3    VGVVEGDDAVLQKAVTLVLQNREDFIAILFYASWCPFSKIFRTDFQKLSSLFPTIAHFSF  62

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
            EES IKP  LS+YGV  FPTLFL+NSTMR RYHGSR+++SL  FY D+TG    + D IS
Sbjct  63   EESRIKPRMLSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLGLFYKDVTGMNPVALDAIS  122

Query  548  LDKIRCSSN-KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
            L+++    N    D  +EQE   F ++RSP   L Q+T LALA++FV
Sbjct  123  LERMEEVVNITEDDKKTEQEDALFIFARSPDRLLHQDTCLALASSFV  169



>gb|ADE77738.1| unknown [Picea sitchensis]
Length=325

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 144/249 (58%), Gaps = 9/249 (4%)
 Frame = -2

Query  902  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  723
            V E D+ SL+R LD++ R S  ++A+LF+ASWCPFS+  + +F  +SS+ P + H A+EE
Sbjct  66   VSELDDVSLERTLDIL-RYSDAHMAVLFHASWCPFSKSCRSLFDDLSSMFPKIYHVAVEE  124

Query  722  SAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLD  543
            S + PS LS+ GV  FP LFL N T R RY GSR LDSLV FY ++TG E  S D ++ +
Sbjct  125  SVLMPSVLSRNGVHSFPCLFLQNQTSRVRYRGSRDLDSLVHFYKEITGIEPISLDPLAKE  184

Query  542  KIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFS  363
                  +   +GG   E  P+ W  SP+N L++E YL  A  F+++R+L  +FP V    
Sbjct  185  FNGFRRSFRNEGGQSMEDSPYPWEMSPKNVLQREPYLVFAVLFLILRMLVYLFPKVLLQV  244

Query  362  RASR-RCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPC-----KRSNLQEGAMNAKAWAS  201
            +  R R I ++      E   L    A+   N  +  C     K  N QEGA NA+ WA 
Sbjct  245  KQCRLRRIWHVNLAFLSENTPLILKHALHMLNLNRIWCRLEFSKTRNFQEGAKNARVWA-  303

Query  200  KSLASVSIG  174
             SLASVS+G
Sbjct  304  -SLASVSLG  311



>ref|XP_001762516.1| predicted protein [Physcomitrella patens]
 gb|EDQ72639.1| predicted protein, partial [Physcomitrella patens]
Length=175

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 123/177 (69%), Gaps = 11/177 (6%)
 Frame = -2

Query  902  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  723
            V++ +E +L++ALD+VH  +  Y+A+L YA+WCPFSR+ +P++ V+S++ P V H AIEE
Sbjct  1    VVQLNETTLEKALDLVHSSNGTYMAVLHYATWCPFSRQVRPVYDVLSTIFPTVHHVAIEE  60

Query  722  SAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLD  543
            S+++PS LS+YGV  FP LF+ N T R RY+G R L+SL+ FY + TG     K++ +  
Sbjct  61   SSVRPSVLSQYGVHSFPVLFMHNRTARVRYYGPRQLESLILFYQNYTG----RKEDCAFA  116

Query  542  KIRCSSNKHRDGGSE-QESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
            ++        D G+E +E CP+ W+ SP+ +L+ + YL LA  F+++RL+YV+ PAV
Sbjct  117  RLV------YDAGTEMKEGCPYPWAISPEKWLQDDMYLNLAVVFLVLRLVYVLIPAV  167



>ref|XP_002444324.1| hypothetical protein SORBIDRAFT_07g020170 [Sorghum bicolor]
 gb|EES13819.1| hypothetical protein SORBIDRAFT_07g020170 [Sorghum bicolor]
Length=272

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 113/166 (68%), Gaps = 1/166 (1%)
 Frame = -2

Query  905  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  726
             V+EGD+ +LQ+A+ +V +   D+VA+LFYASWCPFS+ F   F  +SS  P + HF+ E
Sbjct  72   GVVEGDDGALQKAVALVLQNREDFVAILFYASWCPFSKIFWTDFQKLSSFFPTIAHFSFE  131

Query  725  ESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISL  546
            ES IKP  LS+YGV  FPT+FL+NST+R RYHGSR+++SL  FY D+TG    S D  SL
Sbjct  132  ESNIKPRVLSRYGVRAFPTIFLLNSTVRVRYHGSRAMNSLAVFYKDVTGLNPVSLDATSL  191

Query  545  DKIRCSSN-KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
            +++  +      D  +E+E    SW+RSP   L Q+T LALA++FV
Sbjct  192  ERMEDTVTIIDHDKKTEKEDSLLSWARSPDRLLHQDTCLALASSFV  237



>dbj|BAC99693.1| disulfide isomerase-like protein [Oryza sativa Japonica Group]
Length=287

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 116/183 (63%), Gaps = 14/183 (8%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
              V+EGD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ 
Sbjct  80   VGVVEGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSF  139

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLT-----------  582
            EES IKP  LS+YGV  FPTLFL+NSTMR RYHGSR+++SL  FY D+T           
Sbjct  140  EESRIKPRMLSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLAMFYKDVTVLQDFTDSFRN  199

Query  581  --GAETSSKDNISLDKIRCSSN-KHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
              G    S D ISL+++    N    D  +EQ    F ++RSP   L Q+T LALA++FV
Sbjct  200  IEGMNPVSLDAISLERMEEVVNIIENDKKTEQGDSLFMFARSPDRLLHQDTCLALASSFV  259

Query  410  LMR  402
            LMR
Sbjct  260  LMR  262



>ref|NP_001105766.1| adenosine 5'-phosphosulfate reductase-like5 precursor [Zea mays]
 gb|AAW63055.1| adenosine 5'-phosphosulfate reductase 5 [Zea mays]
 gb|ACF84100.1| unknown [Zea mays]
 tpg|DAA49109.1| TPA: adenosine 5'-phosphosulfate reductase 5 [Zea mays]
Length=267

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 112/164 (68%), Gaps = 1/164 (1%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            +EGD+ +LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES
Sbjct  69   VEGDDGALQKAVALVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEES  128

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
             IKP  LS+YGV  FPT+FL+NST+R RYHGSR+++S+  FY D+TG    S D   L++
Sbjct  129  NIKPRVLSRYGVRAFPTIFLLNSTVRVRYHGSRAMNSVAMFYKDVTGLNPVSLDATCLER  188

Query  539  IRCSSNKHRDG-GSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
            +  S      G  +E++    SW+RSP   L Q+T LALA++FV
Sbjct  189  MEDSVTIVDHGKKAEKDDSLLSWARSPDRLLHQDTCLALASSFV  232



>ref|XP_011628789.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Amborella trichopoda]
 ref|XP_006858931.2| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Amborella trichopoda]
Length=296

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 132/247 (53%), Gaps = 19/247 (8%)
 Frame = -2

Query  896  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESA  717
            E D +SL R L++  +RS+ YV++LFYA WCPFSR  +P F++++S+ P + H AI ES 
Sbjct  51   ELDGRSLDRVLNI--KRSNTYVSVLFYADWCPFSRNVRPTFNILASMFPHIRHVAISEST  108

Query  716  IKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKI  537
              PS  S+YGV   PT+ + N T R RY+G + L+SLV FY   TG E      ++    
Sbjct  109  ATPSVFSRYGVHSLPTIVIANRTSRLRYNGPKDLNSLVQFYKKTTGFEPEEFLEVNHPTN  168

Query  536  RCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRA  357
              S N  R            W  +P+  +R+E YLALA  F+L R    IFP    + R+
Sbjct  169  LASENPIR-----------LWHSTPRELVRREPYLALAVIFLLCRAFLYIFPKCMSWLRS  217

Query  356  SRRCILNLRTRSSWEYPQLCPSRAVQFFN-----SLKEPCKRSNLQEGAMNAKAWASKSL  192
                 +   +   +    L   RA+  FN     S    CK  N ++GA NA+ WAS SL
Sbjct  218  LWMLHMGHLSLGVFGERSLLVERALHVFNIKRVWSRLRLCKTRNFEKGAKNARVWAS-SL  276

Query  191  ASVSIGD  171
            ASVSIG+
Sbjct  277  ASVSIGE  283



>ref|XP_010455302.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Camelina sativa]
Length=162

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = -2

Query  980  SAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCP  801
            SAKD+I    D +          S +V EGD++ LQ A D++ +   DYVALLFYASWCP
Sbjct  32   SAKDYILGFRDRSALYR------SGSVTEGDDRWLQVASDMIDKNKCDYVALLFYASWCP  85

Query  800  FSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSR  621
            FSR  +P F ++S L   +PHFA+EES++K STLSKYGV GFPT+ LMNSTM   Y GSR
Sbjct  86   FSRLLRPSFDLISLLYSSIPHFAVEESSVKSSTLSKYGVHGFPTIILMNSTMLVAYRGSR  145

Query  620  SLDSLVDFYGDLTG  579
            +LDSLV FY D+TG
Sbjct  146  TLDSLVTFYSDVTG  159



>dbj|BAE99715.1| protein disulfide isomerase like protein [Arabidopsis thaliana]
Length=176

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 97/143 (68%), Gaps = 11/143 (8%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTA--VIEGDEKSLQRALDVVHRRSH-DYVALL  822
            C + SAKD+I    D        KS+      V EGD++ LQ A D+V +++  DY ALL
Sbjct  29   CPRESAKDYILGFRD--------KSALHRPGFVTEGDDRWLQMAADMVDKKNKCDYAALL  80

Query  821  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMR  642
            FYASWCPFSR  +P F ++S L   VPHFAIEES++K STLSKYGV GFPT+ LMNSTM 
Sbjct  81   FYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEESSVKASTLSKYGVHGFPTIILMNSTML  140

Query  641  FRYHGSRSLDSLVDFYGDLTGAE  573
              Y GSR+LDSLV FY D+TG E
Sbjct  141  VVYRGSRTLDSLVAFYTDVTGKE  163



>ref|XP_004981362.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like isoform X1 
[Setaria italica]
Length=307

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 145/274 (53%), Gaps = 30/274 (11%)
 Frame = -2

Query  950  DSTCSIDEIKSSCSTAVIEGDE--KSLQRALDV---VHRRSHDYVALLFYASWCPFSRKF  786
            D    +D + S C    IE     +    A+D    + RR   Y ++LFYA+WCPFS KF
Sbjct  43   DGPPFLDAVGSRCPFVRIEPSPPLEVSGEAVDTELNLRRRGASY-SILFYAAWCPFSSKF  101

Query  785  KPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSL  606
            +PIF  +S++ P + HFA+EES+  PS  S+YGV GFP + L+N T   RY GS+ L SL
Sbjct  102  RPIFEALSTMYPQIHHFAVEESSATPSLFSRYGVRGFPAVLLVNETTMVRYRGSKDLSSL  161

Query  605  VDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLAL  426
            V+FY + TG +  +     LD ++  S      GS +   P  W RS +   + E +L L
Sbjct  162  VNFYKETTGLDPIAH----LDVVQQEST-----GSLRSIMP--WDRSLREMAKHEPFLLL  210

Query  425  ATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQFFN-----  270
            A  F++M+++    P V    RA    R   LNL  R      QL   RA+   +     
Sbjct  211  AALFIIMKVVSYFIPVVLSHLRAFLVVRVRNLNLGIRRGSN--QLL-DRALNVLDVRRLW  267

Query  269  -SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              L+   K ++L++GA NA+AWAS S  SVS+G+
Sbjct  268  SKLRLSNKATDLRKGASNARAWAS-SFTSVSLGE  300



>ref|XP_002466254.1| hypothetical protein SORBIDRAFT_01g004420 [Sorghum bicolor]
 gb|EER93252.1| hypothetical protein SORBIDRAFT_01g004420 [Sorghum bicolor]
Length=298

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 140/270 (52%), Gaps = 32/270 (12%)
 Frame = -2

Query  935  IDEIKSSCSTAVIEGDEKSLQR--ALDV---VHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D + S C    IE       R  A+D    + RR   Y  +LFYA+WCPFS KF+P F 
Sbjct  39   LDAVGSRCPFVRIEPSPPLEVRGEAVDTELNLRRRGASYF-ILFYAAWCPFSSKFQPTFE  97

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +S++ P + HFA+EES+  PS  S+YGV GFP +  +N T   RY GS+ L+SLV+FY 
Sbjct  98   ALSTMYPQIHHFAVEESSATPSLFSRYGVRGFPAILFVNETTMVRYRGSKDLNSLVNFYK  157

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDG-GSEQESCPFSWSRSPQNFLRQETYLALATAF  414
            + TG          LD I      H++  GS     P  W RS + F + E YL  A  F
Sbjct  158  ETTG----------LDPIAYIDVVHQESTGSLSSVMP--WDRSLREFAKDEPYLLAAVLF  205

Query  413  VLMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQFFN------SLK  261
            +++++     P V    RA    R   LNL  R      QL   RA+   +       L+
Sbjct  206  IILKVAAHFIPVVMSHLRAFLVVRVQNLNLGIRRGSN--QLL-ERALNVLDMRRLWSKLR  262

Query  260  EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               K ++L++GA NA+AWAS S ASVS+G+
Sbjct  263  LSNKATDLRKGASNARAWAS-SFASVSLGE  291



>ref|NP_001105807.1| adenosine 5'-phosphosulfate reductase-like9 precursor [Zea mays]
 gb|AAW63059.1| adenosine 5'-phosphosulfate reductase 9 [Zea mays]
 gb|ACG46319.1| APRL5 - Zea mays adenosine 5'-phosphosulfate reductase-like [Zea 
mays]
 gb|ACN27775.1| unknown [Zea mays]
 gb|AFW67290.1| APRL5-Zea mays adenosine 5'-phosphosulfate reductase-likeAdenosine 
5'-phosphosulfate reductase 9 [Zea mays]
Length=300

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/267 (36%), Positives = 141/267 (53%), Gaps = 24/267 (9%)
 Frame = -2

Query  935  IDEIKSSCSTAVIEGDEKSLQR--ALDV---VHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D + S C    IE       R  A+D    + RR   Y ++LFYA+WCPFS KF+PIF 
Sbjct  39   LDAVGSRCPFVRIEPSPPLEVRGEAVDTELNLRRRGASY-SILFYAAWCPFSSKFRPIFE  97

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             VS++ P V HFA+EES+  PS  S+YGV GFP + L+N T   RY GS+ L+SLVDFY 
Sbjct  98   TVSTMYPQVHHFAVEESSATPSLFSRYGVRGFPAILLVNETTMVRYRGSKDLNSLVDFYK  157

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQE-TYLALATAF  414
            + TG +  +  ++ +        +     S     P  W RSP    + E  YL +A  F
Sbjct  158  ETTGLDPVAYIDVVV--------QQESTASLSSVAP--WDRSPLEMAKDEPPYLLVAVLF  207

Query  413  VLMRLLYVIFPAVCRFSRA-----SRRCILNLRTRSSWEYPQLCPSRAVQFF-NSLKEPC  252
            ++++    + PA     RA      +   L +R  SS    +   +  V+   + L    
Sbjct  208  IILKAAARLVPAAMSHLRAFLAVRVQNLNLGIRRGSSQVLERALNALDVRRLCSKLGLSN  267

Query  251  KRSNLQEGAMNAKAWASKSLASVSIGD  171
            + ++L++GA NA+AWAS S ASVS+G+
Sbjct  268  RATDLRKGASNARAWAS-SFASVSLGE  293



>ref|NP_001175575.1| Os08g0412401 [Oryza sativa Japonica Group]
 dbj|BAH94303.1| Os08g0412401 [Oryza sativa Japonica Group]
Length=140

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -2

Query  896  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESA  717
            +GD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES 
Sbjct  16   QGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEESR  75

Query  716  IKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTG  579
            IKP  LS+YGV  FPTLFL+NSTMR RYHGSR+++SL  FY D+TG
Sbjct  76   IKPRMLSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLAMFYKDVTG  121



>ref|NP_001105768.1| adenosine 5'-phosphosulfate reductase-like8 precursor [Zea mays]
 gb|AAW63058.1| adenosine 5'-phosphosulfate reductase 8 [Zea mays]
Length=299

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 129/238 (54%), Gaps = 25/238 (11%)
 Frame = -2

Query  857  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIG  678
            + RR   Y ++LFYA+WCPFS K +PIF  +S++ P + HF +EES+  PS  S+YGV G
Sbjct  71   LRRRGASY-SILFYAAWCPFSSKLRPIFGTLSTMYPQIHHFTVEESSATPSLFSRYGVRG  129

Query  677  FPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSE  498
            FP + L+N T   RY GS+ L+SLVDFY + TG +  +  ++          +    GS 
Sbjct  130  FPAILLVNETTMVRYRGSKDLNSLVDFYKETTGLDPIAYIDVV---------EQESTGSL  180

Query  497  QESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRT  327
                P  W RS +   + E YL +A  F++++++    P V    RA    R   LNL  
Sbjct  181  SSVMP--WDRSIREMAKDEMYLLVAVLFIIVKVVAHFIPVVMSHLRAFLVVRVQNLNLGI  238

Query  326  RSSWEYPQLCPSRAVQFFN------SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            R      QL   RA+   +       L+   K ++L++GA NA+AWAS S  SVS+G+
Sbjct  239  RRGSN--QLL-ERALNVLDVRRLWSKLRLSNKATDLRKGANNARAWAS-SFPSVSLGE  292



>ref|NP_001281246.1| APRL5 - Zea mays adenosine 5'-phosphosulfate reductase-like precursor 
[Zea mays]
 gb|ACR34049.1| unknown [Zea mays]
Length=299

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 129/238 (54%), Gaps = 25/238 (11%)
 Frame = -2

Query  857  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIG  678
            + RR   Y ++LFYA+WCPFS K +PIF  +S++ P + HF +EES+  PS  S+YGV G
Sbjct  71   LRRRGASY-SILFYAAWCPFSSKLRPIFGTLSTMYPQIHHFTVEESSATPSLFSRYGVRG  129

Query  677  FPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSE  498
            FP + L+N T   RY GS+ L+SLVDFY + TG +  +  ++          +    GS 
Sbjct  130  FPAILLVNETTMVRYRGSKDLNSLVDFYKETTGLDPIAYIDVV---------EQESTGSL  180

Query  497  QESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRT  327
                P  W RS +   + E YL +A  F++++++    P V    RA    R   LNL  
Sbjct  181  SSVMP--WDRSLREMAKDEMYLLVAVLFIIVKVVAHFIPVVMSHLRAFLVVRVQNLNLGI  238

Query  326  RSSWEYPQLCPSRAVQFFN------SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            R      QL   RA+   +       L+   K ++L++GA NA+AWAS S  SVS+G+
Sbjct  239  RRGSN--QLL-ERALNVLDVRRLWSKLRLSNKATDLRKGASNARAWAS-SFPSVSLGE  292



>gb|EYU31671.1| hypothetical protein MIMGU_mgv1a010641mg [Erythranthe guttata]
Length=306

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 140/293 (48%), Gaps = 31/293 (11%)
 Frame = -2

Query  998  LCCSKYSAKDWIFALPDSTCSID------EIKSSCS------TAVIEGDEKSLQRALDVV  855
            +C    SA  +  A   S C +D      ++ S C       +  I+ D +S ++A+   
Sbjct  18   VCAFAESAASFRLASSSSICQLDFKTLLLDLNSQCPFSKPLPSLPIQVDGESFEKAMSSS  77

Query  854  HRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGF  675
             ++   Y A+LFYASWCPFS  F+   S +SS+ P V H  +E+S+  PS  S+YG+   
Sbjct  78   QKKG--YTAVLFYASWCPFSTIFQSKISTLSSMYPHVKHIMVEQSSATPSIFSRYGIHSV  135

Query  674  PTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQ  495
            P+L ++N T R RYHG + LDSL DFY   TG       N  +D +  +S+    G   Q
Sbjct  136  PSLLIVNQTTRMRYHGRKDLDSLKDFYKRTTGL------NPVVDMVEETSSNSETG---Q  186

Query  494  ESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC-RFSRASRRCILNLRTRSS  318
                 +   S      +E YL L+  FVL+R     FP +  R        I  L  R  
Sbjct  187  NPIQLATGASLMKAFSREPYLTLSAVFVLLRAFLYFFPGIASRLLALWAAVIPRLNLRIF  246

Query  317  WEYPQLCPS-----RAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIG  174
             E  QL           + +N LK  CK  N  +GA NA+ WAS SLASVS+G
Sbjct  247  GESRQLLGHVLHLMDVKRIWNKLKN-CKTRNFVKGARNARVWAS-SLASVSLG  297



>ref|XP_006479121.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Citrus sinensis]
Length=295

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 143/277 (52%), Gaps = 39/277 (14%)
 Frame = -2

Query  950  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  786
            DS   ++ ++S C   +      E D + L RAL    R +  Y ++LFYASWCPFSR  
Sbjct  33   DSVVFLNNLQSQCPPGISPNPPFEVDGEFLDRALTSKQRNA--YTSVLFYASWCPFSRDV  90

Query  785  KPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSL  606
            +P F  +SS+ P + H+ IE+S+  PS  S+YG+   P++FL+N T R +Y G + L SL
Sbjct  91   RPTFEALSSMFPQMEHYTIEQSSALPSIFSRYGIHSLPSIFLVNQTSRLQYQGPKDLHSL  150

Query  605  VDFYGDLTGAET----SSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQET  438
            V FY   TG +     +  ++ISL               E+   P+ +  S +  +++E 
Sbjct  151  VQFYEKTTGFDPVEYFAEDESISL---------------ERTDHPW-FVSSTREIIQREP  194

Query  437  YLALATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQFFNS  267
            YL  A  F+ +R+L  IFP V    +A   S    LNL      E  QL   RA+   + 
Sbjct  195  YLVFAVLFLCLRVLVYIFPEVLSRLKAFWVSYVPHLNLEIFG--ETSQLF-GRALHMVDV  251

Query  266  LK-----EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             +       CK  N +EGA NA+ WAS SLASVS+G+
Sbjct  252  RRVLTKLRICKTRNFREGAKNARVWAS-SLASVSLGE  287



>ref|XP_008813732.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Phoenix dactylifera]
Length=302

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 142/268 (53%), Gaps = 29/268 (11%)
 Frame = -2

Query  935  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D +KS C   +     +E   K+L++ L    + +  Y ++ F+ASWCPFS   +PIF+
Sbjct  40   LDVVKSQCPLWIEPLPPLEVSGKTLEQELSRSQKSA--YYSIFFFASWCPFSSNTRPIFN  97

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +SS+ P + H A+EES+  PS  S+YG+  FP + L N TM  RY GS+ ++SLV+FY 
Sbjct  98   ALSSMFPQIKHLAVEESSSMPSVFSRYGIHSFPAILLANGTMMVRYRGSKDINSLVNFYK  157

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
              TG      D +S   +   SN  R+ GS +      W+ S +  +  E Y+A++  FV
Sbjct  158  KTTGF-----DPVSYFAVDQPSNS-RNVGSLRP-----WNGSLKELIAHEPYIAISLLFV  206

Query  410  LMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQF-----FNSLKEP  255
             ++ +   FP +    RA   S    LNL     W   QL       F     ++ L+  
Sbjct  207  CLKAMVRFFPVIFAHLRAFWVSLAWQLNLGILGEWS--QLLEQAQHVFDIKKLWSKLRLC  264

Query  254  CKRSNLQEGAMNAKAWASKSLASVSIGD  171
             K  N ++GA NA+AWAS SLASVS+G+
Sbjct  265  NKTRNFRKGANNARAWAS-SLASVSLGE  291



>ref|XP_003564162.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Brachypodium 
distachyon]
Length=305

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 146/275 (53%), Gaps = 42/275 (15%)
 Frame = -2

Query  935  IDEIKSSCSTAVIEGDE------KSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIF  774
            +D + S C  A IE         ++L + L++  RRS    ++LFYA+WCPFS KF+PIF
Sbjct  46   LDALGSRCPRARIEPSPPLEVRGEALDKQLNL--RRSGASYSILFYAAWCPFSSKFRPIF  103

Query  773  SVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFY  594
              +S++ P + HFA+EES+  PS  S+YGV GFP + L+N T   RY G++ L SL+DFY
Sbjct  104  EALSTMFPQIHHFAVEESSAMPSLFSRYGVRGFPAVLLVNETSMVRYRGTKDLKSLIDFY  163

Query  593  GDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAF  414
             + TG    +  ++         ++     S     P  W+      LR+   +A    F
Sbjct  164  KETTGLNPVAYFDL---------DQQESTRSLGSVMPGGWT------LRK---MANDEPF  205

Query  413  VLMRLLYVIFPAVCRFSR---ASRRCILNLRTRS-----SWEYPQLCPSRAV------QF  276
            VL+ +L++I   V RF     +  R  L +R R+     S    QL   RA+      + 
Sbjct  206  VLLSVLFLIMKVVARFVPTVISQMRVFLIVRVRNLNLGISRGSSQLM-ERALTVLDVKRI  264

Query  275  FNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            ++ L+   K S+L +GA NA+AWAS S ASVS+G+
Sbjct  265  WSKLRLSSKTSDLTKGASNARAWAS-SFASVSLGE  298



>gb|EMT06163.1| hypothetical protein F775_28438 [Aegilops tauschii]
Length=274

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 121/226 (54%), Gaps = 18/226 (8%)
 Frame = -2

Query  830  ALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNS  651
            ++LFYA+WCPFS KF+PIF  +S++ P + HFA+EES+  PS  S+YGV GFP + L N 
Sbjct  54   SILFYAAWCPFSSKFRPIFEALSTMFPQIHHFAVEESSATPSLFSRYGVRGFPAILLANE  113

Query  650  TMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS  471
            T   RY G++ L SL+ FY + TG +  +  ++         ++    GS   + P    
Sbjct  114  TTMVRYRGTKDLKSLLQFYQETTGLDPITYIDV---------DQQESAGSLGSAMP--GG  162

Query  470  RSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRTR---SSWEY  309
            RS +     E ++ L   F++M++     P V    RA    R   LNLR R   S    
Sbjct  163  RSLRKMAEDEPFVFLGALFIIMKVAAHFIPTVISQLRAFLIVRVQNLNLRIRRGSSQLTE  222

Query  308  PQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              L      + ++ L+   K  +L +GA NA+AWAS S ASVS+G+
Sbjct  223  RALTVLDVKRLWSKLRLSSKTRDLSKGASNARAWAS-SFASVSLGE  267



>ref|XP_004981363.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like isoform X2 
[Setaria italica]
Length=303

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 99/274 (36%), Positives = 143/274 (52%), Gaps = 34/274 (12%)
 Frame = -2

Query  950  DSTCSIDEIKSSCSTAVIEGDE--KSLQRALDV---VHRRSHDYVALLFYASWCPFSRKF  786
            D    +D + S C    IE     +    A+D    + RR   Y ++LFYA+WCPFS KF
Sbjct  43   DGPPFLDAVGSRCPFVRIEPSPPLEVSGEAVDTELNLRRRGASY-SILFYAAWCPFSSKF  101

Query  785  KPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSL  606
            +PIF  +S++ P + HFA+EES+  P    +YGV GFP + L+N T   RY GS+ L SL
Sbjct  102  RPIFEALSTMYPQIHHFAVEESSATP----RYGVRGFPAVLLVNETTMVRYRGSKDLSSL  157

Query  605  VDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLAL  426
            V+FY + TG +  +     LD ++  S      GS +   P  W RS +   + E +L L
Sbjct  158  VNFYKETTGLDPIAH----LDVVQQEST-----GSLRSIMP--WDRSLREMAKHEPFLLL  206

Query  425  ATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQFFN-----  270
            A  F++M+++    P V    RA    R   LNL  R      QL   RA+   +     
Sbjct  207  AALFIIMKVVSYFIPVVLSHLRAFLVVRVRNLNLGIRRGSN--QLL-DRALNVLDVRRLW  263

Query  269  -SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              L+   K ++L++GA NA+AWAS S  SVS+G+
Sbjct  264  SKLRLSNKATDLRKGASNARAWAS-SFTSVSLGE  296



>ref|XP_006443434.1| hypothetical protein CICLE_v100214292mg, partial [Citrus clementina]
 gb|ESR56674.1| hypothetical protein CICLE_v100214292mg, partial [Citrus clementina]
Length=239

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 133/252 (53%), Gaps = 34/252 (13%)
 Frame = -2

Query  890  DEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIK  711
            D + L RAL    R +  Y ++LFYASWCPFSR  +P F  +SS+ P + H+ IE+S+  
Sbjct  2    DGEFLDRALTSKQRNA--YTSVLFYASWCPFSRDVRPTFEALSSMFPQMEHYTIEQSSAL  59

Query  710  PSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAET----SSKDNISLD  543
            PS  S+YG+   P++FL+N T R +Y G + L SLV FY   TG +     +  ++ISL 
Sbjct  60   PSIFSRYGIHSLPSIFLVNQTSRLQYQGPKDLHSLVQFYEKTTGFDPVEYFAEDESISL-  118

Query  542  KIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFS  363
                          E+   P+  S S +  +++E YL  A  F+ +R+L  IFP V    
Sbjct  119  --------------ERTDHPWFVS-STREIIQREPYLVFAVLFLCLRVLVYIFPEVLSRL  163

Query  362  RA---SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAW  207
            +A   S    LNL      E  QL   RA+   +  +       CK  N +EGA NA+ W
Sbjct  164  KAFWVSYVPHLNLEIFG--ETSQLF-GRALHMVDVRRVLTKLRICKTRNFREGAKNARVW  220

Query  206  ASKSLASVSIGD  171
            AS SLASVS+G+
Sbjct  221  AS-SLASVSLGE  231



>ref|XP_002882315.1| hypothetical protein ARALYDRAFT_477638 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58574.1| hypothetical protein ARALYDRAFT_477638 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 129/251 (51%), Gaps = 23/251 (9%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D  SL R +D  H  +  Y+++LFYASWCPFSR  +P F ++SS+ P + H A+E S
Sbjct  57   IEVDGDSLDRVMDSNHGNA--YMSVLFYASWCPFSRAVRPKFDMLSSMFPHIQHLAVEHS  114

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N T++ RYHG + L SL++FY + TG          L  
Sbjct  115  QALPSVFSRYGIHSLPSILMVNQTLKARYHGRKDLTSLIEFYEEATG----------LQP  164

Query  539  IRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMRLLYVIFP-AVC  372
            +   +     G    +    +W R   S +   +Q+ +L L+  F+ +++  ++FP A  
Sbjct  165  VHYVAEGEPTGLDAGDGNLITWLRNGTSIREIFKQDPFLVLSLLFICLQMAILVFPIAES  224

Query  371  RFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAW  207
            R        + NL      E  QL  SR +   +  +        K  N  E A NA+AW
Sbjct  225  RMKALWASYVPNLNLGRFGEISQLF-SRGIHMVDVRRLWLKLSLVKTRNFHERAKNAQAW  283

Query  206  ASKSLASVSIG  174
            AS SLASVS+G
Sbjct  284  AS-SLASVSLG  293



>ref|XP_009353126.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Pyrus x bretschneideri]
Length=299

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/247 (38%), Positives = 123/247 (50%), Gaps = 16/247 (6%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            ++ D   L RAL    R   DY A+LFYASWCPFSR   P F  +S + P V H AIE+S
Sbjct  52   LKVDGNFLDRALASQQRT--DYTAVLFYASWCPFSRTMYPTFEKLSFMFPQVEHLAIEQS  109

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  PS  S+YG+  FP++ ++N T R RYHG +SL SL  FY   TG     K     D 
Sbjct  110  SALPSVFSRYGIHSFPSILIVNQTSRVRYHGPKSLSSLAQFYQKTTGL----KPVQYFDD  165

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
             +  S   R+    Q       + S +   R+E YLA A  F+ +R+L  IFP V     
Sbjct  166  DQIVSLNIREKSLIQSVS----NMSLREISRREPYLAFAILFLCLRVLLYIFPKVLTRLH  221

Query  359  A-----SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKS  195
            A          L +   +S    ++ P   V+   +    CK  N  EGA NA+ WAS S
Sbjct  222  AFWVLYVPHFNLGVFGETSQSMGRILPMVDVRRIWTKLRLCKTRNFHEGAKNARVWAS-S  280

Query  194  LASVSIG  174
            L SVS+G
Sbjct  281  LTSVSLG  287



>ref|XP_003554021.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Glycine 
max]
Length=281

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 140/269 (52%), Gaps = 23/269 (9%)
 Frame = -2

Query  956  LPDSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  792
             P S   + E++S CS AV     +  D   ++  L    R+   Y+++LFYASWC FSR
Sbjct  23   FPPSASFLYELQSQCSLAVSPDPPLRVDGNFIEGVLS--GRKRVGYISILFYASWCRFSR  80

Query  791  KFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLD  612
            +  P F ++SS+ P V H A+E+S+  PS  SKYG+   P + L+N T R RYHG ++L+
Sbjct  81   RMLPEFEILSSMFPQVQHVALEQSSALPSLYSKYGIHSLPAILLVNQTSRVRYHGPKNLN  140

Query  611  SLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYL  432
            SLV+FY   TG E  +KDN  + +    SN   D  S  +        S +    +E YL
Sbjct  141  SLVEFYERNTGLE--AKDNAVVGQ---PSNFLSDEHSTMKGF------SLKEIFNREPYL  189

Query  431  ALATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK  261
            AL+  F+ +R++  +FP +    +A   S    LNL+         L      + +  L+
Sbjct  190  ALSILFLCLRIILFVFPTIMPRLKAFWTSYASHLNLQIFGQVMERVLNVIDVKRIWTKLR  249

Query  260  EPCKRSNLQEGAMNAKAWASKSLASVSIG  174
              CK  N  E   +A+ WAS SLASVS+G
Sbjct  250  L-CKTRNFHERVRSARVWAS-SLASVSLG  276



>ref|XP_002276765.2| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Vitis vinifera]
Length=298

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 93/277 (34%), Positives = 143/277 (52%), Gaps = 29/277 (10%)
 Frame = -2

Query  971  DWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  792
            D++ A   S C +    S  S A+++ D   L RAL    ++ + + ++LF+ASWCPFS 
Sbjct  33   DFLVAFLQSQCPL----SLSSHALLDVDGNFLDRAL--TSKQGNGFTSVLFHASWCPFSC  86

Query  791  KFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLD  612
            K +P F V+SS+ P + H AI+ES+  PS  S+YG+   P++ ++N T R RYHG + L 
Sbjct  87   KMRPKFEVLSSMFPQIEHLAIKESSASPSMFSRYGIHSLPSILIVNQTSRMRYHGPKDLP  146

Query  611  SLVDFYGDLTGAET----SSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRS-PQNFLR  447
            SLV FY   TG E     +    IS +K            SE +S    W+ S  +    
Sbjct  147  SLVKFYRKTTGLEPVQYFAEDQTISFEK------------SEGQSILQPWNGSYVKEIFT  194

Query  446  QETYLALATAFVLMRLLYVIFPAVCRFSRA-----SRRCILNLRTRSSWEYPQLCPSRAV  282
            +E YLA +  F  +R++  +FP +    +A          L +   +S    ++     V
Sbjct  195  REPYLAFSILFFCLRVVLALFPGLLSQLKAFWVLYVPHLNLEIFGETSQMLGRVLNMIDV  254

Query  281  QFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            Q   +  + CK  N +EGA +A+ WAS SLASVS+G+
Sbjct  255  QRVWAKLKLCKIRNFREGAKSARVWAS-SLASVSLGE  290



>ref|XP_008644294.1| PREDICTED: adenosine 5'-phosphosulfate reductase-like9 isoform 
X1 [Zea mays]
Length=296

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 139/267 (52%), Gaps = 28/267 (10%)
 Frame = -2

Query  935  IDEIKSSCSTAVIEGDEKSLQR--ALDV---VHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D + S C    IE       R  A+D    + RR   Y ++LFYA+WCPFS KF+PIF 
Sbjct  39   LDAVGSRCPFVRIEPSPPLEVRGEAVDTELNLRRRGASY-SILFYAAWCPFSSKFRPIFE  97

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             VS++ P V HFA+EES+  P    +YGV GFP + L+N T   RY GS+ L+SLVDFY 
Sbjct  98   TVSTMYPQVHHFAVEESSATP----RYGVRGFPAILLVNETTMVRYRGSKDLNSLVDFYK  153

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQE-TYLALATAF  414
            + TG +  +  ++ +        +     S     P  W RSP    + E  YL +A  F
Sbjct  154  ETTGLDPVAYIDVVV--------QQESTASLSSVAP--WDRSPLEMAKDEPPYLLVAVLF  203

Query  413  VLMRLLYVIFPAVCRFSRA-----SRRCILNLRTRSSWEYPQLCPSRAVQFF-NSLKEPC  252
            ++++    + PA     RA      +   L +R  SS    +   +  V+   + L    
Sbjct  204  IILKAAARLVPAAMSHLRAFLAVRVQNLNLGIRRGSSQVLERALNALDVRRLCSKLGLSN  263

Query  251  KRSNLQEGAMNAKAWASKSLASVSIGD  171
            + ++L++GA NA+AWAS S ASVS+G+
Sbjct  264  RATDLRKGASNARAWAS-SFASVSLGE  289



>ref|XP_010463851.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Camelina sativa]
Length=299

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 130/252 (52%), Gaps = 23/252 (9%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            I+ D  SL R + + H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H  +E S
Sbjct  56   IQVDGDSLDRLMALNH--GNAYMSVLFYASWCPFSRALRPKFDMLSSMFPQIQHLTVEHS  113

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N T++ RYHG + L SL++FY + TG          L  
Sbjct  114  QALPSVFSRYGIHSLPSILMINQTLKARYHGRKDLTSLIEFYEEATG----------LQP  163

Query  539  IRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMRLLYVIFP-AVC  372
            ++  +     G    +    +W R   S +   +Q+ +L L+  F+ +++  ++FP A  
Sbjct  164  VQYVAEGEPTGLDAGDGNLITWLRNGTSIREIFKQDPFLILSLLFICLQIAILVFPIAES  223

Query  371  RFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAW  207
            R        + NL      E  QL  SR +   +  +        K  N  E AMNA+AW
Sbjct  224  RMRALWASYVPNLNLERFREVSQLF-SRGLHMVDVRRLWLKLRLIKTRNFHERAMNAQAW  282

Query  206  ASKSLASVSIGD  171
            AS SLASVS+G 
Sbjct  283  AS-SLASVSLGQ  293



>ref|XP_009396929.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/256 (34%), Positives = 131/256 (51%), Gaps = 34/256 (13%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            +E D +SL R L  +H  S  Y ++LFYASWCPFS   +P F+V+SS+ P + H   +ES
Sbjct  63   LEVDGESLDREL--IHGESKGYYSVLFYASWCPFSDNIRPTFNVLSSMFPQIKHLLADES  120

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  PS LS+YG+  FP + L N T   RY G + +D+L+ FY   TG +   +  + +D+
Sbjct  121  STMPSILSRYGIHSFPAIVLSNQTATIRYRGPKDIDTLIQFYKKTTGFDPVER--LVVDQ  178

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
                 N  R    + ES         +  +  E YL L   F+ ++L+  + P V    +
Sbjct  179  PANLGNV-RSLMHQVESL--------RELITTEPYLVLGVLFICLKLVLSVLPVVYSHLK  229

Query  359  ASRRCILNLRTRSSWE--YPQLC-PSRAV----------QFFNSLKEPCKRSNLQEGAMN  219
            A       L     W    P LC PS+ +          + +N +K   K  NL++GA N
Sbjct  230  A-------LWVSHGWHLNLPILCEPSQLLVRVLHGIDVNKLWNKVKLGNKTMNLRKGANN  282

Query  218  AKAWASKSLASVSIGD  171
            A+AWAS +L SVS+G+
Sbjct  283  ARAWAS-TLTSVSLGE  297



>ref|XP_010923362.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Elaeis guineensis]
Length=304

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/269 (34%), Positives = 138/269 (51%), Gaps = 31/269 (12%)
 Frame = -2

Query  935  IDEIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D ++S C      ++ +E + ++L++ L   H +   Y ++ FYASWCPFS   +PIF 
Sbjct  42   LDVVRSQCPLWIEPSSPLEVNGETLEQELS--HSKRSTYYSVFFYASWCPFSSNTRPIFD  99

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +SS+ P + H A+E+S+  PS  S+YG+   P + L N T+  RY GS+ L+SLV FY 
Sbjct  100  ALSSMFPQIKHLAVEQSSSMPSVFSRYGIHSIPAILLANRTVMVRYRGSKDLNSLVSFYK  159

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
              TG      D +S   +   S      GS      +   RS +  +  E Y+A++  F+
Sbjct  160  KTTGF-----DPVSYFAVEPPS------GSRNTRSLWPVERSSKELIASEPYMAISFLFI  208

Query  410  LMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQFFN------SLKE  258
             ++++   FP +    RA   S     NL     W   QL   RA   F+       L+ 
Sbjct  209  CLKVIMRFFPVIFTHLRAFWISLAWHPNLEILGEWS--QLL-ERARHVFDIKKLWSKLRL  265

Query  257  PCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              K  N Q+GA NA+AWAS SLASVS+G+
Sbjct  266  CNKTRNFQKGANNARAWAS-SLASVSLGE  293



>gb|KJB26618.1| hypothetical protein B456_004G250500 [Gossypium raimondii]
 gb|KJB26619.1| hypothetical protein B456_004G250500 [Gossypium raimondii]
Length=312

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 97/286 (34%), Positives = 141/286 (49%), Gaps = 41/286 (14%)
 Frame = -2

Query  959  ALPDSTCS------IDEIKSSCSTAV-------IEGDEKSLQRALDVVHRRSHDYVALLF  819
             L  S CS      I  I   CS ++       + GD   L R L    ++ + Y ++LF
Sbjct  33   VLGSSICSHEADVFIKNIHFQCSPSISPIPPLKVNGD--FLDRQL--TSKQQNGYTSVLF  88

Query  818  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRF  639
            YASWCPFS    P F ++SS+ P + H A+E+S+  PS LS+YG+   P++ ++N T R 
Sbjct  89   YASWCPFSHGLCPKFDILSSMFPQIEHLAVEQSSTSPSILSRYGIHSLPSILIVNRTSRV  148

Query  638  RYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRD-GGSEQESCPFSWSR-S  465
            RY+G + L S+V FY   TG E           ++  + K  D  G   +    SW   S
Sbjct  149  RYNGPKDLLSIVQFYEKTTGFEP----------VQFVAQKESDVSGDHNKYMIKSWKESS  198

Query  464  PQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCP  294
            P   ++QE YL  A  F+ +R + ++FP V    +A   S     NL      E  QL  
Sbjct  199  PMEIVKQEPYLVFALLFLCLRGILLVFPKVLSRLKAVWVSYAPQFNLEIFG--ETSQLF-  255

Query  293  SRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             RA+   +  +       CK  N Q+GA +A+ WAS SLASVS+G+
Sbjct  256  VRALHMVDVRRVWTKLRLCKTQNFQQGAKSARVWAS-SLASVSLGE  300



>ref|XP_010257654.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nelumbo nucifera]
Length=296

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 94/278 (34%), Positives = 137/278 (49%), Gaps = 35/278 (13%)
 Frame = -2

Query  953  PDSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRK  789
            P S   ++ I+  C   +     IE D  SL+RAL    R +  Y ++LFY+ WCPFS  
Sbjct  26   PQSHLFLNRIQHQCPVEISPSPAIEVDGDSLERALGSNWRNT--YASVLFYSYWCPFSHG  83

Query  788  FKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDS  609
             +P F  +SS+ P V H A+E+S+  PS  S+YG+   P++ ++N T + RYHG + L S
Sbjct  84   VRPTFDTLSSMFPQVRHLAVEQSSAMPSVFSRYGIHSLPSIVMINQTGKVRYHGPKDLTS  143

Query  608  LVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSR-SPQNFLRQETYL  432
            LV FY  +TG E              + ++    GS ++S    W   S +  L +E YL
Sbjct  144  LVHFYKSITGLEPVE---------YFTEDQSSTLGSGEKSLLQLWRESSTEVILAREPYL  194

Query  431  ALATAFVLMRLLYVIFPAVCR------FSRASRRCILNLRTRSSWEYPQLCPSRAVQFFN  270
              +  F+ +R +  +FP +        FS   R   LNL      E  QL    A+   +
Sbjct  195  IFSILFLCLRAVLYLFPEMLSRLKAFWFSYIPR---LNLEIFG--ETSQLL-EHALHVID  248

Query  269  -----SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                 S  + CK  N  +GA NA  WAS SLASVS+G+
Sbjct  249  VKRVWSKPKLCKTRNFHQGAKNAHVWAS-SLASVSLGE  285



>gb|AEK94318.1| disulfide isomerase-related protein [Pyrus x bretschneideri]
Length=297

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 122/247 (49%), Gaps = 16/247 (6%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            ++ D   L RAL    R   DY A+LFYASWCPFSR   P F  +S + P V H AIE+S
Sbjct  52   LKVDGNFLDRALAPQQRT--DYTAVLFYASWCPFSRTMYPTFEKLSFMFPQVEHLAIEQS  109

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  PS  S+YG+  FP++ ++N T R RYHG +SL SL  FY   TG     K     D 
Sbjct  110  SALPSVFSRYGIHSFPSILIVNQTSRVRYHGPKSLSSLAQFYQKTTGL----KPVQYFDG  165

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
             +  S   R+    Q       + S +   R+  YLA A  F+ +R+L  IFP V     
Sbjct  166  DQIVSLNIREKSLIQSMS----NMSLREISRRGPYLAFAILFLCLRVLLYIFPKVLTRLH  221

Query  359  A-----SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKS  195
            A          L +   +S    ++ P   V+   +    CK  N  EGA NA+ WAS S
Sbjct  222  AFWVLYVPHFNLGVFGETSQIMGRILPMVDVRRIWTKLRLCKTRNFHEGAKNARVWAS-S  280

Query  194  LASVSIG  174
            L SVS+G
Sbjct  281  LTSVSLG  287



>ref|XP_010485745.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Camelina sativa]
Length=298

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/255 (33%), Positives = 130/255 (51%), Gaps = 23/255 (9%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
            T  I+ D  SL R + + H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H  +
Sbjct  52   TPPIQVDGDSLDRLMALNH--GNAYISVLFYASWCPFSRALRPKFDMLSSMFPQIQHLTV  109

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
            E S   PS  S+YG+   P++ ++N T++ RYHG + L SL++FY + TG          
Sbjct  110  EHSQALPSVFSRYGIHSLPSILMINQTLKARYHGRKDLTSLIEFYEEATG----------  159

Query  548  LDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMRLLYVIFP-  381
            L  ++  +     G    +    +W R   S +   +Q+ +L L+  F+ +++  ++FP 
Sbjct  160  LQPVQYVAEGEPTGLDAGDGNLITWLRNGTSIREIFKQDPFLILSLLFICLQMAILVFPI  219

Query  380  AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNA  216
            A  R        + NL      E  QL  SR +   +  +        K  N  E A NA
Sbjct  220  AESRMRALWASYVPNLNLERFREVSQLF-SRGLHMVDVRRLWLKLRLIKTRNFHERAKNA  278

Query  215  KAWASKSLASVSIGD  171
            +AWAS SLASVS+G 
Sbjct  279  QAWAS-SLASVSLGQ  292



>ref|NP_566214.1| 5'-adenylylsulfate reductase-like 5 [Arabidopsis thaliana]
 sp|Q93YX4.1|APRL5_ARATH RecName: Full=5'-adenylylsulfate reductase-like 5; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 5; Short=APR-like 
5; Short=AtAPRL5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24078.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14290.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74004.1| 5'-adenylylsulfate reductase-like 5 [Arabidopsis thaliana]
Length=300

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/255 (33%), Positives = 130/255 (51%), Gaps = 23/255 (9%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
            T  IE D  SL R +   H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H A+
Sbjct  54   TPPIEVDGDSLDRLMASQH--GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAV  111

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
            E S   PS  S+YG+   P++ ++N T+  RYHG + L SL++FY + TG          
Sbjct  112  EHSQALPSVFSRYGIHSLPSILMVNQTLNARYHGRKDLISLIEFYEEATG----------  161

Query  548  LDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMRLLYVIFP-  381
            L  ++  +     G +  +    +W R   S +   +Q+ +L L+  F+ +++  ++FP 
Sbjct  162  LQPVQYVAEGEPTGLNAGDGNLITWLRKGTSIREIFKQDPFLVLSLLFICLQMAILVFPI  221

Query  380  AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNA  216
            A  R        + NL      E  QL  +R +   +  +        K  N  E A NA
Sbjct  222  AESRMRALWASYVANLNLGRFGEISQLF-NRGIHMVDVRRLWLKLSLVKTRNFHERAKNA  280

Query  215  KAWASKSLASVSIGD  171
            +AWAS SLASVS+G 
Sbjct  281  QAWAS-SLASVSLGQ  294



>ref|XP_011021471.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Populus euphratica]
Length=296

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 144/275 (52%), Gaps = 28/275 (10%)
 Frame = -2

Query  950  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  786
            +S  S+  I+S C  ++     ++ D K L RAL    ++++ Y ++LFYASWCPFSR  
Sbjct  26   ESALSLHHIRSQCPVSIPPNPPLQVDGKFLDRAL--TSKQTYAYTSVLFYASWCPFSRSM  83

Query  785  KPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSL  606
               F ++SS+ P + H A+E+S+  PS  S+YG+   P++ ++N T + +Y G ++L SL
Sbjct  84   LLKFEMLSSMFPQIKHLALEQSSALPSIFSRYGIHSLPSILIVNQTSKLQYRGPKNLQSL  143

Query  605  VDFYGDLTGAETS---SKDNISLDKIRCSSNKHRDGGSEQESCPFSWSR-SPQNFLRQET  438
            V FY   TG E     +KD    D    S+  H      ++S    W+R S ++ ++ E 
Sbjct  144  VQFYKKTTGLEPVQHFTKD----DDDSTSTEGH------EQSIMQPWNRPSLEDIIKSEP  193

Query  437  YLALATAFVLMR-LLYVIFPAVCRFSRASRRCI-----LNLRTRSSWEYPQLCPSRAVQF  276
            YL LAT F+  R LL  ++P V    +A   C      L +   +S  + ++     V+ 
Sbjct  194  YLVLATLFLCFRVLLLYVYPKVLSHIKAFYVCYVPHFNLEIFGETSQLFGRILHMVDVRR  253

Query  275  FNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              +     K  N  E A N + WAS SLASVS+G+
Sbjct  254  IWTKLRYFKTRNFHERAKNCRVWAS-SLASVSLGE  287



>ref|XP_008391699.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Malus domestica]
Length=305

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 129/262 (49%), Gaps = 21/262 (8%)
 Frame = -2

Query  926  IKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVS  762
            ++S C  ++     ++ D   L RAL    R   DY A+LFYASWCPFSR   P F  +S
Sbjct  38   LQSQCPISISPHPPLKVDGNFLDRALASQQRT--DYAAVLFYASWCPFSRIMYPTFEKLS  95

Query  761  SLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLT  582
             + P V H AIE+S+  PS  S+YG+  FP++ ++N T R RYHG +SL  L  FY   T
Sbjct  96   FMFPQVQHLAIEQSSALPSVFSRYGIHSFPSILIVNQTSRVRYHGPKSLSLLAQFYQKTT  155

Query  581  GAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMR  402
            G     K     D  +  S   R+    Q       + S +   R+E YLA A  F+ +R
Sbjct  156  GL----KPVQYFDGDQIVSLNIREKSLIQSMS----NMSLREISRREPYLAFAILFLCLR  207

Query  401  LLYVIFPAVCRFSRA-----SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNL  237
            ++   FP V    +A          L +   +S    ++ P   V+   +    CK  N 
Sbjct  208  VILYTFPKVLTRLQAFWVLYVPHFNLGIFGETSQIMGRILPMVDVRRIWTKLRLCKTRNF  267

Query  236  QEGAMNAKAWASKSLASVSIGD  171
             EGA NA+ WAS SL SVS+G+
Sbjct  268  HEGAKNARVWAS-SLTSVSLGE  288



>ref|XP_008804329.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Phoenix dactylifera]
Length=304

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 139/269 (52%), Gaps = 31/269 (12%)
 Frame = -2

Query  935  IDEIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D ++S C      ++ +E + ++L++ L   H +   Y ++ FYASWCPFS   +PIF 
Sbjct  42   LDVVRSQCPLWIEPSSSLEVNGETLEQELS--HSQRSAYYSVFFYASWCPFSSNTRPIFD  99

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +SS+ P + H A+E+S+  PS  S+YG+  FP + L N T+  RY GS+ L+SLV FY 
Sbjct  100  ALSSIFPQIKHLAVEQSSSMPSVFSRYGIHSFPAILLANRTVMVRYRGSKDLNSLVSFYK  159

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
              TG      D +S   +   S+      S      +    S +  +  E Y+A++  F+
Sbjct  160  KTTGF-----DPVSFFAVEPPSS------SRNARSLWPVEGSAKELIAHEPYIAISFLFI  208

Query  410  LMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EP  255
             ++ +   FP +    RA   S    LNL     W   QL   RA   F+  K       
Sbjct  209  CLKAILRFFPVIFIHLRAFWVSLAWHLNLGILGEWS--QLL-ERAQHVFDIKKLWSRLRL  265

Query  254  CKRS-NLQEGAMNAKAWASKSLASVSIGD  171
            C +S N Q+GA NA+AWAS S+ASVS+GD
Sbjct  266  CNKSKNFQKGANNARAWAS-SVASVSLGD  293



>ref|XP_010515215.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Camelina sativa]
Length=299

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/255 (33%), Positives = 129/255 (51%), Gaps = 23/255 (9%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
            T  IE D  SL R + + H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H  +
Sbjct  53   TPPIEVDGDSLDRLMALNH--GNAYMSVLFYASWCPFSRVMRPKFDMLSSMFPQIQHLTV  110

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
            E S   PS  S+YG+   P++ ++N T++ RYHG + L SL++FY + TG          
Sbjct  111  EHSQALPSVFSRYGIHSLPSILMINQTLKARYHGRKDLTSLIEFYEEATG----------  160

Query  548  LDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMRLLYVIFP-  381
            L  ++  +     G         +W R   S +   +Q+ +L L+  F+ +++  ++FP 
Sbjct  161  LQPVQYVAEGEPTGLDAGGGNLITWLRNGTSIREIFKQDPFLILSLLFICLQMAILVFPI  220

Query  380  AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNA  216
            A  R        + NL      E  QL  SR +   +  +        K  N  E A NA
Sbjct  221  AESRMRALWASYVPNLNLERFREVSQLF-SRGLHMVDVRRLWLKLRLIKTRNFHERAKNA  279

Query  215  KAWASKSLASVSIGD  171
            +AWAS SLASVS+G 
Sbjct  280  QAWAS-SLASVSLGQ  293



>ref|XP_009366461.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Pyrus x bretschneideri]
Length=296

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 127/280 (45%), Gaps = 59/280 (21%)
 Frame = -2

Query  926  IKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVS  762
            ++S C  ++     ++ D   L RAL    R   DY A+ FYASWCP SR   P F  +S
Sbjct  37   LQSQCPISISPHPPLKVDGNYLDRALASQQRT--DYTAVFFYASWCPLSRTMYPTFEKLS  94

Query  761  SLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLT  582
             + P V H AIE+S+  PS  S+YG+  FP++ L+N T   RYHG ++L SL  FY   T
Sbjct  95   FMFPQVEHLAIEQSSALPSVFSRYGIHSFPSILLVNQTSMVRYHGPKTLSSLAQFYQKTT  154

Query  581  GAE----TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAF  414
            G E          +SL+    S  +     S +E              R+E +LA AT F
Sbjct  155  GLEPVQYIDGDHTVSLNIREKSIIRSMSNMSLREIS------------RREPFLAFATVF  202

Query  413  VLMRLLYVIFPAVCR-----------------FSRASR---RCILNLRTRSSWEYPQLCP  294
            + +R+L  IFP V                   F   S+   R +  +  R  W   +LC 
Sbjct  203  LCLRVLLYIFPKVLTRLQAFWVLYVPHFNLGIFGETSQIMGRILHMVDVRRIWTKLRLCK  262

Query  293  SRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIG  174
            +R               N  EGA NA+ WAS SL SVS+G
Sbjct  263  TR---------------NFHEGAKNARVWAS-SLTSVSLG  286



>ref|XP_010054630.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X1 [Eucalyptus 
grandis]
 gb|KCW89877.1| hypothetical protein EUGRSUZ_A02105 [Eucalyptus grandis]
Length=304

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 103/305 (34%), Positives = 148/305 (49%), Gaps = 37/305 (12%)
 Frame = -2

Query  1037  LTCAHTLTAPFPALCCSKYSAKDWIFALP-DSTCSIDEIKSSCSTAV-----IEGDEKSL  876
             L C   L++P  A   S  SA     A P +    +  ++S CS ++     ++G+   L
Sbjct  12    LVCIGLLSSPLAARLVSPESAT----ACPREPPAFLIGLRSQCSGSISPSPPLQGNGNFL  67

Query  875   QRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLS  696
              R L   H     Y A+LFYASWCPFS+  +PI+  +SS+ P + H A+E+S   PS  S
Sbjct  68    DRFLMSKHHS--GYTAVLFYASWCPFSQSIRPIYEALSSMFPQIDHLAVEQSLAMPSVFS  125

Query  695   KYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKH  516
             +YG+   P++ L+N T R +YHG ++LD LV+FY   TG        +     + S  + 
Sbjct  126   RYGIHSLPSILLLNQTSRLQYHGPKTLDFLVEFYETNTGLHPVQHVMVE----QPSRLQT  181

Query  515   RDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCI--  342
             R+    Q     S        L++E YLAL+  F  +RLL  IFP V    RA   C+  
Sbjct  182   RENSRTQFKDVLSMKS-----LKREPYLALSLLFSCLRLLMAIFPKVVSCLRAF--CVSY  234

Query  341   ---LNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWASKSLAS  186
                LNL      E  QL   R V   +  +       CK  +    A +A+ WAS SLAS
Sbjct  235   VPHLNLEIFG--EATQLL-GRVVYAIDVRRIWTKVRLCKGRSFHARAKSARVWAS-SLAS  290

Query  185   VSIGD  171
             VS+G+
Sbjct  291   VSLGE  295



>ref|XP_009620886.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nicotiana tomentosiformis]
Length=297

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 95/292 (33%), Positives = 141/292 (48%), Gaps = 26/292 (9%)
 Frame = -2

Query  1007  FPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAV-------IEGDEKSLQRALDVVHR  849
             +  + C  +SA   +F+  ++     +++S C   +        E D +SL +AL    +
Sbjct  7     YIVVLCYVFSAFGCVFSSYNTNTFFYDLRSQCPLRISFPPPLLFETDGESLDKALGSSQK  66

Query  848   RSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPT  669
                D  A+LFYASWCPFS   K  F  +SS+ P + H  +E+S   PS  S+YGV  FP 
Sbjct  67    --DDVTAILFYASWCPFSTDVKSKFGALSSMFPRIRHVMVEQSKAMPSVFSRYGVHSFPA  124

Query  668   LFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQES  489
             + ++N TMR RYHG + L SLV+FY   TG +   +  ++  +I   ++ H+     + S
Sbjct  125   ILIVNQTMRVRYHGRKDLQSLVNFYKRTTGLDPVIE--VTEHQITYKTDGHKAFQQWKGS  182

Query  488   CPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWE  312
                    S +  L  E YL L+ AF+L R     FP +     A     I +L      E
Sbjct  183   -------SLRELLLSEPYLVLSVAFLLFRASLYFFPGLVAHVVALWVAYIPHLNMGIFGE  235

Query  311   YPQLCPSRAVQFFN-----SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               QL   R     +     S  +  K  N  +GA NA+ WAS SLASVS+G+
Sbjct  236   SRQLL-GRVFHVIDLKRAWSKLKLSKTRNFHKGARNARVWAS-SLASVSLGE  285



>gb|KJB46049.1| hypothetical protein B456_007G345900 [Gossypium raimondii]
Length=299

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 137/264 (52%), Gaps = 27/264 (10%)
 Frame = -2

Query  935  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            I+ ++  CS ++     +E D   L RAL    R  + YV++LFYASWCPFSR+ +P F 
Sbjct  36   IENLRFQCSPSLSPIPPLEVDGNFLDRALTSKQR--NGYVSVLFYASWCPFSRRLRPKFD  93

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
            ++ S+ P + H A+EES+  PS  S+YG+   P++ ++N T R +Y G + L S+  FY 
Sbjct  94   IIGSMFPQLEHLAVEESSASPSIFSRYGIHSLPSILIVNQTSRVQYRGPKDLPSIEQFYE  153

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
             +TG E      I+  ++  +S  H +   +  + PFS        +++E YL  +  F+
Sbjct  154  KITGFEPF--QYIAEHEL-VTSRDHNNHMKQSWNEPFS-----MEIVKREPYLVFSVLFL  205

Query  410  LMRLLYVIFPAVCRFSR---ASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EP  255
             M+LL  IFP V         S    LNL      E  QL  +RA+   +  +       
Sbjct  206  CMKLLLSIFPIVLSHLETFWVSYAPHLNLEIFG--ETNQLF-ARALHMVDVRRAWTKLRL  262

Query  254  CKRSNLQEGAMNAKAWASKSLASV  183
            CK  N  +GA +A+ WAS SLASV
Sbjct  263  CKTRNFHQGAESARVWAS-SLASV  285



>ref|XP_009408458.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 123/243 (51%), Gaps = 26/243 (11%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            +E D +SL   +++ H  S+ Y ++LFYASWCPFS   +PIF V+SS+ P   HF +EES
Sbjct  57   LEVDGESLD--IELSHGESNGYYSVLFYASWCPFSSSIRPIFDVLSSMFPQTKHFLVEES  114

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS LS+YG+  FP + L N T   RYHG++ L +LV FY          K N   D 
Sbjct  115  TTMPSILSRYGIHSFPAIMLANRTAVVRYHGAKDLSALVQFY----------KKNTGFDP  164

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
            I      HR   S +       + SP+  + +E ++ L   F+ M+++    P +    +
Sbjct  165  I-AYLVVHRPTNSRKVRSLMHQTGSPRELITKEPFMVLGVLFMFMKIVLSSIPVIYAHLK  223

Query  359  A---SRRCILNLRTRSSWEYPQLCPSRAVQ------FFNSLKEPCKRSNL-QEGAMNAKA  210
            A   S    LNL   S  E  QL   R +        ++ LK   K  NL ++GA NA+A
Sbjct  224  ALWVSNAWHLNLHVLS--ESSQLL-VRVLHVVDVKRLWSELKLDNKTRNLRKKGASNARA  280

Query  209  WAS  201
            WAS
Sbjct  281  WAS  283



>gb|KHG25607.1| 5'-adenylylsulfate reductase-like 7 [Gossypium arboreum]
Length=299

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 136/266 (51%), Gaps = 31/266 (12%)
 Frame = -2

Query  935  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            I+ ++  CST++     +E D   L RAL    R  H  V++L Y SWCPFSR+ +P F 
Sbjct  36   IENLRFQCSTSLSPIPPLEVDGNFLDRALTSKQRNGH--VSVLLYGSWCPFSRRLRPKFD  93

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             + S+ P + H A+EES+  PS  S+YG+   P++ ++N T R +Y G + L S+  FY 
Sbjct  94   FIGSMFPQLEHLAVEESSASPSIFSRYGIYSLPSILIVNQTSRVQYRGPKDLPSIEQFYE  153

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
             +TG E      ++  K+  +S  H +   +  + PFS        +++E YL  +  F+
Sbjct  154  KITGFEPF--QYVAEHKL-VTSGDHNNHMKQSWNEPFS-----MEIVKREPYLVFSILFL  205

Query  410  LMRLLYVIFPAVCRFSRASRRCI-----LNLRTRSSWEYPQLCPSRAVQFFNSLK-----  261
             M+LL  IFP V   SR     +     LNL      E  QL  +RA+   +  +     
Sbjct  206  CMKLLLSIFPIV--LSRLETFWVSYAPHLNLEIFG--ETNQLF-ARALHMVDVRRVWTKL  260

Query  260  EPCKRSNLQEGAMNAKAWASKSLASV  183
              CK  N  +GA +A+ WAS SLASV
Sbjct  261  RLCKTRNFHQGAESARVWAS-SLASV  285



>gb|KJB44623.1| hypothetical protein B456_007G261900 [Gossypium raimondii]
Length=296

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 126/247 (51%), Gaps = 23/247 (9%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            ++ D   L RAL    R  + Y ++LFYA+WCPFS    P F ++SS+ P + H A+EES
Sbjct  52   LKVDGNFLDRALSSKQR--NGYASVLFYAAWCPFSHSLYPKFDILSSMFPQIEHLAVEES  109

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  PS  S+YG+   P++ ++N T R +Y GS+ L S++ FY   TG E           
Sbjct  110  SASPSIFSRYGIHSLPSILIVNQTSRVQYRGSKDLPSIIQFYEKTTGFEPVQ--------  161

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
               + N+    G   +     W+++P   +++E YLA A  F+  R+L  +FP V    +
Sbjct  162  -YIAGNESVVLGDHNKYMIQLWNKTPMEIVKREPYLAFALLFLCFRVLLSVFPEVLSRLK  220

Query  359  A---SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWA  204
            A   S    LNL      E  QL  +RA+   +  +     + CK  N  +GA +A  WA
Sbjct  221  AFWVSYAPHLNLEIFG--ETSQLF-ARALHMVDVRRVWTKLKLCKTRNFHQGAKSAHVWA  277

Query  203  SKSLASV  183
            S SLASV
Sbjct  278  S-SLASV  283



>ref|XP_006408248.1| hypothetical protein EUTSA_v10021238mg [Eutrema salsugineum]
 gb|ESQ49701.1| hypothetical protein EUTSA_v10021238mg [Eutrema salsugineum]
Length=297

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 131/254 (52%), Gaps = 28/254 (11%)
 Frame = -2

Query  896  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESA  717
            E D  SL R + + H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H A+E S 
Sbjct  54   EVDGDSLDRLMALNH--GNAYLSVLFYASWCPFSRALRPKFDLLSSMFPQIQHLAVEHSQ  111

Query  716  IKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE-----TSSKDNI  552
              PS  S+YG+   P++ ++N T++ RYHG + L SL++FY + TG +       ++   
Sbjct  112  ALPSVFSRYGIHSLPSILMINQTLKARYHGRKDLTSLIEFYEESTGLQPVQYVAEAEPTT  171

Query  551  SLDKIRCS-SNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFP-A  378
             L+    +   + R+G S  E              +++ +L L+  F+ +++  +IFP A
Sbjct  172  GLEAADGNLITRLRNGTSVSE------------MFKRDPFLVLSLLFICLQMAILIFPVA  219

Query  377  VCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAK  213
              R        + NL      E  QL  SRA+   +  +        K  N  E A NA+
Sbjct  220  ESRMRALWASYVPNLNLERFGEISQLF-SRALHMVDVRRVWLKLRLVKTRNFHERAKNAQ  278

Query  212  AWASKSLASVSIGD  171
            AWAS SLASVS+G 
Sbjct  279  AWAS-SLASVSLGQ  291



>ref|XP_009795826.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nicotiana sylvestris]
Length=297

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/292 (32%), Positives = 142/292 (49%), Gaps = 26/292 (9%)
 Frame = -2

Query  1007  FPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAV-------IEGDEKSLQRALDVVHR  849
             +  + C  +SA  ++F+  ++   + +++S C   +       +E D +SL +AL    +
Sbjct  7     YIVILCYVFSAFGYVFSSYNTNTFLYDLRSQCPLRISFPPPLLVETDGESLDKALGSSQK  66

Query  848   RSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPT  669
                D  A+LFYASWCPFS   K  F  ++S+ P + H  +E+S   PS  S+YGV  FP 
Sbjct  67    --DDVTAILFYASWCPFSTDVKSKFGALNSMFPRIRHVMVEQSKAMPSVFSRYGVHSFPA  124

Query  668   LFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQES  489
             + ++N T R  YHG + L SLV+FY   TG +   +  ++  +I   ++ H+     + S
Sbjct  125   ILIVNQTTRVWYHGRKDLQSLVNFYKRTTGLDPVIE--VTEHQITYKADGHKAFQQWKGS  182

Query  488   CPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRC-ILNLRTRSSWE  312
                    S +  L  E YL L+ AF+L R     FP +     A     I +L      E
Sbjct  183   -------SLRELLLSEPYLVLSVAFLLFRASLYFFPGLVAHVVALWVAYIPHLNMGIFGE  235

Query  311   YPQLCPSRAVQFFN-----SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               QL   R     +     S  +  K  N  +GA NA+ WAS SLASVS+G+
Sbjct  236   SRQLL-GRVFHVIDLKRAWSKLKLSKTRNFHKGARNARVWAS-SLASVSLGE  285



>ref|XP_010934707.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Elaeis guineensis]
Length=302

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/269 (34%), Positives = 141/269 (52%), Gaps = 31/269 (12%)
 Frame = -2

Query  935  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D +KS C   +     +E   ++L++ L    + +  Y ++ F ASWCPFS   +P+F+
Sbjct  40   LDVVKSQCPLWIEPSSPLEVSGETLEQELSRSQKSA--YYSVFFSASWCPFSSNTRPVFN  97

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +SS+ P + H A+EES+  PS  S+YG+  FP + L N TM  RY GS+ + SLV+FY 
Sbjct  98   ALSSMFPQIKHLAVEESSSTPSVFSRYGIHSFPAILLTNGTMMVRYRGSKDIKSLVNFYK  157

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
              TG      D +S   +   SN  R+  S +     +W  S +  +  E Y+A++  FV
Sbjct  158  KTTGF-----DPVSYFAVDQPSNS-RNVRSLR-----AWHGSLKELIAHEPYIAISLLFV  206

Query  410  LMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAV------QFFNSLKE  258
             ++ +   F  +  + RA   S    LNL     W   QL   RA       + ++ L+ 
Sbjct  207  CLKAIVRFFCVIFAYLRAFWFSLAWQLNLGILGEWS--QLL-ERAQHVLDIKKLWSKLRL  263

Query  257  PCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              K  N ++GA NA+AWAS SLASVS+G+
Sbjct  264  CNKTGNFRKGANNARAWAS-SLASVSLGE  291



>ref|XP_002325842.1| hypothetical protein POPTR_0019s05130g [Populus trichocarpa]
 gb|EEF00224.1| hypothetical protein POPTR_0019s05130g [Populus trichocarpa]
Length=296

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 139/272 (51%), Gaps = 22/272 (8%)
 Frame = -2

Query  950  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  786
            +S  S+  I+S C  ++     ++ D K L RAL    R +  Y ++LFYASWCPFSR  
Sbjct  26   ESALSLHHIQSQCPVSIPPNPPLQVDGKFLDRALTSKQRNA--YTSVLFYASWCPFSRSM  83

Query  785  KPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSL  606
               F ++SS+ P + H A+E+S+  PS  S+YG+   P++ ++N T + +Y G ++L SL
Sbjct  84   LLKFDMLSSMFPQIKHLALEQSSAHPSIFSRYGIHSLPSILIVNQTSKVQYRGPKNLQSL  143

Query  605  VDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSR-SPQNFLRQETYLA  429
              FY   TG E     + + D    +S + R+    Q      W+R S ++ ++ E YL 
Sbjct  144  AQFYRKTTGLEPV--QHFAKDDDDSTSTEGREQSIMQP-----WNRPSLEDIIKSEPYLV  196

Query  428  LATAFVLMR-LLYVIFPAVCRFSRASRRCI-----LNLRTRSSWEYPQLCPSRAVQFFNS  267
            LAT F+  R LL  ++P      +A   C      L +   +S  + ++     V+   +
Sbjct  197  LATLFLCFRVLLLYVYPKALSHIKAFYVCYVPHFNLEIFGETSQLFGRILHMVDVRRIWT  256

Query  266  LKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                 K  N  E A N + WAS SLASVS+G+
Sbjct  257  KLRLFKTRNFHERAKNFRVWAS-SLASVSLGE  287



>ref|XP_007161953.1| hypothetical protein PHAVU_001G1116001g, partial [Phaseolus vulgaris]
 gb|ESW33947.1| hypothetical protein PHAVU_001G1116001g, partial [Phaseolus vulgaris]
Length=232

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 124/244 (51%), Gaps = 45/244 (18%)
 Frame = -2

Query  851  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFP  672
            R+   Y ++LFYASWCPFS +  P F  +SS+ P V H A+E+S+  PS  SKYG+   P
Sbjct  13   RKRVGYASVLFYASWCPFSHRILPEFETLSSMFPQVEHVALEQSSALPSLYSKYGIHSLP  72

Query  671  TLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQE  492
             + L+N T R RYHG  +L+SLV+FY   TG E  ++D + + ++        D  S++ 
Sbjct  73   AILLVNQTSRVRYHGPNNLNSLVEFYARNTGLE--ARDKVVVGEL-------SDLLSDEH  123

Query  491  SCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC-----------------RFS  363
            S    +S    +  R+E YLAL+  F+ +R++  +F  +                  +  
Sbjct  124  STIKGFSLGEIS--RREPYLALSILFLCLRIILSVFSTIMPHLKAFWSSYVRHLSLQKLG  181

Query  362  RASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASV  183
            +   R +LN+     W   +LC SR+                 E A +A+ WAS SLASV
Sbjct  182  QVMER-VLNVMDVRIWTKLELCKSRS---------------FHERAKSARVWAS-SLASV  224

Query  182  SIGD  171
            S+GD
Sbjct  225  SLGD  228



>ref|XP_009130392.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Brassica rapa]
Length=302

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 133/256 (52%), Gaps = 31/256 (12%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            ++ D ++L R + + +  ++ Y+++LFYASWCPFSR  +P F ++SS+ P + H A+E S
Sbjct  57   LQVDGETLDRLMGL-NYDANGYMSVLFYASWCPFSRAVRPKFDMLSSMFPLIQHLAVEHS  115

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE-----TSSKDN  555
               PS  S+YG+   P++ ++N T + RYHG + L SL++FY + TG +       ++  
Sbjct  116  QALPSVFSRYGIHSLPSILIVNRTSKARYHGQKDLTSLIEFYEESTGLKPVQYVAEAEPT  175

Query  554  ISLDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMRLLYVIF  384
             SLD          DG         +W R   S     RQ+ +L L+  F+ +++  ++F
Sbjct  176  TSLDST--------DGNL------ITWLRKGTSISEIFRQDPFLVLSLLFICLQMAILVF  221

Query  383  P-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAM  222
            P A  R        + NL      E  QL  SRA+   +  +        K  N  E A 
Sbjct  222  PIAESRMKALWASYVSNLNLERFGEISQLF-SRALHMVDVRRLWLKLRLVKTRNFHERAK  280

Query  221  NAKAWASKSLASVSIG  174
            NA+AWAS SLASVS+G
Sbjct  281  NAQAWAS-SLASVSLG  295



>emb|CDY50856.1| BnaA05g37170D [Brassica napus]
Length=302

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 142/274 (52%), Gaps = 40/274 (15%)
 Frame = -2

Query  929  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  765
            ++ S C +++      + D ++L R + + +  ++ Y+++LFYASWCPFSR  +P F ++
Sbjct  42   DLDSKCPSSLHPAPPFQVDGETLDRLMGL-NYDANGYMSVLFYASWCPFSRAVRPKFDML  100

Query  764  SSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDL  585
            SS+ P + H A+E S   PS  S+YG+   P++ ++N T + RYHG + L SL++FY + 
Sbjct  101  SSMFPQIQHLAVEHSQALPSVFSRYGIHSLPSILIVNQTSKARYHGQKHLTSLIEFYEES  160

Query  584  TGAE-----TSSKDNISLDKIRCSSNKH-----RDGGSEQESCPFSWSRSPQNFLRQETY  435
            TG +       ++   SLD    ++N +     R G S  E              RQ+ +
Sbjct  161  TGLKPVQYVAEAEPTTSLD----ATNGNLITWLRKGTSISE------------IFRQDPF  204

Query  434  LALATAFVLMRLLYVIFP-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-  261
            L L+  ++ +++  ++FP A  R        + NL      E  QL  SRA+   +  + 
Sbjct  205  LVLSLLYICLQMAILVFPIAESRMKALWASYVSNLNLERFGEISQLF-SRALHMVDVRRL  263

Query  260  ----EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                   K  N  E AMNA+AWAS SLASVS+G 
Sbjct  264  WLKLRLVKTRNFHERAMNAQAWAS-SLASVSLGQ  296



>ref|XP_011089720.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X2 [Sesamum 
indicum]
Length=306

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 92/259 (36%), Positives = 133/259 (51%), Gaps = 31/259 (12%)
 Frame = -2

Query  911  STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFA  732
            S++ I+ D  S + A++   +  ++Y A+LFYASWCPFS  F+  FS +SS+ P + H  
Sbjct  55   SSSPIQVDGDSFENAVNSGSK--NEYTAVLFYASWCPFSSVFQSKFSTLSSMYPQIKHLM  112

Query  731  IEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTG-------AE  573
            +E+S+  PS  S+YG+   P+L ++N T R RYHG + L SL++FY   TG        E
Sbjct  113  VEQSSAMPSVFSRYGIHSVPSLLILNQTTRMRYHGRKDLQSLINFYKRTTGLYPVVDIVE  172

Query  572  TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLY  393
             +S ++ S  K+     +  +GGS +E+           FL  E YL L+  FV +R   
Sbjct  173  ETSSNSESGPKVF----QLWNGGSLKET-----------FL-MEPYLVLSAVFVFLRAFL  216

Query  392  VIFPA-VCRFSRASRRCILNLRTRSSWEYPQLCPSRA----VQFFNSLKEPCKRSNLQEG  228
              FP  V R        I +L      E  QL         V+   S  + CK  N  E 
Sbjct  217  YFFPEIVSRIMALWVAYIPHLNLGIFGESRQLLAHVLHLIDVKRIWSKLKLCKTRNFHER  276

Query  227  AMNAKAWASKSLASVSIGD  171
            A NA+ WAS SLASVS+G+
Sbjct  277  ARNARVWAS-SLASVSLGE  294



>gb|KFK37822.1| hypothetical protein AALP_AA3G033700 [Arabis alpina]
Length=302

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 136/265 (51%), Gaps = 32/265 (12%)
 Frame = -2

Query  923  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
            +S   T  IE D  SL R +D+     + Y+++LFYASWCPFSR  +P F ++SS+ P V
Sbjct  50   RSLYPTPPIEVDGDSLDRLMDL--NLGNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQV  107

Query  743  PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE---  573
             H A+E S   PS  S+YG+   P++ ++N T+  RYHG + L SL++FY + TG +   
Sbjct  108  QHLAVEHSQALPSVFSRYGIHSLPSILMVNQTINARYHGRKDLISLIEFYEESTGLQPVQ  167

Query  572  --TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVL  408
                ++   S+D          DG         +W R   S +   +++ +  L+  F+ 
Sbjct  168  YVAEAEPTTSIDAA--------DGNL------ITWLRNGTSIRQIFKRDPFFVLSLLFIC  213

Query  407  MRLLYVIFP-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKR  246
            ++++ ++FP A  R        + NL      E  Q+  SRA+   +  +        K 
Sbjct  214  IQIVILVFPIAESRMKALWASYVPNLNLGRFGEISQMF-SRALHMVDVRRLWLKLRLVKT  272

Query  245  SNLQEGAMNAKAWASKSLASVSIGD  171
             N +E A NA+AWAS SLASVS+G 
Sbjct  273  RNFRERAKNAQAWAS-SLASVSLGQ  296



>emb|CBI29948.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 133/272 (49%), Gaps = 57/272 (21%)
 Frame = -2

Query  971  DWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  792
            D++ A   S C +    S  S A+++ D   L RAL    ++ + + ++LF+ASWCPFS 
Sbjct  33   DFLVAFLQSQCPL----SLSSHALLDVDGNFLDRAL--TSKQGNGFTSVLFHASWCPFSC  86

Query  791  KFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLD  612
            K +P F V+SS+ P + H AI+ES+  PS  S+YG+   P++ ++N T R RYHG + L 
Sbjct  87   KMRPKFEVLSSMFPQIEHLAIKESSASPSMFSRYGIHSLPSILIVNQTSRMRYHGPKDLP  146

Query  611  SLVDFYGDLTGAET----SSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRS-PQNFLR  447
            SLV FY   TG E     +    IS +K            SE +S    W+ S  +    
Sbjct  147  SLVKFYRKTTGLEPVQYFAEDQTISFEK------------SEGQSILQPWNGSYVKEIFT  194

Query  446  QETYLALATAFVLMRLLYVIFPAVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNS  267
            +E YLA +   +L R+L +I                    +  W   +LC  R       
Sbjct  195  REPYLAFSIFQMLGRVLNMI------------------DVQRVWAKLKLCKIR-------  229

Query  266  LKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                    N +EGA +A+ WAS SLASVS+G+
Sbjct  230  --------NFREGAKSARVWAS-SLASVSLGE  252



>ref|XP_010054638.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X2 [Eucalyptus 
grandis]
Length=244

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 90/251 (36%), Positives = 125/251 (50%), Gaps = 27/251 (11%)
 Frame = -2

Query  893  GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAI  714
            G+   L R L   H     Y A+LFYASWCPFS+  +PI+  +SS+ P + H A+E+S  
Sbjct  2    GNGNFLDRFLMSKHHSG--YTAVLFYASWCPFSQSIRPIYEALSSMFPQIDHLAVEQSLA  59

Query  713  KPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIR  534
             PS  S+YG+   P++ L+N T R +YHG ++LD LV+FY   TG        +     +
Sbjct  60   MPSVFSRYGIHSLPSILLLNQTSRLQYHGPKTLDFLVEFYETNTGLHPVQHVMVE----Q  115

Query  533  CSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS  354
             S  + R+    Q     S        L++E YLAL+  F  +RLL  IFP V    RA 
Sbjct  116  PSRLQTRENSRTQFKDVLSMKS-----LKREPYLALSLLFSCLRLLMAIFPKVVSCLRAF  170

Query  353  RRCI-----LNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWA  204
              C+     LNL      E  QL   R V   +  +       CK  +    A +A+ WA
Sbjct  171  --CVSYVPHLNLEIFG--EATQLL-GRVVYAIDVRRIWTKVRLCKGRSFHARAKSARVWA  225

Query  203  SKSLASVSIGD  171
            S SLASVS+G+
Sbjct  226  S-SLASVSLGE  235



>gb|AAF00632.1|AC009540_9 unknown protein [Arabidopsis thaliana]
Length=318

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/263 (32%), Positives = 131/263 (50%), Gaps = 21/263 (8%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
            T  IE D  SL R +   H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H A+
Sbjct  54   TPPIEVDGDSLDRLMASQH--GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAV  111

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
            E S   PS  S+YG+   P++ ++N T+  RYHG + L SL++FY + T         I+
Sbjct  112  EHSQALPSVFSRYGIHSLPSILMVNQTLNARYHGRKDLISLIEFYEEATAHFGWIDLEIT  171

Query  548  --------LDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMR  402
                    L  ++  +     G +  +    +W R   S +   +Q+ +L L+  F+ ++
Sbjct  172  GCCSGFPGLQPVQYVAEGEPTGLNAGDGNLITWLRKGTSIREIFKQDPFLVLSLLFICLQ  231

Query  401  LLYVIFP-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSN  240
            +  ++FP A  R        + NL      E  QL  +R +   +  +        K  N
Sbjct  232  MAILVFPIAESRMRALWASYVANLNLGRFGEISQLF-NRGIHMVDVRRLWLKLSLVKTRN  290

Query  239  LQEGAMNAKAWASKSLASVSIGD  171
              E A NA+AWAS SLASVS+G 
Sbjct  291  FHERAKNAQAWAS-SLASVSLGQ  312



>ref|XP_008350130.1| PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfate reductase-like 
5 [Malus domestica]
Length=296

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 125/276 (45%), Gaps = 51/276 (18%)
 Frame = -2

Query  926  IKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVS  762
            ++S C  ++     ++ D   L RAL    R   DY A+LFYASWCP SR   P F  +S
Sbjct  37   LQSQCPISISPHPPLKVDGNFLDRALASQQRT--DYSAVLFYASWCPLSRTXYPTFEKLS  94

Query  761  SLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLT  582
             + P V H AIEES+  PS  S+YG+  FP++ L+N T   RYHG ++L  L  FY   T
Sbjct  95   FMFPQVEHLAIEESSALPSVFSRYGIHSFPSILLVNQTSMVRYHGPKNLSLLAQFYQKTT  154

Query  581  GAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMR  402
            G E         D     S   R+    Q     S     +   R+E +LA AT F+ +R
Sbjct  155  GLEPVQY----FDGDHTVSLNIREKSIIQSMSDMSL----REISRREPFLAFATLFLCLR  206

Query  401  LLYVIFPAVCR-----------------FSRASR---RCILNLRTRSSWEYPQLCPSRAV  282
            +L  +FP V                   F   S+   R +  +  R  W   +LC +R  
Sbjct  207  VLLYMFPKVLTRLQAFWVLYVPHFNLGIFGETSQIMGRILHMVDVRRIWTKLRLCKTR--  264

Query  281  QFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIG  174
                         N  +GA NA+ WAS SL SVS+G
Sbjct  265  -------------NFHKGAKNARVWAS-SLTSVSLG  286



>gb|ACG38706.1| APRL5 - Zea mays adenosine 5'-phosphosulfate reductase-like [Zea 
mays]
Length=274

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 94/167 (56%), Gaps = 12/167 (7%)
 Frame = -2

Query  857  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIG  678
            + RR   Y ++LFYA+WCPFS K +PIF  +S++ P + HF +EES+  PS  S+YGV G
Sbjct  70   LRRRGASY-SILFYAAWCPFSSKLRPIFGTLSTMYPQIHHFTVEESSATPSLFSRYGVRG  128

Query  677  FPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSE  498
            FP + L+N T   RY GS+ L+SLVDFY + TG +  +  ++          +    GS 
Sbjct  129  FPAILLVNETTMVRYRGSKDLNSLVDFYKETTGLDPIAYIDVV---------EQESTGSL  179

Query  497  QESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRA  357
                P  W RS +   + E YL +A  F++++++    P V    RA
Sbjct  180  SSVMP--WDRSIREMAKDEMYLLVAVLFIIVKVVAHFIPVVMSHLRA  224



>gb|ACU17922.1| unknown [Glycine max]
Length=129

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = -2

Query  992  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  813
            C   S  D++   PDSTC +  + S  S AVIEGDE SLQ+AL++VH+ +H+YVA+LFYA
Sbjct  40   CPAGSLLDFVLGFPDSTCPL--LNSLGSIAVIEGDEVSLQKALNMVHKNNHEYVAVLFYA  97

Query  812  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEESA  717
            SWCPFSR FKPIFSV+SSL P +PHFAI ES+
Sbjct  98   SWCPFSRVFKPIFSVLSSLHPSIPHFAIGESS  129



>gb|AES75170.2| 5-adenylylsulfate reductase-like protein [Medicago truncatula]
Length=294

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 124/233 (53%), Gaps = 14/233 (6%)
 Frame = -2

Query  851  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFP  672
            R+  + V++LFYASWCPFS +  P F  +SS+ P + H  IE+S+  PS  SKYG+   P
Sbjct  65   RKMIESVSILFYASWCPFSCRMLPKFEALSSMFPEIEHLVIEQSSALPSLYSKYGIHRLP  124

Query  671  TLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQE  492
            ++ L+N T R RY G   + SLV+FY   T  E SS  NI++D+     ++     + + 
Sbjct  125  SIILVNQTSRLRYRGRNDILSLVEFYESNTRFEASS--NIAIDQPSSMMSEENFSLNLKS  182

Query  491  SCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSW  315
                S   +    LR+E YL  +  F+ +R+L  +FP +    RA    CI +L  +   
Sbjct  183  LMGLSLKET----LRREPYLVFSVMFICLRILLFVFPKILSRLRAFWVSCIPHLNMQIFG  238

Query  314  EYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            E  Q+   R +Q  +  +       CK  N  E A +A+ WAS SLASVS+G+
Sbjct  239  ETSQVM-GRVLQVIDVRRIWTKLGLCKTRNFHERARSARVWAS-SLASVSLGE  289



>emb|CDY64906.1| BnaC05g47730D [Brassica napus]
Length=302

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 141/274 (51%), Gaps = 40/274 (15%)
 Frame = -2

Query  929  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  765
            ++ S C +++     I+   ++L R + + +  ++ Y+++LFYASWCPFSR  +P F ++
Sbjct  42   DLDSKCPSSLHPAPPIQVGGETLDRLMGL-NYDANGYMSVLFYASWCPFSRAVRPKFDML  100

Query  764  SSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDL  585
            SS+ P + H A+E S   PS  S+YG+   P++ ++N   + RYHG + L SL++FY + 
Sbjct  101  SSMFPRIQHLAVEHSQALPSVFSRYGIRSLPSILIVNQASKARYHGQKDLTSLIEFYEES  160

Query  584  TGAE-----TSSKDNISLDKIRCSSNKH-----RDGGSEQESCPFSWSRSPQNFLRQETY  435
            TG +       ++   SLD    ++N +     R G S  E              RQ+ +
Sbjct  161  TGLKPVQYVAEAEPTTSLD----ATNGNLITWLRKGTSISE------------IFRQDPF  204

Query  434  LALATAFVLMRLLYVIFP-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-  261
            L L+  F+ +++  ++FP A  R        + NL      E  QL  SRA+   +  + 
Sbjct  205  LVLSLLFICLQIAILVFPIAESRMKALWASYVSNLNLERFREISQLF-SRALHMVDVRRL  263

Query  260  ----EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                   K  N  E AMNA+AWAS SLASVS+G 
Sbjct  264  WLKLRLVKTRNFHERAMNAQAWAS-SLASVSLGQ  296



>ref|XP_012070440.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Jatropha curcas]
 gb|KDP39694.1| hypothetical protein JCGZ_02714 [Jatropha curcas]
Length=298

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 137/278 (49%), Gaps = 31/278 (11%)
 Frame = -2

Query  950  DSTCSIDEIKSSCS-----------TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWC  804
            DS C  + +  SC+              +E D K L RAL    R S    ++LFYASWC
Sbjct  26   DSVCPNESVLFSCNLQSQCPLSISPNPPLEVDGKFLDRALTSKQRNS--CTSILFYASWC  83

Query  803  PFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGS  624
            PFS+  +P F+++ S+ P + HF++E+S+  PS  S+YG+   P+L ++N T + +YHG 
Sbjct  84   PFSQNMRPKFNMLGSMFPQIEHFSVEQSSASPSIFSRYGIHSLPSLLIVNQTSKLQYHGP  143

Query  623  RSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDG-GSEQESCPFSWSRSP-QNFL  450
            + L SLV FY   TG          L  ++C       G  S +ES    W  S  +  +
Sbjct  144  KDLQSLVQFYEKTTG----------LKPVQCFGEDEPTGLDSGEESIMQHWDVSSLEEMM  193

Query  449  RQETYLALATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRT--RSSWEYPQLCPSRA  285
            ++E YL  A  F+ +R+L  I P +    +A   S     NL     +S  + ++     
Sbjct  194  KKEPYLVFAVLFLFLRVLLFISPKLVSHLKAFYGSYVPHFNLEIFGETSQLFGRILHMID  253

Query  284  VQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            V+        CK  N  EGA N + WAS SLASVS+G+
Sbjct  254  VRRIWVKLRLCKARNFHEGAKNCRVWAS-SLASVSLGE  290



>ref|NP_001051635.1| Os03g0806500 [Oryza sativa Japonica Group]
 sp|Q84M47.1|APRL5_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 5; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 5; Short=APR-like 
5; Short=OsAPRL5; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAP21422.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99443.1| adenosine 5'-phosphosulfate reductase 8, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13549.1| Os03g0806500 [Oryza sativa Japonica Group]
 gb|EEC76374.1| hypothetical protein OsI_13981 [Oryza sativa Indica Group]
 gb|EEE60139.1| hypothetical protein OsJ_13029 [Oryza sativa Japonica Group]
Length=301

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 133/271 (49%), Gaps = 39/271 (14%)
 Frame = -2

Query  947  STCS------IDEIKSSCSTAVIEGDE------KSLQRALDVVHRRSHDYVALLFYASWC  804
            STC+      +D + S C    IE         +++ + L++ HR      ++LFYA+WC
Sbjct  32   STCARRGPGFVDALASRCPCIRIEPSPPVEVRGEAIAKELNLRHRGVT--YSVLFYAAWC  89

Query  803  PFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGS  624
            PFS KF+PIF  +S++ P + HF +EES+  PS  S+YGV GFP + L+N T   RY G 
Sbjct  90   PFSSKFRPIFEALSTMFPQIYHFTVEESSAMPSLFSRYGVRGFPAILLVNETTMVRYWGP  149

Query  623  RSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDG-GSEQESCPFSWSRSPQNFLR  447
            + L SLVDFY + TG           D I      H+D  G  +   P    RS +   +
Sbjct  150  KDLSSLVDFYKETTG----------FDPIAYFDVDHQDSTGDFRPVTP--GDRSLRKIAK  197

Query  446  QETYLALATAFVLMRLLYVIFPAVCRFSR---ASRRCILNLRTRSSWEYPQLCPSRAVQF  276
             E ++ LA  F+++++     P V    +     R   LNL  R      QL   RA+  
Sbjct  198  DEPFVLLAVLFIILKVAAHFVPIVVSHLKTFLVVRVQNLNLGIRRGSS--QLL-ERALNV  254

Query  275  FN------SLKEPCKRSNLQEGAMNAKAWAS  201
             +       L+   K  +L++GA NA+AWAS
Sbjct  255  LDVKRLCSKLRLSNKTRDLRKGASNARAWAS  285



>ref|XP_003548734.2| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Glycine 
max]
Length=285

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 86/275 (31%), Positives = 130/275 (47%), Gaps = 51/275 (19%)
 Frame = -2

Query  929  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  765
            E++S CS A      ++ D   ++  L    R+   Y+++LFYASWCP S +  P F ++
Sbjct  36   ELQSQCSLATSPDPPLQVDGNFIEGVLS--GRKRVGYISILFYASWCPLSCRMLPEFEIL  93

Query  764  SSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDL  585
            SS+ P V H A+E+S+  PS  SKYG+   P + L+N T R RYHG + L+ LV+FY   
Sbjct  94   SSMFPQVQHVALEQSSALPSLYSKYGIHSLPAILLVNQTSRVRYHGPKILNFLVEFYERN  153

Query  584  TGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLM  405
            TG E  +KDN  + ++   SN   D  S  +        S +    +E YLAL+  F  +
Sbjct  154  TGLE--AKDNAVVGQL---SNLMSDEHSTMKGF------SLKEIFNREPYLALSILFFCL  202

Query  404  RLLYVIFPAVCR-----------------FSRASRRCILNLRTRSSWEYPQLCPSRAVQF  276
            R++  + P +                   F     R +  +  +  W   +L  +R    
Sbjct  203  RIILFVLPTIMSRLKEFWTSYASHLNMQIFGEVMERVLNVIDVKRIWTKLRLYKTR----  258

Query  275  FNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                       N  E   +A+ WAS SLASVS+GD
Sbjct  259  -----------NFHERVRSARVWAS-SLASVSLGD  281



>ref|XP_003618952.1| Thioredoxin domain-containing protein [Medicago truncatula]
Length=353

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 89/273 (33%), Positives = 138/273 (51%), Gaps = 21/273 (8%)
 Frame = -2

Query  956  LPDSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  792
            +P     +  ++S C T +     ++ D   +   L    R+  + V++LFYASWCPFS 
Sbjct  86   IPPPPSFLFHLQSQCPTFIQSNPPLQVDGNFIDEVLS--GRKMIESVSILFYASWCPFSC  143

Query  791  KFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLD  612
            +  P F  +SS+ P + H  IE+S+  PS  SKYG+   P++ L+N T R RY G   + 
Sbjct  144  RMLPKFEALSSMFPEIEHLVIEQSSALPSLYSKYGIHRLPSIILVNQTSRLRYRGRNDIL  203

Query  611  SLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYL  432
            SLV+FY   T  E SS  NI++D+     ++     + +     S   +    LR+E YL
Sbjct  204  SLVEFYESNTRFEASS--NIAIDQPSSMMSEENFSLNLKSLMGLSLKET----LRREPYL  257

Query  431  ALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLK--  261
              +  F+ +R+L  +FP +    RA    CI +L  +   E  Q+   R +Q  +  +  
Sbjct  258  VFSVMFICLRILLFVFPKILSRLRAFWVSCIPHLNMQIFGETSQVM-GRVLQVIDVRRIW  316

Query  260  ---EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                 CK  N  E A +A+ WAS SLASVS+G+
Sbjct  317  TKLGLCKTRNFHERARSARVWAS-SLASVSLGE  348



>ref|XP_004489697.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Cicer arietinum]
Length=293

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 122/236 (52%), Gaps = 25/236 (11%)
 Frame = -2

Query  851  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFP  672
            R+  + V++LFYASWCPFSR+  P F  +SS+ P + H  +E+S+  PS  SKYG+   P
Sbjct  69   RKKIECVSILFYASWCPFSRRMLPKFETLSSMFPQIEHLVLEQSSALPSLYSKYGIHSLP  128

Query  671  TLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSN---KHRDGGS  501
             + L+N T R RY G  +  S+++FY   T  E SS  NI + +     N   K   G S
Sbjct  129  AIVLLNQTSRLRYGGPNNFLSILEFYERNTRFEASS--NIVIGQPSSDENSSLKSLMGLS  186

Query  500  EQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTR  324
             +E+             R+E YL  +  F+ +R+L  +FP +    RA    CI +L  +
Sbjct  187  LKETS------------RREPYLVFSVMFICLRILLFVFPKIVSRIRAFWVSCIPHLNMQ  234

Query  323  SSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               E  Q+   R +Q  +  +       CK  N  E A +A+ WAS SLASVS+G+
Sbjct  235  IFGETSQVM-GRVLQVIDVRRIWTKLGLCKTRNFHERARSARVWAS-SLASVSLGE  288



>ref|XP_002525419.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36909.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/260 (32%), Positives = 128/260 (49%), Gaps = 20/260 (8%)
 Frame = -2

Query  950  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  786
            +S+  + +++S C   +     ++ D   L RAL    R S  Y ++LFYASWCPFSR  
Sbjct  30   ESSLLLYDLQSQCPLEIFPNPPLQVDGNFLDRALASNQRNS--YTSVLFYASWCPFSRII  87

Query  785  KPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSL  606
             P F ++ S+ P + HFAIE+S+  PS  S+YG+   PT+ ++N T + +YHG   + SL
Sbjct  88   CPKFDMLGSMFPQIEHFAIEQSSAVPSIFSRYGIRSLPTILMINQTSKVQYHGPNDIQSL  147

Query  605  VDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLAL  426
            V FY   TG +        +  +        DG  +    P+ +  S +  +++E YL L
Sbjct  148  VQFYEKTTGIKP-------VQYLAEYEPSGLDGCGKSIMQPW-YGSSLEEVMKREAYLVL  199

Query  425  ATAFVLMRLLYVIFPAVCRFSRASRRCIL---NLRT--RSSWEYPQLCPSRAVQFFNSLK  261
            A  F+ +R+L  I P V    RA     L   NL     +S  + ++     V+   +  
Sbjct  200  AAMFLCLRVLLYISPKVLSHLRAFYVLYLPHFNLEKFGETSQLFGRILHMIDVRRIWTRI  259

Query  260  EPCKRSNLQEGAMNAKAWAS  201
              CK  N  +GA N + WAS
Sbjct  260  RLCKTRNFHQGAKNCRVWAS  279



>emb|CDX92054.1| BnaC03g33560D [Brassica napus]
Length=303

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 130/257 (51%), Gaps = 32/257 (12%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D  SL R + + H     Y+++LFYASWCPFSR  +  F ++SS+ P + H A+E S
Sbjct  57   IEVDGDSLDRLMALSHDDGDAYMSVLFYASWCPFSRAVRTKFDMLSSMFPQIQHLAVEHS  116

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE-----TSSKDN  555
               PS  S+YG+   P++ ++N T++ RYHG + L SL++FY + TG +       ++  
Sbjct  117  QALPSVFSRYGIHSLPSILMVNQTLKARYHGRKDLTSLIEFYEESTGLKPVQYVAEAEPA  176

Query  554  ISLDKIRCSSNKHRDGGSEQESCPFSWSRS----PQNFLRQETYLALATAFVLMRLLYVI  387
             SLD          DG         +W R+     + F+R + +L L+  F+ +++  ++
Sbjct  177  TSLDAT--------DGNL------ITWLRNGTSMSEIFIR-DPFLVLSLLFICIQVAILV  221

Query  386  FP-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFN-----SLKEPCKRSNLQEGA  225
            FP A  R          NL      E  Q+  SRA+   +           K  +  E A
Sbjct  222  FPIAESRMKALWASYAPNLNLERFGEVSQVF-SRALHMVDVRRLWLRLRLVKTRSFHERA  280

Query  224  MNAKAWASKSLASVSIG  174
             NA+AWAS SLASVS+G
Sbjct  281  KNAQAWAS-SLASVSLG  296



>gb|ACN33657.1| unknown [Zea mays]
Length=140

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = -2

Query  503  SEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR-ASRRCILNLRT  327
            +EQE+CPF W+RSP+N L+Q+TYLALAT FV++RLLY IFP +  F+R A RR  +  + 
Sbjct  14   AEQENCPFWWARSPENILQQDTYLALATVFVILRLLYRIFPKIDSFTRWAWRRHNMFAKL  73

Query  326  RSSWEYPQLCPSRAVQFFNSL-KEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              + EY      +A Q F+ L     KR NLQEGAMNA AWASKSLASVSIG+
Sbjct  74   MGAHEYFLTYLEQARQKFHRLYPSSSKRGNLQEGAMNATAWASKSLASVSIGE  126



>ref|XP_006296718.1| hypothetical protein CARUB_v10014268mg [Capsella rubella]
 gb|EOA29616.1| hypothetical protein CARUB_v10014268mg [Capsella rubella]
Length=301

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 126/254 (50%), Gaps = 23/254 (9%)
 Frame = -2

Query  908  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  729
            T  IE D  SL R + +   + + Y+++LFYASWCPFS   +P F ++SS+ P + H  +
Sbjct  55   TPPIEIDGDSLDRLMAL--NQGNSYMSVLFYASWCPFSLAVRPKFDMLSSMFPQIQHLTV  112

Query  728  EESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNIS  549
            E S   PS  S+YG+   P++ ++N T+  RYHG + L SL++FY + TG          
Sbjct  113  EHSQALPSVFSRYGIHSLPSVLMVNQTLMARYHGRKDLTSLIEFYEEATG----------  162

Query  548  LDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMRLLYVIFP-  381
            L  ++  +          +    +W R   S     +Q+ +LAL+  F+ +++  ++FP 
Sbjct  163  LQPVQYVAEGEPTRLEADDDNLITWLRNGTSIGGIFKQDPFLALSLLFICLQMAILVFPV  222

Query  380  AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNA  216
            A  R          NL      E  QL  SR +   +  +        K  N  E A NA
Sbjct  223  AESRMRALWDSYAPNLNLERFREISQLF-SRGLHMVDVRRLWLKLRLIKTRNFHERAKNA  281

Query  215  KAWASKSLASVSIG  174
            +AWAS SLASVS+G
Sbjct  282  QAWAS-SLASVSLG  294



>ref|XP_009134747.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Brassica rapa]
 emb|CDX74204.1| BnaA03g28430D [Brassica napus]
Length=303

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 128/256 (50%), Gaps = 30/256 (12%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D  SL R + + H   + YV++LFYASWCPFSR  +  F ++S + P + H A+E S
Sbjct  57   IEVDGDSLDRLMALNHDDGNAYVSVLFYASWCPFSRAVRTKFDMLSLMFPQIQHLAVEHS  116

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE-----TSSKDN  555
               PS  S+YG+   P++ ++N T++ RYHG + L SL++FY + TG +        +  
Sbjct  117  QALPSVFSRYGIHSLPSILMVNQTLKARYHGRKDLTSLIEFYDESTGLKPVQYVAEGEPA  176

Query  554  ISLDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLALATAFVLMRLLYVIF  384
             +LD          DG         +W R   S     +++ +L L+  F+ +++  ++F
Sbjct  177  TTLDAT--------DGSL------ITWLRNGTSISEIFKRDPFLVLSLLFICIQVAILVF  222

Query  383  P-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAM  222
            P A  R          NL      E  Q+  SRA+   +  +        K  +  E A 
Sbjct  223  PIAESRMKALWASYAPNLNLERFGEVSQVF-SRALHMVDVRRLWLKLRLVKTRSFHERAK  281

Query  221  NAKAWASKSLASVSIG  174
            NA+AWAS SLASVS+G
Sbjct  282  NAQAWAS-SLASVSLG  296



>ref|XP_011457634.1| PREDICTED: 5'-adenylylsulfate reductase-like 5, partial [Fragaria 
vesca subsp. vesca]
Length=247

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/253 (34%), Positives = 117/253 (46%), Gaps = 55/253 (22%)
 Frame = -2

Query  851  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFP  672
            +++  + ++LFYASWCPFSR+  P F ++S + P V H A+E+S+  PS  S+YG+  FP
Sbjct  15   KQNSGFTSVLFYASWCPFSRRLNPTFEMLSFMFPQVDHLAVEQSSAFPSVFSRYGIPSFP  74

Query  671  TLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQE  492
            ++ ++N T R RYHG + L SLV FY   TG E                + H D     E
Sbjct  75   SILVVNHTSRVRYHGPKDLLSLVQFYQKTTGLEP-------------VQHYHHDQSVSYE  121

Query  491  SCPFSWSRSPQNF------LRQETYLALATAF------------VLMRL-----LYVIFP  381
                S  RS  N        R+E YL  AT F            VL  L     LY+   
Sbjct  122  RAEKSIIRSMNNMPSLKEVSRREPYLVFATLFLCLRLLLHILPKVLTHLKAFWVLYIPHF  181

Query  380  AVCRFSRASR---RCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKA  210
             +  F   S+   R +  +  R  W   +LC +R               N  EGA NA+ 
Sbjct  182  NMGIFGETSQIMGRILHMVDVRRIWNKLRLCKTR---------------NFHEGAKNARV  226

Query  209  WASKSLASVSIGD  171
            WAS SL SVS+G+
Sbjct  227  WAS-SLTSVSLGE  238



>ref|XP_004228686.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Solanum lycopersicum]
Length=300

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 127/257 (49%), Gaps = 27/257 (11%)
 Frame = -2

Query  911  STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFA  732
            S+ ++E D +SL +AL    +   +  A+LFYASWCPFS   K  F  +SS+ P + H  
Sbjct  49   SSKILETDGESLDKALRSSQK--DEVTAILFYASWCPFSTDVKLKFGALSSMFPQIRHVM  106

Query  731  IEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNI  552
            +E+S   PS  S+YGV  FP++ ++  T R RYHG + L SLV+FY   TG         
Sbjct  107  VEQSKATPSVFSRYGVHSFPSILIVTQTSRVRYHGQKDLPSLVNFYKRTTGLH-------  159

Query  551  SLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQ-ETYLALATAFVLMRLLYVIFPA-  378
             + ++  S   ++  G +       W  S    L   E YLAL+ AF+L R     FP  
Sbjct  160  PMVEVTESQITYKADGRKAFQ---KWKGSSLKELSSTEPYLALSVAFLLFRASLYFFPGL  216

Query  377  VCRFSRASRRCILNLRTRSSWEYPQLC--------PSRAVQFFNSLKEPCKRSNLQEGAM  222
            V R        I +L      +  Q+         P RA   ++ LK  CK  N  +GA 
Sbjct  217  VTRVVALWAAYIPHLNMGIFGDSRQILGRVFHVIDPKRA---WSKLKL-CKTRNFHKGAR  272

Query  221  NAKAWASKSLASVSIGD  171
            NA+ WAS SL SVS+G+
Sbjct  273  NARVWAS-SLTSVSLGE  288



>emb|CDY29967.1| BnaC01g40410D [Brassica napus]
Length=298

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 133/271 (49%), Gaps = 36/271 (13%)
 Frame = -2

Query  929  EIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  765
            +I S C      T  IE D  SL R +   H   + Y+++LFYASWCPFSR  +P F ++
Sbjct  38   DIHSKCPPSMYPTPPIEVDGDSLDRVMAFNHD-GNAYMSVLFYASWCPFSRALRPKFDML  96

Query  764  SSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDL  585
            SS+ P + H A++ S   PS  S+YG+   P++ ++N T + RYHG + L SL++FY + 
Sbjct  97   SSMFPQIHHLAVDHSQALPSVFSRYGIHSLPSILIVNQTSKARYHGRKDLTSLIEFYEES  156

Query  584  TGAE-----TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLA  429
            TG +     +  +   SLD          DG         +W R   S     + + +L 
Sbjct  157  TGLKPVQYVSEPEPTTSLDAT--------DGSL------ITWLRKGTSISEIFKGDPFLV  202

Query  428  LATAFVLMRLLYVIFP-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK---  261
            L+  FV +++  ++FP A  R        + NL      E  Q+   RA+   +  +   
Sbjct  203  LSLVFVCLQVAILVFPMAEQRLKALWASYVPNLNLERFGEVSQVF-RRALHMVDVRRLWL  261

Query  260  --EPCKRSNLQEGAMNAKAWASKSLASVSIG  174
                 K  +  E A NA+AWAS SLASVS+G
Sbjct  262  KLTLVKTRSFHERAKNARAWAS-SLASVSLG  291



>emb|CDP14309.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 127/245 (52%), Gaps = 24/245 (10%)
 Frame = -2

Query  878  LQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTL  699
            L+R L    R S  Y A+LFYASWCPFS++    F V+SS+ P + H A+E+S+  PS  
Sbjct  68   LERVLSSKARNS--YAAVLFYASWCPFSQRAYMTFEVLSSMYPHIEHLAVEQSSATPSLF  125

Query  698  SKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNK  519
            S++G+   P + ++    R R++GS+ LDSLV+FY   TG+E              ++N+
Sbjct  126  SRFGIHSLPAIVMVKQKSRTRFYGSKDLDSLVEFYKQTTGSEPVQY---------VAANQ  176

Query  518  HRDGGSEQESCPFSW-SRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC-RFSR--ASR  351
                 +  +    SW   S +  + +E YL  +  F+++R+L  + P V  R     AS 
Sbjct  177  SGSSVTSPKLIVQSWMGSSIREMVTREPYLIFSVLFLILRVLVYVMPTVLYRLEDVWASY  236

Query  350  RCILNLRTRSSWEYPQLCPSRAVQFFN-----SLKEPCKRSNLQEGAMNAKAWASKSLAS  186
            R  LN+      E  Q+   R +Q  +     S    CK  N  + A NA+ WAS SLAS
Sbjct  237  RPHLNMEIFG--ETSQVL-GRILQMIDVKRAWSKLRICKNRNFHQSARNARVWAS-SLAS  292

Query  185  VSIGD  171
            VS+G+
Sbjct  293  VSLGE  297



>ref|XP_006354125.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Solanum 
tuberosum]
Length=300

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 86/270 (32%), Positives = 127/270 (47%), Gaps = 34/270 (13%)
 Frame = -2

Query  929  EIKSSC-------STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            ++KS C       S+ ++E D +SL + L    +   +  A+LFYASWCPFS   K  F 
Sbjct  36   DLKSQCPFGISVPSSKILETDGESLDKVLRSSQK--DEVTAILFYASWCPFSTDVKSKFG  93

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +SS+ P + H  +E+S   PS  S+YGV  FP++ ++  T R RYHG + L SLV+FY 
Sbjct  94   ALSSMFPQIRHVMVEQSKATPSVFSRYGVHSFPSILIVTQTSRVRYHGQKDLPSLVNFYK  153

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSP-QNFLRQETYLALATAF  414
              TG          LD +  ++       ++       W  S  +     E YL L+ AF
Sbjct  154  RTTG----------LDPMVDATESQITFKADGRKAFQKWKGSSLRELFSSEPYLVLSVAF  203

Query  413  VLMRLLYVIFPAVCR---------FSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK  261
            +L R     FP +               +     + R      +  + P RA   ++ LK
Sbjct  204  LLFRASLYFFPGLVARVVALWAAYIPHPNMGIFGDSRQILGRIFHVVDPKRA---WSKLK  260

Query  260  EPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
              CK  N  +GA NA+ WAS SL SVS+G+
Sbjct  261  L-CKTRNFHKGARNARVWAS-SLTSVSLGE  288



>ref|XP_007202392.1| hypothetical protein PRUPE_ppa009402mg [Prunus persica]
 gb|EMJ03591.1| hypothetical protein PRUPE_ppa009402mg [Prunus persica]
Length=294

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 122/249 (49%), Gaps = 18/249 (7%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            ++ D   L+RAL    R    Y A+LFYASWCPFS    P F ++S + P V H AIE+S
Sbjct  49   LKVDGNFLERALATKQRTG--YTAVLFYASWCPFSCSMYPTFGMLSFMFPQVEHLAIEQS  106

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  PS  S+YG+   P++ ++N T R RYHG + L SLV FY  +TG E     + +   
Sbjct  107  SALPSVFSRYGIHSLPSILIVNQTSRVRYHGLKDLYSLVRFYQTITGLEPVQYFDGNQSV  166

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
            I  SS K         S         +   R E YL  A  F+ +R L  IF  V    +
Sbjct  167  ILKSSEKSIIQSMSNMSL--------REISRSEPYLVFAILFLCLRALLYIFHRVLACLQ  218

Query  359  A-----SRRCILNLRTRSSWEYPQLCPSRAV-QFFNSLKEPCKRSNLQEGAMNAKAWASK  198
            A          L +   +S    ++     V + +N L+  CK  N  +GA NA+ WAS 
Sbjct  219  AFWVLYVPHFNLGIFGETSQIMGRILHMVDVRRIWNKLRL-CKTQNFHKGAKNARVWAS-  276

Query  197  SLASVSIGD  171
            SL SVS+G+
Sbjct  277  SLTSVSLGE  285



>ref|XP_009413322.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Musa acuminata 
subsp. malaccensis]
Length=302

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/256 (32%), Positives = 127/256 (50%), Gaps = 30/256 (12%)
 Frame = -2

Query  935  IDEIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D I+S C      ++  E   ++ +R L     +   Y ++LFYASWCPFS   +P+F 
Sbjct  42   LDGIESQCPLWIELSSPQEVSGETFERELS---GKQSAYYSILFYASWCPFSSNTRPMFD  98

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +SS+ P + H  +EES++ PS LS+ G+  FP + L+N T R +YHGSR L SLV FY 
Sbjct  99   ALSSMFPQIKHLLVEESSVMPSVLSRNGIHSFPAVMLINGTTRVQYHGSRDLTSLVQFYK  158

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
              TG        I L+  + SS + R      ES         +  +  E YL  +  F+
Sbjct  159  KNTGLNPV----IYLEIEQLSSERVRSHVPHVESA--------RELISHEPYLTFSIFFI  206

Query  410  LMRLLYVIFPAVCRFSRASRRCILN---LRTRSSWEYPQLCPS-----RAVQFFNSLKEP  255
             ++++   FP +  +SR     + +   L +R   E  QL           + +++L+  
Sbjct  207  CLKIIMCFFPVI--YSRIKAFWVSHAWPLNSRVLCESSQLLEQALHVIDVKRLWSNLRLC  264

Query  254  CKRSNLQEGAMNAKAW  207
             K  N Q+GA NA+AW
Sbjct  265  NKTRNFQKGANNARAW  280



>ref|XP_004962823.1| PREDICTED: 5'-adenylylsulfate reductase-like 6-like [Setaria 
italica]
Length=307

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 129/261 (49%), Gaps = 27/261 (10%)
 Frame = -2

Query  947  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  768
            +TC +       S   + G+E  L R LD       +Y A+LFYASWCPFS++ +P+F  
Sbjct  55   ATCPVS--AEGYSAEEVNGEE--LVRMLD----GKKEYTAVLFYASWCPFSQRMRPLFDD  106

Query  767  VSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGD  588
            +SS+ P + H A+EES + P+  S+Y V   P++ + + +  F   GS+ LDS+ +FY  
Sbjct  107  LSSMFPQIKHLAVEESNVMPAIFSRYAVRTLPSIIITHGSYAFWPLGSKDLDSMANFYTA  166

Query  587  LTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVL  408
            +TG E  +   I   K   + N H             W+ S    ++QE YLA +  F+ 
Sbjct  167  VTGQEPVAY--IGPRKWSAAQNTHYAK---------FWNSSISEAVKQEPYLAFSILFIC  215

Query  407  MRLLYVIFP---AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNL  237
            +R+    FP   A+ +         +NL   +       C   AV     +++   +  L
Sbjct  216  LRIFMFFFPKCFALIKGFWTQYFQQINLGILAKLNQLLECVPHAVD----VRKVWSKLRL  271

Query  236  QEGAMNAKAWASKSLASVSIG  174
              GA NA+AWAS SLASVS+G
Sbjct  272  VAGAKNARAWAS-SLASVSLG  291



>ref|XP_007030092.1| APR-like 5, putative [Theobroma cacao]
 gb|EOY10594.1| APR-like 5, putative [Theobroma cacao]
Length=299

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 134/279 (48%), Gaps = 35/279 (13%)
 Frame = -2

Query  959  ALPDSTCS------IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYA  813
             L  S CS      I  +   CS ++     ++ +   L RAL    ++ + Y A+LFYA
Sbjct  23   VLGSSICSHEADVFIKSLHFQCSPSISPIPPLKVNGNFLDRAL--ASKQRNGYTAVLFYA  80

Query  812  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRY  633
            SWCPFS    P F ++SS+ P   H  +E+S+  PS  S+YG+   P++ ++N T   RY
Sbjct  81   SWCPFSCSLHPKFDILSSMFPQFEHLMVEQSSAWPSLFSRYGIHSLPSILVVNQTSSVRY  140

Query  632  HGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSP-QN  456
             G + L S++ FY  +TG E              + NK    G+       SW+ S   +
Sbjct  141  RGPKDLPSIMQFYEKITGFEPVQN---------VAENKQVVSGNYNRYIIQSWNESSLMD  191

Query  455  FLRQETYLALATAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRA  285
             +++E YLA A  F+ +R+L  IFP V    +A   S    LNL      E  QL   RA
Sbjct  192  IVKREQYLAFAVLFLCLRVLLSIFPEVLSRLKAFWVSYAPHLNLEIFG--ETSQLF-VRA  248

Query  284  VQFFNSLK-----EPCKRSNLQEGAMNAKAWASKSLASV  183
            +   +  +       CK  N  +GA +A+ WAS SLASV
Sbjct  249  LHMVDVRRVWTKLRLCKTRNFHQGAKSARVWAS-SLASV  286



>emb|CDY21158.1| BnaA01g33890D [Brassica napus]
Length=298

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 134/271 (49%), Gaps = 36/271 (13%)
 Frame = -2

Query  929  EIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  765
            +I S C      T  IE D  SL R + + H   + YV++LFYASWCPFSR  +  F ++
Sbjct  38   DIHSKCPPSMYPTPPIEIDGDSLDRLMSLNHD-GNAYVSVLFYASWCPFSRALRSKFDML  96

Query  764  SSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDL  585
            SS+ P + H A++ S   PS  S+YG+   P++ ++N T + RYHG + L SL++FY + 
Sbjct  97   SSMFPQIHHLALDHSQALPSVFSRYGIHSLPSILMVNQTSKARYHGRKDLTSLIEFYEES  156

Query  584  TGAE-----TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLA  429
            TG +     +  +   S+D          DG         +W R   S     + + +L 
Sbjct  157  TGLKPVQYVSEPEPTTSVDAT--------DGNL------ITWLRKGTSISEIFKGDPFLV  202

Query  428  LATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQFFNSLK---  261
            L+  FV +++  ++FP   +  RA     + NL      E  Q+   RAV   +  +   
Sbjct  203  LSLVFVCLQMAILVFPIAEQRLRALWASYVPNLNLERFGEVSQVF-RRAVHMVDVRRLWL  261

Query  260  --EPCKRSNLQEGAMNAKAWASKSLASVSIG  174
                 K  +  E A NA+AWAS SLASVS+G
Sbjct  262  KLTLVKTRSFHERAKNARAWAS-SLASVSLG  291



>ref|XP_009417154.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=300

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/288 (32%), Positives = 135/288 (47%), Gaps = 28/288 (10%)
 Frame = -2

Query  1046  VGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRA  867
             V  LT   +L A  P LC      +  I  L D  C         S   + G+   L+R 
Sbjct  17    VASLTFPRSLAAVVPPLC-----PRSGIAFLDDLGCQCSRWIELSSPQEVSGE--MLERE  69

Query  866   LDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYG  687
             L         Y ++LFYASWC FS   +PIF  +S + P + H  +EES++ PS LS+ G
Sbjct  70    LS---NDQSAYYSVLFYASWCQFSSDIQPIFDALSYMFPQIKHLLVEESSVMPSVLSRNG  126

Query  686   VIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDG  507
             +  FP + L N T RFRY GS+   SLV FY   TG +  +     L+  + SS   R  
Sbjct  127   IHSFPAIMLFNGTTRFRYRGSKDFTSLVHFYKRSTGLDPITY----LEIHQSSSGNARTV  182

Query  506   GSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV-CRFSR--ASRRCILN  336
               + ES    W       + +E+YL  A  F+ ++++   FP +  RF     S    +N
Sbjct  183   IVQVESI---W-----ELITKESYLTFAILFICLKIIMCFFPLIYLRFKSFWVSHVWPVN  234

Query  335   LRT--RSSWEYPQLCPSRAVQ-FFNSLKEPCKRSNLQEGAMNAKAWAS  201
             LR    SS    ++     ++  +++++   K  N Q+GA NA+ WAS
Sbjct  235   LRILHESSLLLEKVLQVVDIKRMWSNIQLSNKTRNFQKGANNARVWAS  282



>ref|XP_009102086.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Brassica rapa]
Length=298

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 131/271 (48%), Gaps = 36/271 (13%)
 Frame = -2

Query  929  EIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  765
            +I S C      T  IE D  SL R L  +H   + YV++LFYASWCPFSR  +  F  +
Sbjct  38   DIHSKCPPSMYPTPPIEIDGDSLDR-LMALHHDGNAYVSVLFYASWCPFSRALRSKFDTL  96

Query  764  SSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDL  585
            SS+ P + H A++ S   PS  S+YG+   P++ ++N T + RYHG + L SL++FY + 
Sbjct  97   SSMFPQIHHLALDHSQALPSVFSRYGIHSLPSILMVNQTSKARYHGRKDLTSLIEFYEES  156

Query  584  TGAE-----TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSR---SPQNFLRQETYLA  429
            TG +     +  +   S+D          DG         +W R   S     + + +L 
Sbjct  157  TGLKPVQYVSEPEPTTSVDAT--------DGNM------ITWLRKGTSISEVFKGDPFLV  202

Query  428  LATAFVLMRLLYVIFP-AVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK---  261
            L+  FV ++   ++FP A  R        + NL      E  Q+   RAV   +  +   
Sbjct  203  LSLLFVCLQAAILVFPMAEQRLKALWASYVPNLNLERFGEVSQVF-RRAVHMVDVRRLWL  261

Query  260  --EPCKRSNLQEGAMNAKAWASKSLASVSIG  174
                 K  +  E A NA+AWAS SLASVS+G
Sbjct  262  KLTLVKTRSFHERAKNARAWAS-SLASVSLG  291



>ref|XP_010097394.1| 5'-adenylylsulfate reductase-like 5 [Morus notabilis]
 gb|EXB67900.1| 5'-adenylylsulfate reductase-like 5 [Morus notabilis]
Length=326

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 115/229 (50%), Gaps = 18/229 (8%)
 Frame = -2

Query  836  YVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLM  657
            Y ++LFYASWC FSR   P F  +SS+ P + H A+EES+  PS  S+Y +   P++ ++
Sbjct  101  YTSILFYASWCEFSRSTYPKFEALSSMFPQIEHLAVEESSAMPSVFSRYRIHSLPSIVMV  160

Query  656  NSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFS  477
            N T R RY+G + L SL+ FY   TG E     ++         N    GG  + +    
Sbjct  161  NQTSRVRYYGPKDLRSLMQFYEKTTGLEPVQYLDVD------QPNGSESGG--ESAIQLM  212

Query  476  WSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC-RFSRASRRCILNLRTRSSWEYPQL  300
               + +   ++E Y   +  F+ +R+L  +FP V  R       C+ +L      E  Q+
Sbjct  213  NGSALRAEWKREPYFVFSILFLCLRILVAVFPRVLSRLKAFWVSCVPHLNLGIFGETSQI  272

Query  299  CPSRAVQFFN------SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               R     +       L++ CK  NL EGA NA+ WAS SLASVS+G+
Sbjct  273  M-GRISHMIDVRGIWMKLRQ-CKTRNLHEGARNARVWAS-SLASVSLGE  318



>ref|XP_011089719.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X1 [Sesamum 
indicum]
Length=311

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 132/264 (50%), Gaps = 36/264 (14%)
 Frame = -2

Query  911  STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFA  732
            S++ I+ D  S + A++   +  ++Y A+LFYASWCPFS  F+  FS +SS+ P + H  
Sbjct  55   SSSPIQVDGDSFENAVNSGSK--NEYTAVLFYASWCPFSSVFQSKFSTLSSMYPQIKHLM  112

Query  731  IEESAIKPS-----TLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTG----  579
            +E+S+  P        S+YG+   P+L ++N T R RYHG + L SL++FY   TG    
Sbjct  113  VEQSSAMPRWVFLIVFSRYGIHSVPSLLILNQTTRMRYHGRKDLQSLINFYKRTTGLYPV  172

Query  578  ---AETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVL  408
                E +S ++ S  K+     +  +GGS +E+           FL  E YL L+  FV 
Sbjct  173  VDIVEETSSNSESGPKVF----QLWNGGSLKET-----------FL-MEPYLVLSAVFVF  216

Query  407  MRLLYVIFPA-VCRFSRASRRCILNLRTRSSWEYPQLCPSRA----VQFFNSLKEPCKRS  243
            +R     FP  V R        I +L      E  QL         V+   S  + CK  
Sbjct  217  LRAFLYFFPEIVSRIMALWVAYIPHLNLGIFGESRQLLAHVLHLIDVKRIWSKLKLCKTR  276

Query  242  NLQEGAMNAKAWASKSLASVSIGD  171
            N  E A NA+ WAS SLASVS+G+
Sbjct  277  NFHERARNARVWAS-SLASVSLGE  299



>ref|XP_009417155.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=249

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 113/218 (52%), Gaps = 18/218 (8%)
 Frame = -2

Query  836  YVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLM  657
            Y ++LFYASWC FS   +PIF  +S + P + H  +EES++ PS LS+ G+  FP + L 
Sbjct  26   YYSVLFYASWCQFSSDIQPIFDALSYMFPQIKHLLVEESSVMPSVLSRNGIHSFPAIMLF  85

Query  656  NSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFS  477
            N T RFRY GS+   SLV FY   TG +  +     L+  + SS   R    + ES    
Sbjct  86   NGTTRFRYRGSKDFTSLVHFYKRSTGLDPITY----LEIHQSSSGNARTVIVQVESI---  138

Query  476  WSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV-CRFSR--ASRRCILNLRT--RSSWE  312
            W       + +E+YL  A  F+ ++++   FP +  RF     S    +NLR    SS  
Sbjct  139  W-----ELITKESYLTFAILFICLKIIMCFFPLIYLRFKSFWVSHVWPVNLRILHESSLL  193

Query  311  YPQLCPSRAVQ-FFNSLKEPCKRSNLQEGAMNAKAWAS  201
              ++     ++  +++++   K  N Q+GA NA+ WAS
Sbjct  194  LEKVLQVVDIKRMWSNIQLSNKTRNFQKGANNARVWAS  231



>ref|XP_009420649.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 125/256 (49%), Gaps = 27/256 (11%)
 Frame = -2

Query  935  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            +D++ S C   +      E   ++L+R L+        Y ++LF  SWCPFSR  +PIF 
Sbjct  40   LDDLGSQCPRWIELPLRQEVSGETLERYLNC----GDQYCSVLFGVSWCPFSRNIQPIFD  95

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +SS+ P + H  +EES+I PS LS+ G+  FP + L+N T R RYHG + L+SLV FY 
Sbjct  96   ALSSMFPQIKHLLVEESSIMPSVLSRNGIHSFPAIMLINQTSRIRYHGPKDLNSLVHFYK  155

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
              TG        +++D+           GS     P     S    + +E YL     ++
Sbjct  156  KSTGLNPIMY--LAIDQ----------SGSGNVKSPVLEVESASELITKEPYLTFGIIYI  203

Query  410  LMRLLYVIFPAVCRFSRA---SRRCILN---LRTRSSWEYPQLCPSRAVQFFNSLKEPCK  249
             ++++   F A+    +A   S  C LN   LR  S      L        +++++   K
Sbjct  204  GLKIIICSFSAIYSCFKAFWVSHACHLNLSFLRESSQLLEQMLHVVEVNGLWSNIRFCNK  263

Query  248  RSNLQEGAMNAKAWAS  201
             SN Q+GA NA+AWAS
Sbjct  264  TSNFQKGANNARAWAS  279



>ref|XP_002871802.1| hypothetical protein ARALYDRAFT_909820 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48061.1| hypothetical protein ARALYDRAFT_909820 [Arabidopsis lyrata subsp. 
lyrata]
Length=290

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/268 (32%), Positives = 127/268 (47%), Gaps = 34/268 (13%)
 Frame = -2

Query  941  CSIDEI--KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  768
            C I++I  +S   +   E D   L + +D  H  +  Y ++LFYASWCPFSR  +P F V
Sbjct  38   CEIEQICPRSLYPSPPFEVDGDLLDKLMDTNHGNA--YTSILFYASWCPFSRAVRPKFDV  95

Query  767  VSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGD  588
            +SS+ P + H  +E+S   PS  S+YG+   P++ ++N TM+ RYHG + L SL+ FY +
Sbjct  96   LSSMSPHIKHLIVEQSQALPSVFSRYGIHSLPSILMVNQTMKMRYHGQKDLASLIQFYKE  155

Query  587  LTGAE----TSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALAT  420
             TG +        +  SLD          +G S +E               +E Y+ LA 
Sbjct  156  TTGLKPVQYVDEGEPTSLDIDGNLITWLHNGSSIREVA------------EREPYMVLAL  203

Query  419  AFVLMRLLYVIFPAV-CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----E  258
             F+ ++L  +IFP +  R        + +L      E  QL   RA+   +  +      
Sbjct  204  MFLSLKLAILIFPIMGSRLKTLWALYVPHLSLAILGETSQLF-GRALHMIDVRRLWMKLR  262

Query  257  PCKRSNLQEGAMNAKAWASKSLASVSIG  174
              K  N QE A NA       LASVS+G
Sbjct  263  LTKTRNFQERAKNA-------LASVSLG  283



>ref|XP_009797663.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nicotiana sylvestris]
Length=292

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 126/250 (50%), Gaps = 23/250 (9%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            + GD   + RAL    R+   Y + LFYASWCPFSR+   +F  +SS+ P + H AIE+S
Sbjct  54   VSGD--FIDRAL--TSRQWSTYTSALFYASWCPFSRRIHFMFEALSSMYPQIEHLAIEQS  109

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  PS  S+YG+   P + + N T R  +H S+ LDSL  FY   TG E     ++    
Sbjct  110  SAMPSLFSRYGIHSMPAILIFNQTSRMWFHDSKDLDSLSKFYRRTTGLEPIQFVDVDQSG  169

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
            +     K R     + S P +        L +E YL+ A AF+ +R+++++   +    +
Sbjct  170  VL---RKKRFATESKLSLPLN------EMLSREPYLSFAVAFLCLRVIWIVAQRLMYHIK  220

Query  359  AS-RRCILNLRTRSSWEYPQLCPSRAVQ------FFNSLKEPCKRSNLQEGAMNAKAWAS  201
            A   R   N       E  Q+   R VQ       +  L++ CK  NL  GA +A+ WAS
Sbjct  221  AFWTRYRPNPNLDIFGETGQIL-RRIVQAIDMKGLWTKLRQ-CKIRNLHHGARSARVWAS  278

Query  200  KSLASVSIGD  171
             SLASVS+G+
Sbjct  279  -SLASVSLGE  287



>ref|XP_006664614.1| PREDICTED: 5'-adenylylsulfate reductase-like 6-like, partial 
[Oryza brachyantha]
Length=245

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 112/230 (49%), Gaps = 31/230 (13%)
 Frame = -2

Query  830  ALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNS  651
            A+LFYASWCPFS+  +PIF  +SS+ P + H A+E++ + P+ LS+YGV  FP++ L   
Sbjct  27   AVLFYASWCPFSQITRPIFEDLSSMFPQIKHMAVEQTNVMPAVLSRYGVRSFPSILLACG  86

Query  650  TMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWS  471
               F   GS+ LDSLV+ Y  +TG E  +              K    G+        W 
Sbjct  87   PYAFWPVGSKDLDSLVNVYTAVTGQEPVA---------YLGPRKWSAAGAGSTHHAKLWK  137

Query  470  RSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCI----------LNLRTRS  321
            ++    L+ E YLA +  F+ +++L V FP +         CI          +NL   +
Sbjct  138  KTINEALKSEPYLAFSILFICLKMLVVFFPKI-------SACIKGIWVQYFRNINLGILA  190

Query  320  SWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
                   C   AV     L++   +  L  GAMN + WAS SLAS+S G+
Sbjct  191  KLTQLLQCVPHAVD----LRKIWSKWRLMGGAMNNRVWAS-SLASMSFGE  235



>gb|EYU39267.1| hypothetical protein MIMGU_mgv1a011190mg [Erythranthe guttata]
Length=289

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 120/243 (49%), Gaps = 17/243 (7%)
 Frame = -2

Query  914  CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  735
            CS+  I+ D +SL+RA+    +  ++Y A+LFYASWCPFS  F+  FS +SS+ P V H 
Sbjct  55   CSSP-IQVDGESLERAMSSSQK--NEYTAVLFYASWCPFSSIFQSKFSTLSSMYPQVKHL  111

Query  734  AIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDN  555
             +E++++ PS  S+YG+   P+L +++   R RYHG + L SLV+FY   TG +      
Sbjct  112  MVEQTSVLPSVFSRYGIHSVPSLLIVDQKSRMRYHGQKDLQSLVNFYRKKTGLDP-----  166

Query  554  ISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
              +D +  +S   +   S+Q+        S +    +E YL  +  FV+ R    +FP +
Sbjct  167  -VVDMVEDTSCHSK---SDQKVSQLWNGASLKEKFLKEPYLLFSILFVMSRGFQYLFPEI  222

Query  374  CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFN-----SLKEPCKRSNLQEGAMNAKA  210
                 A     +       +   +    R +   +     S  + CK  N   GA NA+ 
Sbjct  223  APHIMAIWAAYVPHLNIGIFGDSRQIIGRVLHVIDVNGIWSKLKMCKTRNFHRGARNARV  282

Query  209  WAS  201
            WAS
Sbjct  283  WAS  285



>ref|XP_010558723.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
 ref|XP_010558724.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
Length=299

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 124/247 (50%), Gaps = 24/247 (10%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            ++GD   L R  D  H   + Y A+LFYASWC FSR  +P F  V+S+ P + H  +E S
Sbjct  57   VDGD--YLDRVTDAKH--GNGYTAVLFYASWCHFSRAVRPEFDAVASMFPHIKHLVVEHS  112

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N T + RYHG ++L SLV FY   TG          L  
Sbjct  113  HALPSVFSRYGIHSLPSILMVNQTSKVRYHGQKNLASLVQFYEKTTG----------LHP  162

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSP---QNFLRQETYLALATAFVLMRLLYVIFPAVCR  369
            I+    + +    E +    +W R     +  + +E YLA A  F+L++L  +I P V  
Sbjct  163  IQY-VGEGKQTSLETDGSLITWLRYGSYRREIMVREPYLAFAVMFLLLKLAMIIVPRVIS  221

Query  368  FSRA--SRRCILNLRTRSSWEYPQLCPSRAVQFFN-SLK-EPCKRSNLQEGAMNAKAWAS  201
              +A  + +    L+     E  +L   RA+   +  +K    K S+  E A  A+AWAS
Sbjct  222  RMKAIWASQIPHILKLGIIGETSRLF-GRALHMIDLRMKLRLTKTSSFHERAKKARAWAS  280

Query  200  KSLASVS  180
             SLAS+S
Sbjct  281  -SLASIS  286



>ref|XP_006400357.1| hypothetical protein EUTSA_v10014257mg [Eutrema salsugineum]
 gb|ESQ41810.1| hypothetical protein EUTSA_v10014257mg [Eutrema salsugineum]
Length=291

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/255 (31%), Positives = 121/255 (47%), Gaps = 38/255 (15%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            +E D   L R ++  H   + Y ++LFYASWCPFSR  +P F V+S++ P + H  +E+S
Sbjct  55   VEVDGDLLDRLINTNH--GNAYTSILFYASWCPFSRAVRPKFDVLSAMFPHIGHLIVEQS  112

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N T++ RYHG + L SL+ FY + TG +           
Sbjct  113  QALPSVFSRYGIHSLPSILMVNQTLKMRYHGQKDLASLILFYEETTGLKPV---------  163

Query  539  IRCSSNKHRDGGS----EQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
                  ++ D G     E +    +W     S +    +E YL LA  F+ ++L  ++FP
Sbjct  164  ------QYVDEGEPTSLEADGNLIAWLHNGSSIREIAEREPYLVLALMFLFLKLAILVFP  217

Query  380  AVC-RFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMN  219
             +  R        I +L      E  QL   RA+   +  +        K  N QE A N
Sbjct  218  IMASRLKTLWTSYIPHLSLGILGETSQLF-GRALHMIDVRRLWIKLRLTKTRNFQERAKN  276

Query  218  AKAWASKSLASVSIG  174
            A       LASVS+G
Sbjct  277  A-------LASVSLG  284



>gb|AGV54233.1| 5'-adenylylsulfate reductase-like protein [Phaseolus vulgaris]
Length=305

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 142/276 (51%), Gaps = 49/276 (18%)
 Frame = -2

Query  929  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  765
             ++S C  ++     ++ D   L R L    R+S +Y+++LFYASWCPFS+K  P F +V
Sbjct  44   NLQSQCPISIPTNPPLQVDGNILDRVLS--SRKSIEYISILFYASWCPFSQKMLPQFELV  101

Query  764  SSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDL  585
            SS+ P V H  +E+S+  PS  S+YG+   P + L+N T   RYHG  +L S+ +FY   
Sbjct  102  SSMFPQVEHLILEQSSALPSLFSRYGIHNLPAILLVNQTSMLRYHGPNNLLSVFEFYERN  161

Query  584  TG-----------AETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQET  438
            +G           +  +S +N+++++I         G S +E    +WSR P        
Sbjct  162  SGFVASINIVEQPSSMTSDENLTMNQI---------GLSLKE----TWSRDP--------  200

Query  437  YLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQ------  279
            YL  +  F+  RLL  +FP +    RA    C+ +L  +   E  Q+   R +Q      
Sbjct  201  YLLFSVLFLCFRLLLFVFPKIVSRLRAFWVSCVPHLNLQIFGETSQVM-GRVLQVIDVRR  259

Query  278  FFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             +N L+  CK    QE A +A+ WAS SLASVS+G+
Sbjct  260  IWNRLRL-CKIRIFQERARSARVWAS-SLASVSLGE  293



>ref|XP_007151851.1| hypothetical protein PHAVU_004G080800g [Phaseolus vulgaris]
 ref|XP_007151852.1| hypothetical protein PHAVU_004G080800g [Phaseolus vulgaris]
 gb|ESW23845.1| hypothetical protein PHAVU_004G080800g [Phaseolus vulgaris]
 gb|ESW23846.1| hypothetical protein PHAVU_004G080800g [Phaseolus vulgaris]
Length=305

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 142/276 (51%), Gaps = 49/276 (18%)
 Frame = -2

Query  929  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  765
             ++S C  ++     ++ D   L R L    R+S +Y+++LFYASWCPFS+K  P F +V
Sbjct  44   NLQSQCPISIPTNPPLQVDGNILDRVLS--SRKSIEYISILFYASWCPFSQKMLPQFELV  101

Query  764  SSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDL  585
            SS+ P V H  +E+S+  PS  S+YG+   P + L+N T   RYHG  +L S+ +FY   
Sbjct  102  SSMFPQVEHLILEQSSALPSLFSRYGIHNLPAILLVNQTSMLRYHGPNNLLSVSEFYERN  161

Query  584  TG-----------AETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQET  438
            +G           +  +S +N+++++I         G S +E    +WSR P        
Sbjct  162  SGFVASINIVEQPSSMTSDENLTMNQI---------GLSLKE----TWSRDP--------  200

Query  437  YLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQLCPSRAVQ------  279
            YL  +  F+  RLL  +FP +    RA    C+ +L  +   E  Q+   R +Q      
Sbjct  201  YLLFSVLFLCFRLLLFVFPKIVSRLRAFWVSCVPHLNLQIFGETSQVM-GRVLQVIDVRR  259

Query  278  FFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
             +N L+  CK    QE A +A+ WAS SLASVS+G+
Sbjct  260  IWNRLRL-CKIRIFQERARSARVWAS-SLASVSLGE  293



>gb|KGN53935.1| hypothetical protein Csa_4G192070 [Cucumis sativus]
Length=243

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 106/219 (48%), Gaps = 17/219 (8%)
 Frame = -2

Query  836  YVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLM  657
            Y ++ FYASWCPFS   +  F  +S L P + H  +E+S+  P+ LSKYGV  FP++ L+
Sbjct  19   YTSVFFYASWCPFSLHLRHTFETLSFLFPQMEHLVVEQSSTLPNVLSKYGVHSFPSILLV  78

Query  656  NSTMRFRYHGSRSLDSLVDFYGDLTGAE-TSSKDNISLDKIRCSSNKHRDGGSEQESCPF  480
            N T R RY G +++ SLV FY  +TG +     +N  L  I             +     
Sbjct  79   NGTSRVRYRGRKNILSLVRFYNRITGLKPIPYYNNAELVTIESVG---------RPVIQL  129

Query  479  SWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC-RFSRASRRCILNLRTRSSWEYPQ  303
            +   SP N L+ +  LA +  FV +R+     P V  + +   R C+ +L      E  Q
Sbjct  130  AKPSSPNNILKSDPLLAFSFVFVCLRVAMFKLPHVLHQLNNLCRSCVPHLNLEIFGETRQ  189

Query  302  LCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWAS  201
            L   R +Q  +  +        K  N+ +GA NA+ WAS
Sbjct  190  LM-GRILQMLDIRRAWAKLRLYKTKNIHKGARNARVWAS  227



>ref|XP_008441988.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Cucumis melo]
Length=298

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 118/247 (48%), Gaps = 19/247 (8%)
 Frame = -2

Query  920  SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  741
            S+  ++ ++ D   + R L     +   Y ++ FYASWCPFS   +  F  +S L P + 
Sbjct  48   SAVPSSPLQVDGDYIDRTLT--SYKKIGYTSVFFYASWCPFSLHLRHTFETLSFLFPQME  105

Query  740  HFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE-TSS  564
            H  +E+S+  P+ LSKYGV  FP++ L+N T R RY G +++ SLV FY  +TG +    
Sbjct  106  HLVVEQSSTLPNVLSKYGVHSFPSILLVNGTSRVRYRGRKNILSLVRFYSRITGLKPIPY  165

Query  563  KDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIF  384
             +N  L  I             +     + S SP N L+ +  LA +  FV +R+     
Sbjct  166  YNNAELVTIESVG---------RPIIQLAKSSSPNNILKSDPLLAFSFVFVCLRVAMFKL  216

Query  383  PAVC-RFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAM  222
            P V  + +   R CI +L      E  QL   R +Q  +  +        K  N+ +GA 
Sbjct  217  PHVLHQLNNLCRSCIPHLNLEIFGETRQLM-GRILQMLDIRRAWAKLRLYKTKNIHKGAR  275

Query  221  NAKAWAS  201
            NA+ WAS
Sbjct  276  NARVWAS  282



>ref|XP_007202391.1| hypothetical protein PRUPE_ppa009402mg [Prunus persica]
 gb|EMJ03590.1| hypothetical protein PRUPE_ppa009402mg [Prunus persica]
Length=290

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 87/249 (35%), Positives = 120/249 (48%), Gaps = 22/249 (9%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            ++ D   L+RAL    R    Y A+LFYASWCPFS    P F ++S + P V H AIE+S
Sbjct  49   LKVDGNFLERALATKQRTG--YTAVLFYASWCPFSCSMYPTFGMLSFMFPQVEHLAIEQS  106

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
                S L +YG+   P++ ++N T R RYHG + L SLV FY  +TG E     + +   
Sbjct  107  ----SALPRYGIHSLPSILIVNQTSRVRYHGLKDLYSLVRFYQTITGLEPVQYFDGNQSV  162

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
            I  SS K         S         +   R E YL  A  F+ +R L  IF  V    +
Sbjct  163  ILKSSEKSIIQSMSNMSL--------REISRSEPYLVFAILFLCLRALLYIFHRVLACLQ  214

Query  359  A-----SRRCILNLRTRSSWEYPQLCPSRAV-QFFNSLKEPCKRSNLQEGAMNAKAWASK  198
            A          L +   +S    ++     V + +N L+  CK  N  +GA NA+ WAS 
Sbjct  215  AFWVLYVPHFNLGIFGETSQIMGRILHMVDVRRIWNKLRL-CKTQNFHKGAKNARVWAS-  272

Query  197  SLASVSIGD  171
            SL SVS+G+
Sbjct  273  SLTSVSLGE  281



>gb|EYU26001.1| hypothetical protein MIMGU_mgv1a022783mg, partial [Erythranthe 
guttata]
Length=270

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 122/255 (48%), Gaps = 21/255 (8%)
 Frame = -2

Query  935  IDEIKSSC-----STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  771
            + ++ S C     S++ I+ D +SL+RA+    +  ++Y A+LFYASWCPFS  F+  FS
Sbjct  23   LHDLNSQCPLFIPSSSPIQVDGESLERAMSSSQK--NEYTAVLFYASWCPFSSIFQSKFS  80

Query  770  VVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYG  591
             +SS+ P V H  +E++++ PS  S+YG+   P+L +++   R RYHG + L SLV+FY 
Sbjct  81   TLSSMYPQVKHLMVEQTSVLPSVFSRYGIHSVPSLLIVDQKSRMRYHGQKDLQSLVNFYR  140

Query  590  DLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFV  411
              TG +        ++   C S       S+Q+        S +    +E YL  +  FV
Sbjct  141  KKTGLDPVVD---MVEDTSCHSK------SDQKVSQLWNGASLKEKFLKEPYLLFSILFV  191

Query  410  LMRLLYVIFPAVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFN-----SLKEPCKR  246
            + R    +F  +     A     +       +   +    R +   +     S  + CK 
Sbjct  192  MSRGFQYLFSEIAPHIMAIWAAYVPHLNIGIFGDSRQIIGRVLHVIDVNGIWSKLKMCKT  251

Query  245  SNLQEGAMNAKAWAS  201
             N   GA NA+ WAS
Sbjct  252  RNFHRGARNARVWAS  266



>dbj|BAB09470.1| unnamed protein product [Arabidopsis thaliana]
Length=303

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/255 (31%), Positives = 123/255 (48%), Gaps = 24/255 (9%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D   L + +D  H  +  Y+++LFY S CPFSR  +P F V+SS+ P + H  +E+S
Sbjct  53   IEVDGDLLDKLMDANHGNA--YISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQS  110

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N TM+ RYHG + L SL+ FY + TG E+   +      
Sbjct  111  QALPSVFSRYGIHSLPSILMVNQTMKMRYHGPKDLASLIQFYKETTG-ESMLHEKPDCVS  169

Query  539  IRCSSNKHRDGGS----EQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
            +     ++ D G     + +    +W     S +    +E Y+ LA  F+ ++L  +IFP
Sbjct  170  VCLKPVQYMDEGEPTSLDTDGNLITWLHNGSSIREIAEREPYMVLALMFLSLKLAILIFP  229

Query  380  AV-CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMN  219
             +  R        + +L      E  QL   RA+   +  +        K  N QE A N
Sbjct  230  IMGSRLKTLWALYVPHLSLGILGETSQLF-GRALHMIDVRRLWIKLRLTKTRNFQERAKN  288

Query  218  AKAWASKSLASVSIG  174
            A       LASVS+G
Sbjct  289  A-------LASVSLG  296



>ref|XP_008240528.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Prunus mume]
Length=296

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 122/263 (46%), Gaps = 46/263 (17%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            ++ D   L+RAL    R    Y A+LFYASWCPFS    P F ++S + P V H AIE+S
Sbjct  49   LKVDGNFLERALASKQRT--GYTAVLFYASWCPFSCSMYPTFGMLSFMFPQVEHLAIEQS  106

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  PS  S+YG+   P++ ++N T R RYHG + L SLV FY  +TG E     + +   
Sbjct  107  SALPSVFSRYGIHSLPSILIVNQTSRVRYHGLKDLYSLVRFYQTITGLEPVQYFDGNQSV  166

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALA--------TAFVLMR------  402
            +  SS K     S  +S     + S +   R E YL  A          ++  R      
Sbjct  167  VLKSSEK-----SIIQSIS---NMSLREISRSEPYLVFALLFLCLRVLLYIFHRVLACLK  218

Query  401  ---LLYVIFPAVCRFSRASR---RCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSN  240
               +LYV    +  F   S+   R +  +  R  W   +L               CK  N
Sbjct  219  AFWVLYVPHFNLGIFGETSQIMGRILHMVDVRRIWNKLRL---------------CKTQN  263

Query  239  LQEGAMNAKAWASKSLASVSIGD  171
              +GA NA+ WAS SL SVS+G+
Sbjct  264  FHKGAKNARVWAS-SLTSVSLGE  285



>ref|NP_568360.1| 5'-adenylylsulfate reductase-like 7 [Arabidopsis thaliana]
 sp|Q84JN1.1|APRL7_ARATH RecName: Full=5'-adenylylsulfate reductase-like 7; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 7; Short=APR-like 
7; Short=AtAPRL7; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22670.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42428.1| unknown protein [Arabidopsis thaliana]
 gb|AED92509.1| 5'-adenylylsulfate reductase-like 7 [Arabidopsis thaliana]
Length=289

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 119/252 (47%), Gaps = 32/252 (13%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D   L + +D  H   + Y+++LFY S CPFSR  +P F V+SS+ P + H  +E+S
Sbjct  53   IEVDGDLLDKLMDANH--GNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQS  110

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE----TSSKDNI  552
               PS  S+YG+   P++ ++N TM+ RYHG + L SL+ FY + TG +        +  
Sbjct  111  QALPSVFSRYGIHSLPSILMVNQTMKMRYHGPKDLASLIQFYKETTGLKPVQYMDEGEPT  170

Query  551  SLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV-  375
            SLD          +G S +E               +E Y+ LA  F+ ++L  +IFP + 
Sbjct  171  SLDTDGNLITWLHNGSSIREIA------------EREPYMVLALMFLSLKLAILIFPIMG  218

Query  374  CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKA  210
             R        + +L      E  QL   RA+   +  +        K  N QE A NA  
Sbjct  219  SRLKTLWALYVPHLSLGILGETSQLF-GRALHMIDVRRLWIKLRLTKTRNFQERAKNA--  275

Query  209  WASKSLASVSIG  174
                 LASVS+G
Sbjct  276  -----LASVSLG  282



>gb|ERN20398.1| hypothetical protein AMTR_s00068p00075130 [Amborella trichopoda]
Length=202

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 97/201 (48%), Gaps = 17/201 (8%)
 Frame = -2

Query  758  LLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTG  579
            + P + H AI ES   PS  S+YGV   PT+ + N T R RY+G + L+SLV FY   TG
Sbjct  1    MFPHIRHVAISESTATPSVFSRYGVHSLPTIVIANRTSRLRYNGPKDLNSLVQFYKKTTG  60

Query  578  AETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRL  399
             E      ++      S N  R            W  +P+  +R+E YLALA  F+L R 
Sbjct  61   FEPEEFLEVNHPTNLASENPIR-----------LWHSTPRELVRREPYLALAVIFLLCRA  109

Query  398  LYVIFPAVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFN-----SLKEPCKRSNLQ  234
               IFP    + R+     +   +   +    L   RA+  FN     S    CK  N +
Sbjct  110  FLYIFPKCMSWLRSLWMLHMGHLSLGVFGERSLLVERALHVFNIKRVWSRLRLCKTRNFE  169

Query  233  EGAMNAKAWASKSLASVSIGD  171
            +GA NA+ WAS SLASVSIG+
Sbjct  170  KGAKNARVWAS-SLASVSIGE  189



>ref|XP_010237189.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Brachypodium 
distachyon]
Length=305

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 113/230 (49%), Gaps = 24/230 (10%)
 Frame = -2

Query  842  HDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLF  663
              Y A+LFYASWCPFS++ +P+F  +SS+ P + H A+E+S + P+ LS+YGV  FP++ 
Sbjct  84   EGYTAVLFYASWCPFSQRMRPVFDDLSSMYPQIKHLAVEQSNVMPAVLSRYGVRSFPSIL  143

Query  662  LMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCP  483
            + + +  F   G++ L+SLV+FY  +TG E  +              K    G   +   
Sbjct  144  IPHGSFAFWPIGAKDLNSLVNFYFAVTGQEPVAY---------LGPRKWSPTGQSTQYVK  194

Query  482  FSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCILNLRTRSSWEYPQ  303
            F W+ S    ++ E YLA +  FV +R+                 CI  L T+       
Sbjct  195  F-WNGSINETVKSEPYLAFSILFVCLRVFLFF-------FPKFFTCIKGLWTQYFRHANL  246

Query  302  LCPSRAVQFFN------SLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
               ++  Q          +++   +  L  GAMNA+ WAS SLASVSIG 
Sbjct  247  GVLAKLTQLLECVPHAVDVRKMWSKWRLMVGAMNARVWAS-SLASVSIGG  295



>gb|AAM60945.1| contains similarity to protein disulfide isomerase-related protein 
[Arabidopsis thaliana]
Length=289

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 119/252 (47%), Gaps = 32/252 (13%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D   L + +D  H   + Y+++LFY S CPFSR  +P F V+SS+ P + H  +E+S
Sbjct  53   IEVDGDLLDKLMDANH--GNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQS  110

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE----TSSKDNI  552
               PS  S+YG+   P++ ++N TM+ RYHG + L SL+ FY + TG +        +  
Sbjct  111  QALPSVFSRYGIHSLPSILMVNQTMKMRYHGPKDLASLIQFYKETTGLKPVQYMDEGEPT  170

Query  551  SLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV-  375
            SLD          +G S +E               +E Y+ LA  F+ ++L  +IFP + 
Sbjct  171  SLDTDGNLITWLHNGSSIREIA------------EREPYMLLALMFLSLKLAILIFPIMG  218

Query  374  CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKA  210
             R        + +L      E  QL   RA+   +  +        K  N QE A NA  
Sbjct  219  SRLKTLWALYVPHLSLGILGETSQLF-GRALHMIDVRRLWIKLRLTKTRNFQERAKNA--  275

Query  209  WASKSLASVSIG  174
                 LASVS+G
Sbjct  276  -----LASVSLG  282



>ref|XP_010036228.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Eucalyptus grandis]
Length=271

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 132/279 (47%), Gaps = 57/279 (20%)
 Frame = -2

Query  959  ALPDSTCSID------EIKSSCSTAVIEGDEKSLQRALD-------VVHRRSHDYVALLF  819
            A P   C ++       + S CST++      SL   +D       V  +  +  VALL 
Sbjct  29   AEPRHACPVEPFPFLYRLTSRCSTSI----PPSLPLQVDGYFLDSIVASKDKNACVALLL  84

Query  818  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRF  639
            YASWCPFS++  PIF V+SS+ P + H  +E S++ PS LS+YG+   P++ ++N T   
Sbjct  85   YASWCPFSQRLLPIFDVLSSMFPQMDHLLVEHSSVFPSVLSRYGIHSVPSILVINQTSMV  144

Query  638  RYHGSRSLDSLVDFYGDLTGAE------TSSKDNISLDKIRCSSNKHRDGGSEQESCPFS  477
            +YHG ++L SLV FY   TG E            +S  K   S++  R+ G+        
Sbjct  145  KYHGPKTLLSLVRFYERNTGFEPVLDFMEGQLTGLSSSKESSSTSWIRNSGT--------  196

Query  476  WSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCILNLRTRSSWEYPQLC  297
               S +  + ++ YL+L+  F+ +R+L V F           R +  +  R +W   +L 
Sbjct  197  ---SMKEMIMKDPYLSLSVLFLCLRVLMVGFSEYL-------RVLHRIDVRRAWRKLRL-  245

Query  296  PSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVS  180
                          CK  N   GA +A+ WAS SLASVS
Sbjct  246  --------------CKNGNFHVGARDAQVWAS-SLASVS  269



>ref|XP_009624667.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nicotiana tomentosiformis]
Length=293

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 121/243 (50%), Gaps = 20/243 (8%)
 Frame = -2

Query  878  LQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTL  699
            + RAL    R+   Y + LFYASWCPFSR+   IF  +SS+ P + H A+E+S+  PS  
Sbjct  59   IDRAL--TSRQRSTYTSALFYASWCPFSRRIHFIFEALSSMYPQIEHLAVEQSSAMPSLF  116

Query  698  SKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNK  519
            S+YG+   P + + N T R  +H  + LDSL  FY   TG +      + +D        
Sbjct  117  SRYGIHSVPAILIFNRTSRTWFHDCKDLDSLSKFYRRTTGLKP--IQFVDVDHSGVLRKN  174

Query  518  HRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCI  342
             R     + S P +        L +E YL+ A AF+ +R+++++   +    +A   R  
Sbjct  175  ARFATESKLSLPLN------EMLSREPYLSFAVAFLCLRVIWIVAQRLMYHIKAFWTRYR  228

Query  341  LNLRTRSSWEYPQLCPSRAVQ------FFNSLKEPCKRSNLQEGAMNAKAWASKSLASVS  180
             N       E  Q+   R VQ       +  L++ CK  NL  GA +A+ WAS SLASVS
Sbjct  229  PNPNLDIFGETGQIL-RRIVQAIDMKGLWTKLRQ-CKIRNLHHGARSARVWAS-SLASVS  285

Query  179  IGD  171
            +G+
Sbjct  286  LGE  288



>ref|XP_004147538.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Cucumis sativus]
Length=298

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 106/219 (48%), Gaps = 17/219 (8%)
 Frame = -2

Query  836  YVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLM  657
            Y ++ FYASWCPFS   +  F  +S L P + H  +E+S+  P+ LSKYGV  FP++ L+
Sbjct  74   YTSVFFYASWCPFSLHLRHTFETLSFLFPQMEHLVVEQSSTLPNVLSKYGVHSFPSILLV  133

Query  656  NSTMRFRYHGSRSLDSLVDFYGDLTGAE-TSSKDNISLDKIRCSSNKHRDGGSEQESCPF  480
            N T R RY G +++ SLV FY  +TG +     +N  L  I             +     
Sbjct  134  NGTSRVRYRGRKNILSLVRFYNRITGLKPIPYYNNAELVTIESVG---------RPVIQL  184

Query  479  SWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC-RFSRASRRCILNLRTRSSWEYPQ  303
            +   SP N L+ +  LA +  FV +R+     P V  + +   R C+ +L      E  Q
Sbjct  185  AKPSSPNNILKSDPLLAFSFVFVCLRVAMFKLPHVLHQLNNLCRSCVPHLNLEIFGETRQ  244

Query  302  LCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWAS  201
            L   R +Q  +  +        K  N+ +GA NA+ WAS
Sbjct  245  LM-GRILQMLDIRRAWAKLRLYKTKNIHKGARNARVWAS  282



>ref|XP_002319158.2| hypothetical protein POPTR_0013s05370g [Populus trichocarpa]
 gb|EEE95081.2| hypothetical protein POPTR_0013s05370g [Populus trichocarpa]
Length=248

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 120/242 (50%), Gaps = 23/242 (10%)
 Frame = -2

Query  902  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  723
            +++GD   L RAL    R +  Y ++LFYASWCPFS    P F ++SS+ P + H A+E+
Sbjct  4    LVDGD--FLDRALTSKQRNA--YTSVLFYASWCPFSCSMLPKFEILSSMFPQIEHLAVEQ  59

Query  722  SAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETS---SKDNI  552
            S+  PS  S+YG+   P++ ++N   + +Y G ++L SL  FY   TG E     +KD+ 
Sbjct  60   SSALPSIFSRYGIHSLPSILIVNQRSKVQYRGPKNLQSLAQFYKKTTGLEPVQLFTKDDS  119

Query  551  SLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVC  372
            S      S+  H     +  + P     S +  +++E YLALAT F+ +R+L    P   
Sbjct  120  S------STEGHEKSILQPWNGP-----SLEEIIKREPYLALATLFLCLRVLLYASPKAL  168

Query  371  RFSRA---SRRCILNLRT--RSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAW  207
               +A   S     NL     +S  + ++     V+   +    CK  N  E A N + W
Sbjct  169  SHLKAFYVSYIPHFNLEIFGETSQFFGRILHMIDVRRIWTKLRLCKTRNFHERAKNCRVW  228

Query  206  AS  201
            AS
Sbjct  229  AS  230



>sp|Q2QP53.1|APRL6_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 6; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 6; Short=APR-like 
6; Short=OsAPRL6; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|ABA99457.1| adenosine 5'-phosphosulfate reductase 6, putative, expressed 
[Oryza sativa Japonica Group]
Length=300

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 127/258 (49%), Gaps = 37/258 (14%)
 Frame = -2

Query  914  CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  735
            C    I G+E  L + L        +  A+LFYASWCPFS++ +P+F  +SS+ P + H 
Sbjct  60   CPAEEINGEE--LVKELS----GKEECTAVLFYASWCPFSQRMRPVFDDLSSMFPRIKHL  113

Query  734  AIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDN  555
            A+E++   P+ LS+YGV  FP++ +      +   GS+ LDSLV+ Y  +TG E  +   
Sbjct  114  AVEQTNAMPAVLSRYGVRSFPSILIACGPYAYWPVGSKELDSLVNVYTAVTGQEPIAY--  171

Query  554  ISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAV  375
              L   + S+   R G ++       W  S    L+ E YLA +  F+ +++L   FP  
Sbjct  172  --LGPRKWSAA--RTGSTQHVKL---WKSSIIEALKSEPYLAFSILFICLKILVAFFPKF  224

Query  374  --------CRFSRASRRCILNLRTRSSWEYPQL--CPSRAVQFFNSLKEPCKRSNLQEGA  225
                     ++ R +   IL   T       QL  C   AV     L++   +  L  GA
Sbjct  225  FSCIKGIWVQYFRHANLGILAKLT-------QLLECVPHAVD----LRKIWSKCRLMGGA  273

Query  224  MNAKAWASKSLASVSIGD  171
            MN++ WAS SLAS+S G+
Sbjct  274  MNSRVWAS-SLASMSFGE  290



>gb|KHN00681.1| 5'-adenylylsulfate reductase-like 5 [Glycine soja]
Length=299

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 118/230 (51%), Gaps = 19/230 (8%)
 Frame = -2

Query  839  DYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFL  660
            +Y ++LFYASWCPFSRK  P F ++SS    V H  +E+S++ PS  SKYG+   P + L
Sbjct  70   EYTSILFYASWCPFSRKMLPQFEILSSTFLQVEHLVLEKSSVLPSFFSKYGIHSLPAILL  129

Query  659  MNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPF  480
            +N T + RYHG  +L SL +FY   TG   SS   IS       S+++        S   
Sbjct  130  VNQTSKLRYHGPNNLLSLFEFYERKTGFAPSSNIVIS-PSTSTMSDENSTTNLFSLSMKE  188

Query  479  SWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRAS-RRCILNLRTRSSWEYPQ  303
            +WSR P        YL  +  F+ +RLL  + P +    RA    CI +L  +   E  Q
Sbjct  189  TWSREP--------YLLFSVLFLCLRLLLFVLPKIGSHLRAFWISCIPHLNLQIFGETCQ  240

Query  302  LCPSRAVQ------FFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIGD  171
            +   R +Q       +N L+  CK     E A +A+ WAS S+ SVS+G+
Sbjct  241  MM-GRVLQVIDVRRIWNKLRL-CKTRTFHEKARSARVWAS-SITSVSLGE  287



>emb|CDY25457.1| BnaC09g39720D [Brassica napus]
Length=277

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 111/249 (45%), Gaps = 54/249 (22%)
 Frame = -2

Query  854  HRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGF  675
            H R + Y ++LFYAS CPFSR  +P F V+SS+ P + H  +E+S   PS  S+YG+   
Sbjct  54   HNRGNAYTSILFYASRCPFSRAVRPKFDVLSSMFPHIRHLVVEQSQALPSVFSRYGIHSL  113

Query  674  PTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAE----TSSKDNISLDKIRCSSNKHRDG  507
            P++ ++N T R RYHG + L SL+ FY   TG +        +  S D          +G
Sbjct  114  PSILMVNQTFRIRYHGQKDLASLIQFYQHTTGLKPVQYVDEGEPTSFDTDGNLITWLHNG  173

Query  506  GSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRASRRCILNLRT  327
             S +E               ++ YL LA  F+ ++L  +IFP            I+  R 
Sbjct  174  SSIKE------------IAERDPYLVLALMFLSLKLAILIFP------------IMGARL  209

Query  326  RSSW-------------EYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAWAS  201
            ++ W             E  QL   RA+   +  +        K  N QE A NA     
Sbjct  210  QTLWASYTPHLSLGILGETSQLF-GRAMHMIDVRRLWIKLRLAKTRNFQERAKNA-----  263

Query  200  KSLASVSIG  174
              LASVS+G
Sbjct  264  --LASVSLG  270



>emb|CDP14310.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 122/248 (49%), Gaps = 16/248 (6%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            +E +  S + AL    +  + Y A+LFYASWCPFS+     F V+ SL P + H A+E+S
Sbjct  65   VEMNGDSRESALS--SKSGNTYTAVLFYASWCPFSQDALSAFEVLDSLYPEIDHLAVEQS  122

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
            +  PS  S+YG+   P + +++   R R+ GS+ LDSL+ FY   TG E      I++D+
Sbjct  123  STVPSLFSRYGIHSLPAIIIVSQKSRTRFRGSKDLDSLIKFYKKTTGHEPV--QYIAVDQ  180

Query  539  IRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSR  360
               S N    G S   S       S +  L +E YL  +  F+ +R++  + P     SR
Sbjct  181  ---SGNSGIGGKSMVVS---RCGSSAKETLTREPYLFFSVLFLSLRVMVYVCPKFLFHSR  234

Query  359  ---ASRRCILNLRT--RSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKS  195
                S R  LNL     +S    Q+      +   +    C   N   GA NA+ +AS S
Sbjct  235  NLWVSFRPHLNLEIFGGTSEILGQIFQMTDFKRVWTKIRLCNHRNFHLGASNARVFAS-S  293

Query  194  LASVSIGD  171
             ASVS+G+
Sbjct  294  FASVSLGE  301



>ref|XP_006400356.1| hypothetical protein EUTSA_v10014257mg [Eutrema salsugineum]
 gb|ESQ41809.1| hypothetical protein EUTSA_v10014257mg [Eutrema salsugineum]
Length=287

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 78/255 (31%), Positives = 119/255 (47%), Gaps = 42/255 (16%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            +E D   L R ++  H   + Y ++LFYASWCPFSR  +P F V+S++ P + H  +E+S
Sbjct  55   VEVDGDLLDRLINTNH--GNAYTSILFYASWCPFSRAVRPKFDVLSAMFPHIGHLIVEQS  112

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS    YG+   P++ ++N T++ RYHG + L SL+ FY + TG +           
Sbjct  113  QALPS----YGIHSLPSILMVNQTLKMRYHGQKDLASLILFYEETTGLKPV---------  159

Query  539  IRCSSNKHRDGGS----EQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
                  ++ D G     E +    +W     S +    +E YL LA  F+ ++L  ++FP
Sbjct  160  ------QYVDEGEPTSLEADGNLIAWLHNGSSIREIAEREPYLVLALMFLFLKLAILVFP  213

Query  380  AVC-RFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMN  219
             +  R        I +L      E  QL   RA+   +  +        K  N QE A N
Sbjct  214  IMASRLKTLWTSYIPHLSLGILGETSQLF-GRALHMIDVRRLWIKLRLTKTRNFQERAKN  272

Query  218  AKAWASKSLASVSIG  174
            A       LASVS+G
Sbjct  273  A-------LASVSLG  280



>ref|XP_010524982.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
Length=302

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 123/266 (46%), Gaps = 56/266 (21%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            +E D   L R +D  H   + Y A+LFYASWCPFSR  +P    ++S+ P + H  +E S
Sbjct  56   LEVDGDYLDRVMDSNH--GNGYKAVLFYASWCPFSRAVRPKIDALASMFPQIEHLVVEHS  113

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTG----------AET  570
               PS  S+YG+  FP++ L++ + + RY G + L SLV FY   TG           +T
Sbjct  114  QALPSVFSRYGIHSFPSILLVHQSSKVRYLGEKDLASLVQFYEKTTGLHPVHYVTDVEQT  173

Query  569  SSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYV  390
            SS  + SL       NK    GS       SW    +  L +E+YL  A  F+L++L  +
Sbjct  174  SSDTDGSL-------NKWLSNGS-------SW----REILTRESYLVFALLFLLVKLGIL  215

Query  389  IFPAVCRFSRASRRCILNLRTRSSWEYPQL---CPSRAVQFFNSL------------KEP  255
            + P          R +L ++   +   P+L        +Q F                  
Sbjct  216  VIP----------RVLLRVKAFCASHIPKLNLGIIGETIQLFGCALHMIDVGRIWMKTRL  265

Query  254  CKRSNLQEGAMNAKAWASKSLASVSI  177
             K  N  E A NA+AWAS SLASVS+
Sbjct  266  TKTRNFHERAKNARAWAS-SLASVSL  290



>ref|XP_010420552.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010420553.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010420554.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
Length=289

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 117/255 (46%), Gaps = 38/255 (15%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D   L R +D  HR +  Y ++LFY   C FSR  +P F V+SS+ P + H  +E+S
Sbjct  53   IEVDGDLLDRLMDANHRNA--YTSILFYTKRCQFSRAVRPKFDVLSSMFPHIKHLVVEQS  110

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N T++ RYHG + L+ L+ FY + TG +           
Sbjct  111  QALPSVFSRYGIHSLPSILMVNQTVKVRYHGQKDLEPLIQFYKETTGLKPV---------  161

Query  539  IRCSSNKHRDGGS----EQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
                  ++ D G     E +    +W     S +    ++ Y+ L   F+ ++L  +IFP
Sbjct  162  ------QYVDEGEPTSLETDGNLITWLLNGSSVKEIAERDPYMVLTLMFLSLKLAILIFP  215

Query  380  AV-CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMN  219
             +  R        + +L      E  QL   RA+   +  +        K  N QE A N
Sbjct  216  IMGTRLKTLWAMYVPHLSLGILGETSQLF-GRALHMIDVRRLWMKLRLTKTRNFQERAKN  274

Query  218  AKAWASKSLASVSIG  174
            A       LASVS+G
Sbjct  275  A-------LASVSLG  282



>ref|XP_010420551.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X1 [Camelina 
sativa]
Length=294

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 117/255 (46%), Gaps = 38/255 (15%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D   L R +D  HR +  Y ++LFY   C FSR  +P F V+SS+ P + H  +E+S
Sbjct  58   IEVDGDLLDRLMDANHRNA--YTSILFYTKRCQFSRAVRPKFDVLSSMFPHIKHLVVEQS  115

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N T++ RYHG + L+ L+ FY + TG +           
Sbjct  116  QALPSVFSRYGIHSLPSILMVNQTVKVRYHGQKDLEPLIQFYKETTGLKPV---------  166

Query  539  IRCSSNKHRDGGS----EQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
                  ++ D G     E +    +W     S +    ++ Y+ L   F+ ++L  +IFP
Sbjct  167  ------QYVDEGEPTSLETDGNLITWLLNGSSVKEIAERDPYMVLTLMFLSLKLAILIFP  220

Query  380  AV-CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMN  219
             +  R        + +L      E  QL   RA+   +  +        K  N QE A N
Sbjct  221  IMGTRLKTLWAMYVPHLSLGILGETSQLF-GRALHMIDVRRLWMKLRLTKTRNFQERAKN  279

Query  218  AKAWASKSLASVSIG  174
            A       LASVS+G
Sbjct  280  A-------LASVSLG  287



>ref|XP_003548940.1| PREDICTED: 5'-adenylylsulfate reductase-like 7-like [Glycine 
max]
Length=160

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 76/125 (61%), Gaps = 4/125 (3%)
 Frame = -2

Query  923  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
            +++ +T ++  DE  ++  L  + R   +Y ++LFYASWCPFSRK  P F ++SS    V
Sbjct  7    RTTATTVIV--DENFVEGILSDIKRI--EYTSILFYASWCPFSRKILPQFEILSSTFLQV  62

Query  743  PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSS  564
             H  +E+S++ PS  SKYG+   P + L+N T R RYHG  +L SL++FY   TG   SS
Sbjct  63   EHLVLEKSSVLPSFFSKYGIHSLPAILLVNQTSRLRYHGPNNLLSLLEFYKRKTGFAPSS  122

Query  563  KDNIS  549
               IS
Sbjct  123  NIVIS  127



>ref|XP_010454034.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010454036.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010454037.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
Length=290

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 118/255 (46%), Gaps = 38/255 (15%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D   L R +D  HR +  Y ++LFY   C FSR  +P F V+SS+ P + H  +E+S
Sbjct  54   IEVDGDLLDRLMDANHRNA--YTSILFYTKRCQFSRAVRPKFDVLSSMFPHIKHLIVEQS  111

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N  ++ RYHG + L+SL+ FY + TG +           
Sbjct  112  QALPSVFSRYGIHSLPSILMVNQKVKVRYHGQKDLESLIQFYKETTGLKPV---------  162

Query  539  IRCSSNKHRDGGS----EQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
                  ++ D G     E +    +W     S +    ++ Y+ LA  F+ +++  +IFP
Sbjct  163  ------QYVDEGEPTSLETDGNLITWILNGSSVKEIAERDPYMVLALMFLSLKVAILIFP  216

Query  380  AV-CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMN  219
             +  R        + +L      E  QL   RA+   +  +        K  N QE A N
Sbjct  217  IMGSRLKTLWAMYVPHLSLGILGETSQLF-GRALHMIDVRRLWMKLRLTKTRNFQERAKN  275

Query  218  AKAWASKSLASVSIG  174
            A       LASVS+G
Sbjct  276  A-------LASVSLG  283



>ref|XP_010454033.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X1 [Camelina 
sativa]
Length=352

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 118/255 (46%), Gaps = 38/255 (15%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            IE D   L R +D  HR +  Y ++LFY   C FSR  +P F V+SS+ P + H  +E+S
Sbjct  116  IEVDGDLLDRLMDANHRNA--YTSILFYTKRCQFSRAVRPKFDVLSSMFPHIKHLIVEQS  173

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N  ++ RYHG + L+SL+ FY + TG +           
Sbjct  174  QALPSVFSRYGIHSLPSILMVNQKVKVRYHGQKDLESLIQFYKETTGLKPV---------  224

Query  539  IRCSSNKHRDGGS----EQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLYVIFP  381
                  ++ D G     E +    +W     S +    ++ Y+ LA  F+ +++  +IFP
Sbjct  225  ------QYVDEGEPTSLETDGNLITWILNGSSVKEIAERDPYMVLALMFLSLKVAILIFP  278

Query  380  AV-CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMN  219
             +  R        + +L      E  QL   RA+   +  +        K  N QE A N
Sbjct  279  IMGSRLKTLWAMYVPHLSLGILGETSQLF-GRALHMIDVRRLWMKLRLTKTRNFQERAKN  337

Query  218  AKAWASKSLASVSIG  174
            A       LASVS+G
Sbjct  338  A-------LASVSLG  345



>gb|KHN34690.1| 5'-adenylylsulfate reductase-like 5 [Glycine soja]
Length=200

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 107/206 (52%), Gaps = 16/206 (8%)
 Frame = -2

Query  782  PIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLV  603
            P F ++SS+ P V H A+E+S+  PS  SKYG+   P + L+N T R RYHG ++L+SLV
Sbjct  3    PEFEILSSMFPQVQHVALEQSSALPSLYSKYGIHSLPAILLVNQTSRVRYHGPKNLNSLV  62

Query  602  DFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALA  423
            +FY   TG E  +KDN  + +    SN   D  S  +        S +    +E YLAL+
Sbjct  63   EFYERNTGLE--AKDNAVVGQ---PSNFLSDEHSTMKGF------SLKEIFNREPYLALS  111

Query  422  TAFVLMRLLYVIFPAVCRFSRA---SRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPC  252
              F+ +R++  +FP +    +A   S    LNL+         L      + +  L+  C
Sbjct  112  ILFLCLRIILFVFPTIMPRLKAFWTSYASHLNLQIFGQVMERVLNVIDVKRIWTKLRL-C  170

Query  251  KRSNLQEGAMNAKAWASKSLASVSIG  174
            K  N  E   +A+ WAS SLASVS+G
Sbjct  171  KTRNFHERVRSARVWAS-SLASVSLG  195



>gb|ACF81704.1| unknown [Zea mays]
 gb|ACL53558.1| unknown [Zea mays]
 gb|AFW67287.1| hypothetical protein ZEAMMB73_867650 [Zea mays]
 gb|AFW67288.1| hypothetical protein ZEAMMB73_867650 [Zea mays]
Length=199

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 106/203 (52%), Gaps = 18/203 (9%)
 Frame = -2

Query  758  LLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTG  579
            + P V HFA+EES+  PS  S+YGV GFP + L+N T   RY GS+ L+SLVDFY + TG
Sbjct  1    MYPQVHHFAVEESSATPSLFSRYGVRGFPAILLVNETTMVRYRGSKDLNSLVDFYKETTG  60

Query  578  AETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQE-TYLALATAFVLMR  402
             +  +  ++ + +   +S           S    W RSP    + E  YL +A  F++++
Sbjct  61   LDPVAYIDVVVQQESTAS----------LSSVAPWDRSPLEMAKDEPPYLLVAVLFIILK  110

Query  401  LLYVIFPAVCRFSRA-----SRRCILNLRTRSSWEYPQLCPSRAVQFF-NSLKEPCKRSN  240
                + PA     RA      +   L +R  SS    +   +  V+   + L    + ++
Sbjct  111  AAARLVPAAMSHLRAFLAVRVQNLNLGIRRGSSQVLERALNALDVRRLCSKLGLSNRATD  170

Query  239  LQEGAMNAKAWASKSLASVSIGD  171
            L++GA NA+AWAS S ASVS+G+
Sbjct  171  LRKGASNARAWAS-SFASVSLGE  192



>ref|XP_006288371.1| hypothetical protein CARUB_v10001621mg [Capsella rubella]
 gb|EOA21269.1| hypothetical protein CARUB_v10001621mg [Capsella rubella]
Length=290

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 113/251 (45%), Gaps = 30/251 (12%)
 Frame = -2

Query  899  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  720
            +E D   L R +D  H   + Y ++LFYA  CP SR   P F V+SS+ P + H  +E+S
Sbjct  54   VEVDGDLLDRLMDANH--GNVYTSILFYAKRCPNSRAVHPKFDVLSSMFPHIKHLVVEQS  111

Query  719  AIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDK  540
               PS  S+YG+   P++ ++N  ++ RY G + L SL+ FY D TG +           
Sbjct  112  QALPSVFSRYGIHSLPSILMVNQNVKVRYQGQKDLKSLIQFYKDTTGLKPVQ--------  163

Query  539  IRCSSNKHRDGGSEQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLYVIFPAV-C  372
                 ++      E +    +W     S +    +E Y+ LA  F+ ++L  +IFP +  
Sbjct  164  ---YVDEGEPASLETDGNLITWLLNGSSVKEIAEREPYMVLALMFLALKLAILIFPIMGS  220

Query  371  RFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQEGAMNAKAW  207
            R        + +L      E  QL   RA+   +  +        K  N QE A NA   
Sbjct  221  RLKTLWALYVPHLSLGILRETSQLF-GRALHMMDVRRLWMKLRLTKTRNFQERAKNA---  276

Query  206  ASKSLASVSIG  174
                LASVS+G
Sbjct  277  ----LASVSLG  283



>gb|EMS52111.1| 5'-adenylylsulfate reductase-like 6 [Triticum urartu]
Length=263

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/234 (31%), Positives = 118/234 (50%), Gaps = 30/234 (13%)
 Frame = -2

Query  839  DYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFL  660
            +Y A+LFYASWCPFS + +PIF  +SS+ P + H A+E+S + P+ LS+YGV   P++ +
Sbjct  37   EYTAVLFYASWCPFSHRMRPIFDDLSSMYPHIKHLAVEQSNVMPTVLSRYGVRSLPSILI  96

Query  659  MNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPF  480
             + +  F    ++ L+SLV+FY  +T      +      +   +    R G + + S  +
Sbjct  97   AHESYAFWPLVAKDLNSLVNFYSAVT------ETLFDAGQEPVAYLGPRKGNTTERSTQY  150

Query  479  S--WSRSPQNFLRQETYLALATAFVLMRLLYV--------IFPAVCRFSRASRRCILNLR  330
            +  WS S    ++ E YLA +  F+ +R+           I     ++ R +   +L   
Sbjct  151  AKLWSGSVSESVKSEPYLAFSILFICLRIFLFFFPKFFACIKGLWAQYFRHANFGVLAKL  210

Query  329  TRSSWEYPQL--CPSRAVQFFNSLKEPCKRSNLQEGAMNAKAWASKSLASVSIG  174
            T       QL  C   AV     +++   +  L  GA+N + WAS SLASVS+G
Sbjct  211  T-------QLLECVPHAVD----VRKMWSKWRLMVGAINMRVWAS-SLASVSLG  252



>ref|XP_010492806.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X1 [Camelina 
sativa]
Length=294

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/263 (29%), Positives = 118/263 (45%), Gaps = 38/263 (14%)
 Frame = -2

Query  923  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
            +S   T  +E D   L R +D  H     Y ++LFY   C FSR  +P F V+SS+ P +
Sbjct  50   RSLYPTPPLEVDGDLLDRLMDANH--GFTYTSILFYTKRCQFSRAVRPKFDVLSSMFPHI  107

Query  743  PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSS  564
             H  +E+S   PS  S+YG+   P++ ++N  ++ RYHG + L+ LV FY + TG +   
Sbjct  108  KHLVVEQSQALPSVFSRYGIHSLPSILMVNQAVKVRYHGQKDLECLVQFYKETTGLKPI-  166

Query  563  KDNISLDKIRCSSNKHRDGGS----EQESCPFSW---SRSPQNFLRQETYLALATAFVLM  405
                          ++ D G     E +    +W     S +    ++ Y+ LA  F+ +
Sbjct  167  --------------QYIDEGEPTSLETDGDLITWLLNGSSVKEIAERDPYMVLALMFLSL  212

Query  404  RLLYVIFPAV-CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRS  243
            +L  +IFP +  R        + +L      E  QL   RA+   +  +        K  
Sbjct  213  KLAILIFPIMGSRLKTLWAMYVPHLSLGILGETSQLF-GRALHMIDVRRLWMKLRLTKTR  271

Query  242  NLQEGAMNAKAWASKSLASVSIG  174
            N QE A NA       LASVS+G
Sbjct  272  NFQERAKNA-------LASVSLG  287



>emb|CDX70796.1| BnaC03g08800D [Brassica napus]
Length=281

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 118/259 (46%), Gaps = 54/259 (21%)
 Frame = -2

Query  896  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEESA  717
            E D   L R +D  H   + Y ++LFY+ WCPFS   +P F  +SS+ P + H  +E+S 
Sbjct  52   EVDGDLLDRLMDS-HNHGNAYTSILFYSPWCPFSSLVRPKFEALSSMFPHIGHLVVEQSQ  110

Query  716  IKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSSKDNISLDKI  537
              PS  S+YG+   P++ ++N T++ RY G + L SL+ FY   TG +        +D+ 
Sbjct  111  ALPSVFSRYGIHSLPSILMVNQTLKMRYIGPKDLASLIQFYQHTTGLKPVQY----VDEA  166

Query  536  RCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVLMRLLYVIFPAVCRFSRA  357
              +  K    GS           S +    ++ YL LA  F+ ++L  +IFP        
Sbjct  167  EPNLIKWLHNGS-----------SIREIAERDPYLVLALMFLSLKLAILIFP--------  207

Query  356  SRRCILNLRTRSSW-------------EYPQLCPSRAVQFFNS----LKEPCKRS-NLQE  231
                I+  R R+ W             E  QL   RA+   +     +K+   ++ + QE
Sbjct  208  ----IMGARLRTLWAAHVPHLSLGILGETSQLF-GRALHMIDVRRLWIKQRLNKTRDFQE  262

Query  230  GAMNAKAWASKSLASVSIG  174
             A NA       LASVS+G
Sbjct  263  RAKNA-------LASVSLG  274



>ref|XP_010492807.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010492808.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010492809.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010492810.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010492811.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
Length=289

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 119/259 (46%), Gaps = 30/259 (12%)
 Frame = -2

Query  923  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  744
            +S   T  +E D   L R +D  H     Y ++LFY   C FSR  +P F V+SS+ P +
Sbjct  45   RSLYPTPPLEVDGDLLDRLMDANH--GFTYTSILFYTKRCQFSRAVRPKFDVLSSMFPHI  102

Query  743  PHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGDLTGAETSS  564
             H  +E+S   PS  S+YG+   P++ ++N  ++ RYHG + L+ LV FY + TG     
Sbjct  103  KHLVVEQSQALPSVFSRYGIHSLPSILMVNQAVKVRYHGQKDLECLVQFYKETTGL----  158

Query  563  KDNISLDKIRCSSNKHRDGGSEQESCPFSW---SRSPQNFLRQETYLALATAFVLMRLLY  393
            K    +D+   +S        E +    +W     S +    ++ Y+ LA  F+ ++L  
Sbjct  159  KPIQYIDEGEPTS-------LETDGDLITWLLNGSSVKEIAERDPYMVLALMFLSLKLAI  211

Query  392  VIFPAV-CRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLK-----EPCKRSNLQE  231
            +IFP +  R        + +L      E  QL   RA+   +  +        K  N QE
Sbjct  212  LIFPIMGSRLKTLWAMYVPHLSLGILGETSQLF-GRALHMIDVRRLWMKLRLTKTRNFQE  270

Query  230  GAMNAKAWASKSLASVSIG  174
             A NA       LASVS+G
Sbjct  271  RAKNA-------LASVSLG  282



>ref|XP_002443304.1| hypothetical protein SORBIDRAFT_08g017260 [Sorghum bicolor]
 gb|EES17142.1| hypothetical protein SORBIDRAFT_08g017260 [Sorghum bicolor]
Length=299

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 122/258 (47%), Gaps = 27/258 (10%)
 Frame = -2

Query  947  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  768
            ++C +     S    V+ G+E  L R LD       ++ A+LFYASWCPFS++ +P+F  
Sbjct  53   ASCPVSTEGYSPPEEVVNGEE--LLRMLD----SKEEHTAVLFYASWCPFSQRIRPVFDD  106

Query  767  VSSLLPWVPHFAIEESAIKPSTLSKYGVIGFPTLFLMNSTMRFRYHGSRSLDSLVDFYGD  588
            +SS+ P V H A+EES I  + LS+Y V   P++ +  S+  F   GS+ LDSLV+ Y  
Sbjct  107  LSSMFPRVKHVAVEESNIVKAILSRYHVRALPSIIIARSSYVFWPLGSKDLDSLVNLYTT  166

Query  587  LTGAETSSKDNISLDKIRCSSNKHRDGGSEQESCPFSWSRSPQNFLRQETYLALATAFVL  408
             TG E  +     +   + S+ +  D           W+ S    +++E YLA +  F+ 
Sbjct  167  ATGQEPVAY----IGTRKWSAARSTDYAK-------IWNSSISETVKREPYLAFSILFIC  215

Query  407  MRLLYVIFPAVCRFSRASRRCILNLRTRSSWEYPQLCPSRAVQFFNSLKEPCKRSNLQEG  228
            +R        +  F       ++       +E   L     +     +++   +  L  G
Sbjct  216  LR--------IFFFFFPKFFALIQDFWTEYYEQSNLGILAKLTHAVDVRKVWSKLRLMVG  267

Query  227  AMNAKAWASKSLASVSIG  174
            A N + WA  SLASVS+G
Sbjct  268  AKNGRIWA--SLASVSLG  283



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3031982759680