BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5701

Length=1012
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624918.1|  PREDICTED: uncharacterized protein LOC104115...    294   7e-95   Nicotiana tomentosiformis
ref|XP_009796422.1|  PREDICTED: uncharacterized protein LOC104243006    293   2e-94   Nicotiana sylvestris
ref|XP_009624919.1|  PREDICTED: uncharacterized protein LOC104115...    289   5e-93   Nicotiana tomentosiformis
ref|XP_006356360.1|  PREDICTED: uncharacterized protein LOC102590911    287   3e-92   Solanum tuberosum [potatoes]
ref|XP_004250890.1|  PREDICTED: uncharacterized protein LOC101260106    283   2e-90   Solanum lycopersicum
ref|XP_009592376.1|  PREDICTED: uncharacterized protein LOC104089233    276   1e-87   Nicotiana tomentosiformis
ref|XP_009790732.1|  PREDICTED: uncharacterized protein LOC104238...    271   6e-86   Nicotiana sylvestris
ref|XP_007015289.1|  RING/U-box superfamily protein isoform 1           262   1e-82   
gb|KHG17577.1|  Protein SCAF11                                          262   2e-82   Gossypium arboreum [tree cotton]
ref|XP_006362753.1|  PREDICTED: uncharacterized protein LOC102579503    262   3e-82   Solanum tuberosum [potatoes]
gb|EYU35944.1|  hypothetical protein MIMGU_mgv1a011982mg                259   4e-81   Erythranthe guttata [common monkey flower]
ref|XP_007015290.1|  RING/U-box superfamily protein isoform 2           258   8e-81   
ref|XP_012065903.1|  PREDICTED: uncharacterized protein LOC105628995    255   1e-79   Jatropha curcas
gb|KJB83578.1|  hypothetical protein B456_013G253900                    254   2e-79   Gossypium raimondii
gb|KHN28150.1|  hypothetical protein glysoja_023968                     248   1e-76   Glycine soja [wild soybean]
ref|NP_001242587.1|  uncharacterized protein LOC100777135               247   1e-76   
ref|XP_009790741.1|  PREDICTED: uncharacterized protein LOC104238...    244   5e-76   Nicotiana sylvestris
emb|CDP14460.1|  unnamed protein product                                246   1e-75   Coffea canephora [robusta coffee]
ref|XP_007146324.1|  hypothetical protein PHAVU_006G030700g             243   2e-75   Phaseolus vulgaris [French bean]
ref|XP_006446281.1|  hypothetical protein CICLE_v10016417mg             243   5e-75   Citrus clementina [clementine]
gb|KDO54836.1|  hypothetical protein CISIN_1g025685mg                   243   5e-75   Citrus sinensis [apfelsine]
ref|XP_004228498.1|  PREDICTED: uncharacterized protein LOC101258982    242   9e-75   Solanum lycopersicum
ref|XP_006470558.1|  PREDICTED: uncharacterized protein LOC102609827    239   2e-73   Citrus sinensis [apfelsine]
ref|XP_008227622.1|  PREDICTED: uncharacterized protein LOC103327113    238   3e-73   Prunus mume [ume]
ref|XP_002299981.2|  hypothetical protein POPTR_0001s28270g             238   4e-73   
gb|KDO54835.1|  hypothetical protein CISIN_1g025685mg                   236   2e-72   Citrus sinensis [apfelsine]
ref|XP_003556822.1|  PREDICTED: uncharacterized protein LOC100785472    236   2e-72   Glycine max [soybeans]
gb|ACU23925.1|  unknown                                                 236   2e-72   Glycine max [soybeans]
ref|XP_007213836.1|  hypothetical protein PRUPE_ppa010547mg             235   7e-72   Prunus persica
ref|XP_011009127.1|  PREDICTED: uncharacterized protein LOC105114310    231   2e-70   Populus euphratica
ref|XP_011004228.1|  PREDICTED: uncharacterized protein LOC105110764    231   2e-70   Populus euphratica
gb|AFK39748.1|  unknown                                                 231   2e-70   Medicago truncatula
ref|XP_002530900.1|  protein binding protein, putative                  230   9e-70   Ricinus communis
ref|XP_011090171.1|  PREDICTED: uncharacterized protein LOC105170929    228   3e-69   Sesamum indicum [beniseed]
ref|XP_011080406.1|  PREDICTED: uncharacterized protein LOC105163664    228   4e-69   Sesamum indicum [beniseed]
ref|XP_004291737.1|  PREDICTED: uncharacterized protein LOC101305336    228   4e-69   Fragaria vesca subsp. vesca
ref|XP_009349039.1|  PREDICTED: uncharacterized protein LOC103940...    226   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_008803341.1|  PREDICTED: uncharacterized protein LOC103716...    226   3e-68   Phoenix dactylifera
ref|XP_008344988.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...    225   4e-68   
ref|XP_009349038.1|  PREDICTED: uncharacterized protein LOC103940...    224   9e-68   Pyrus x bretschneideri [bai li]
ref|XP_011024967.1|  PREDICTED: E3 ubiquitin-protein ligase RHF1A...    224   1e-67   Populus euphratica
ref|XP_009400091.1|  PREDICTED: uncharacterized protein LOC103984324    223   4e-67   
ref|XP_004513944.1|  PREDICTED: uncharacterized protein LOC101496...    222   9e-67   
ref|XP_009340141.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...    221   1e-66   
ref|XP_009337048.1|  PREDICTED: uncharacterized protein LOC103929558    221   1e-66   Pyrus x bretschneideri [bai li]
ref|XP_002280104.1|  PREDICTED: uncharacterized protein LOC100260248    221   2e-66   Vitis vinifera
gb|EEE56020.1|  hypothetical protein OsJ_04797                          221   5e-66   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB64711.1|  RING finger-like protein                               219   2e-65   Oryza sativa Japonica Group [Japonica rice]
gb|KJB35685.1|  hypothetical protein B456_006G124000                    218   2e-65   Gossypium raimondii
ref|XP_010926978.1|  PREDICTED: uncharacterized protein LOC105049116    218   2e-65   Elaeis guineensis
ref|XP_008356335.1|  PREDICTED: uncharacterized protein LOC103420049    218   3e-65   
ref|XP_010045057.1|  PREDICTED: uncharacterized protein LOC104433874    217   6e-65   Eucalyptus grandis [rose gum]
gb|KHG12965.1|  Protein SCAF11                                          217   8e-65   Gossypium arboreum [tree cotton]
ref|XP_006645378.1|  PREDICTED: uncharacterized protein LOC102722445    217   2e-64   Oryza brachyantha
ref|XP_010938563.1|  PREDICTED: uncharacterized protein LOC105057609    214   6e-64   Elaeis guineensis
ref|XP_008782014.1|  PREDICTED: uncharacterized protein LOC103701648    214   1e-63   Phoenix dactylifera
gb|AFK37549.1|  unknown                                                 212   7e-63   Lotus japonicus
ref|XP_004971302.1|  PREDICTED: uncharacterized protein LOC101754108    209   1e-61   Setaria italica
ref|XP_008449663.1|  PREDICTED: uncharacterized protein LOC103491...    209   2e-61   
ref|XP_006399746.1|  hypothetical protein EUTSA_v10014482mg             208   2e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010673753.1|  PREDICTED: uncharacterized protein LOC104890082    207   9e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008449664.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...    206   1e-60   
ref|XP_011657615.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...    206   1e-60   Cucumis sativus [cucumbers]
ref|XP_002456950.1|  hypothetical protein SORBIDRAFT_03g046160          207   1e-60   Sorghum bicolor [broomcorn]
ref|XP_004140197.1|  PREDICTED: uncharacterized protein LOC101206...    206   2e-60   Cucumis sativus [cucumbers]
ref|XP_006400503.1|  hypothetical protein EUTSA_v10014461mg             206   2e-60   Eutrema salsugineum [saltwater cress]
ref|NP_001148564.1|  LOC100282180                                       204   1e-59   Zea mays [maize]
emb|CDX70877.1|  BnaC03g09610D                                          204   1e-59   
ref|XP_002873563.1|  zinc finger family protein                         203   2e-59   
emb|CDX88890.1|  BnaA03g07590D                                          202   5e-59   
ref|NP_568264.1|  RING/U-box superfamily protein                        201   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419820.1|  PREDICTED: uncharacterized protein LOC104705504    201   2e-58   Camelina sativa [gold-of-pleasure]
dbj|BAK01918.1|  predicted protein                                      202   2e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010453296.1|  PREDICTED: uncharacterized protein LOC104735246    200   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010491989.1|  PREDICTED: uncharacterized protein LOC104769470    198   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009131737.1|  PREDICTED: uncharacterized protein LOC103856380    198   1e-57   Brassica rapa
ref|NP_568374.1|  RING/U-box domain-containing protein                  197   3e-57   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86745.1|  predicted protein                                      199   3e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006286547.1|  hypothetical protein CARUB_v10001792mg             197   4e-57   Capsella rubella
emb|CDX78482.1|  BnaA03g03940D                                          197   5e-57   
ref|XP_002871884.1|  zinc finger family protein                         197   6e-57   
ref|XP_009131277.1|  PREDICTED: uncharacterized protein LOC103855973    196   1e-56   Brassica rapa
emb|CDM86606.1|  unnamed protein product                                196   2e-56   Triticum aestivum [Canadian hard winter wheat]
emb|CDX70471.1|  BnaC03g05550D                                          195   3e-56   
ref|XP_003565098.2|  PREDICTED: uncharacterized protein LOC100841314    197   5e-56   
tpg|DAA55776.1|  TPA: putative RING zinc finger domain superfamil...    195   6e-56   
gb|KFK25505.1|  hypothetical protein AALP_AA8G123400                    194   7e-56   Arabis alpina [alpine rockcress]
ref|XP_009121860.1|  PREDICTED: uncharacterized protein LOC103846649    194   1e-55   Brassica rapa
ref|XP_010493004.1|  PREDICTED: uncharacterized protein LOC104770302    193   2e-55   Camelina sativa [gold-of-pleasure]
emb|CDX70467.1|  BnaC03g05510D                                          193   2e-55   
ref|XP_010420744.1|  PREDICTED: uncharacterized protein LOC104706267    193   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010555026.1|  PREDICTED: uncharacterized protein LOC104824623    191   5e-55   Tarenaya hassleriana [spider flower]
ref|XP_010454216.1|  PREDICTED: uncharacterized protein LOC104736...    190   2e-54   Camelina sativa [gold-of-pleasure]
emb|CDX97183.1|  BnaC09g44420D                                          190   3e-54   
gb|EYU46200.1|  hypothetical protein MIMGU_mgv1a013031mg                188   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_006288184.1|  hypothetical protein CARUB_v10001420mg             191   1e-53   
ref|XP_010454215.1|  PREDICTED: uncharacterized protein LOC104736...    188   1e-53   Camelina sativa [gold-of-pleasure]
ref|NP_001190339.1|  RING/U-box domain-containing protein               184   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26206.1|  hypothetical protein AALP_AA8G216300                    184   4e-52   Arabis alpina [alpine rockcress]
ref|XP_010248257.1|  PREDICTED: uncharacterized protein LOC104591167    176   8e-50   Nelumbo nucifera [Indian lotus]
ref|XP_008803342.1|  PREDICTED: uncharacterized protein LOC103716...    176   1e-49   
ref|XP_006827514.1|  PREDICTED: uncharacterized protein LOC18422960     175   5e-49   Amborella trichopoda
ref|XP_006399745.1|  hypothetical protein EUTSA_v10014482mg             174   6e-49   
gb|KDO54837.1|  hypothetical protein CISIN_1g025685mg                   174   7e-49   Citrus sinensis [apfelsine]
ref|XP_009340142.1|  PREDICTED: uncharacterized protein LOC103932...    164   3e-45   
gb|ABK22142.1|  unknown                                                 165   8e-45   Picea sitchensis
gb|EPS60559.1|  hypothetical protein M569_14245                         160   9e-44   Genlisea aurea
gb|KCW87218.1|  hypothetical protein EUGRSUZ_B03731                     157   1e-42   Eucalyptus grandis [rose gum]
gb|EMT03322.1|  hypothetical protein F775_30097                         157   4e-42   
gb|AIA26132.1|  ring finger-like protein                                154   4e-42   Phyllostachys edulis [kikko-chiku]
gb|AIA26130.1|  ring finger-like protein                                152   2e-41   Phyllostachys nigra var. henonis
gb|AIA26131.1|  ring finger-like protein                                152   3e-41   Phyllostachys nidularia [broom bamboo]
gb|AIA26125.1|  ring finger-like protein                                152   3e-41   Fargesia spathacea [umbrella bamboo]
gb|EMS60622.1|  hypothetical protein TRIUR3_12364                       154   8e-41   Triticum urartu
ref|XP_002987496.1|  hypothetical protein SELMODRAFT_446999             154   1e-40   Selaginella moellendorffii
ref|XP_001783242.1|  predicted protein                                  152   2e-40   
ref|XP_002992803.1|  hypothetical protein SELMODRAFT_448908             154   2e-40   Selaginella moellendorffii
ref|XP_010097998.1|  hypothetical protein L484_001486                   146   8e-38   
ref|XP_002947166.1|  hypothetical protein VOLCADRAFT_103400             131   9e-32   Volvox carteri f. nagariensis
ref|XP_010097999.1|  hypothetical protein L484_001487                   119   5e-28   
ref|XP_001699127.1|  hypothetical protein CHLREDRAFT_95886              111   3e-26   Chlamydomonas reinhardtii
ref|XP_005849394.1|  hypothetical protein CHLNCDRAFT_143887             116   4e-26   Chlorella variabilis
ref|XP_006379115.1|  hypothetical protein POPTR_0009s07480g             116   6e-26   
gb|EAY77270.1|  hypothetical protein OsI_05243                          109   8e-25   Oryza sativa Indica Group [Indian rice]
gb|KDO54834.1|  hypothetical protein CISIN_1g025685mg                   110   9e-25   Citrus sinensis [apfelsine]
dbj|BAK05709.1|  predicted protein                                      115   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007146325.1|  hypothetical protein PHAVU_006G030800g             104   2e-23   Phaseolus vulgaris [French bean]
gb|KDO54839.1|  hypothetical protein CISIN_1g025685mg                   102   1e-22   Citrus sinensis [apfelsine]
emb|CDP20833.1|  unnamed protein product                                107   1e-22   Coffea canephora [robusta coffee]
ref|XP_005648124.1|  hypothetical protein COCSUDRAFT_15265            97.1    5e-21   Coccomyxa subellipsoidea C-169
ref|XP_005769571.1|  hypothetical protein EMIHUDRAFT_470326           87.8    2e-16   Emiliania huxleyi CCMP1516
gb|KDO54838.1|  hypothetical protein CISIN_1g025685mg                 85.1    2e-16   Citrus sinensis [apfelsine]
ref|XP_011396423.1|  Protein SCAF11                                   81.6    6e-15   Auxenochlorella protothecoides
ref|XP_003054864.1|  predicted protein                                84.7    7e-15   Micromonas pusilla CCMP1545
tpg|DAA55777.1|  TPA: putative RING zinc finger domain superfamil...  69.7    4e-11   
gb|ACN35218.1|  unknown                                               69.7    5e-11   Zea mays [maize]
emb|CEF99954.1|  Zinc finger, RING/FYVE/PHD-type                      70.9    1e-10   Ostreococcus tauri
tpg|DAA55775.1|  TPA: putative RING zinc finger domain superfamil...  70.5    2e-10   
ref|XP_001420848.1|  predicted protein                                69.3    4e-10   Ostreococcus lucimarinus CCE9901
gb|KDD72042.1|  hypothetical protein H632_c3960p0                     64.3    4e-09   Helicosporidium sp. ATCC 50920
ref|XP_005769873.1|  hypothetical protein EMIHUDRAFT_451415           67.0    6e-09   Emiliania huxleyi CCMP1516
ref|XP_004365935.1|  hypothetical protein CAOG_01064                  62.0    2e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_006379116.1|  hypothetical protein POPTR_0009s07490g           58.2    3e-07   
ref|XP_010482836.1|  PREDICTED: uncharacterized protein LOC104761...  57.0    7e-07   Camelina sativa [gold-of-pleasure]
ref|XP_004597936.1|  PREDICTED: protein SCAF11                        59.3    3e-06   
ref|XP_007512089.1|  unknown protein                                  57.8    7e-06   Bathycoccus prasinos
gb|EHL03248.1|  hypothetical protein M7I_0683                         54.3    4e-05   Glarea lozoyensis 74030
ref|XP_009687468.1|  PREDICTED: LOW QUALITY PROTEIN: protein SCAF11   55.5    5e-05   Struthio camelus australis
gb|KIY99316.1|  hypothetical protein MNEG_8649                        54.7    6e-05   Monoraphidium neglectum
ref|XP_010482835.1|  PREDICTED: uncharacterized protein LOC104761...  51.6    8e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006489137.1|  PREDICTED: E3 ubiquitin-protein ligase Topor...  53.5    1e-04   Citrus sinensis [apfelsine]
ref|XP_006419647.1|  hypothetical protein CICLE_v10005542mg           53.5    1e-04   Citrus clementina [clementine]
ref|XP_006476564.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  51.2    1e-04   Citrus sinensis [apfelsine]
ref|XP_010004590.1|  PREDICTED: protein SCAF11                        54.3    1e-04   Chaetura pelagica
ref|XP_009075429.1|  PREDICTED: protein SCAF11                        53.9    1e-04   Acanthisitta chloris
gb|ACN36095.1|  unknown                                               51.2    2e-04   Zea mays [maize]
ref|XP_010188928.1|  PREDICTED: protein SCAF11                        53.5    2e-04   Mesitornis unicolor
ref|XP_002124973.1|  PREDICTED: protein SCAF11                        53.5    2e-04   Ciona intestinalis [sea vase]
ref|XP_010222545.1|  PREDICTED: protein SCAF11                        53.5    2e-04   Tinamus guttatus
ref|XP_010250551.1|  PREDICTED: E3 ubiquitin-protein ligase Topors    52.4    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008083170.1|  RING/U-box                                       52.8    2e-04   Glarea lozoyensis ATCC 20868
ref|XP_009464423.1|  PREDICTED: protein SCAF11                        53.5    2e-04   Nipponia nippon
gb|EOB08370.1|  SFRS2-interacting protein                             53.5    3e-04   Anas platyrhynchos [duck]
ref|XP_002630911.1|  Hypothetical protein CBG02635                    53.1    3e-04   Caenorhabditis briggsae
ref|XP_007238014.1|  PREDICTED: protein SCAF11 isoform X2             53.1    3e-04   
ref|XP_006439544.1|  hypothetical protein CICLE_v10023541mg           50.1    3e-04   Citrus clementina [clementine]
ref|XP_003771424.1|  PREDICTED: protein SCAF11                        53.1    3e-04   
ref|XP_005010007.1|  PREDICTED: protein SCAF11 isoform X2             53.1    3e-04   
emb|CAP23915.2|  Protein CBG02635                                     53.1    3e-04   Caenorhabditis briggsae
ref|XP_005010006.1|  PREDICTED: protein SCAF11 isoform X1             53.1    3e-04   
ref|XP_007238013.1|  PREDICTED: protein SCAF11 isoform X1             53.1    3e-04   
ref|XP_009325873.1|  PREDICTED: protein SCAF11                        53.1    3e-04   Pygoscelis adeliae
ref|XP_009284482.1|  PREDICTED: protein SCAF11 isoform X2             53.1    3e-04   Aptenodytes forsteri
ref|XP_009284481.1|  PREDICTED: protein SCAF11 isoform X1             53.1    3e-04   Aptenodytes forsteri
ref|XP_005010008.1|  PREDICTED: protein SCAF11 isoform X3             53.1    3e-04   
ref|XP_005519354.1|  PREDICTED: protein SCAF11                        53.1    3e-04   
ref|XP_009093333.1|  PREDICTED: protein SCAF11                        52.8    3e-04   
ref|XP_002194545.2|  PREDICTED: protein SCAF11                        52.8    4e-04   
ref|XP_005419312.1|  PREDICTED: protein SCAF11                        52.8    4e-04   Geospiza fortis
ref|XP_008924795.1|  PREDICTED: protein SCAF11                        52.8    4e-04   
ref|XP_005480595.1|  PREDICTED: protein SCAF11                        52.8    4e-04   Zonotrichia albicollis
ref|XP_008493961.1|  PREDICTED: protein SCAF11                        52.8    4e-04   Calypte anna
ref|XP_003292173.1|  hypothetical protein DICPUDRAFT_82806            52.0    4e-04   Dictyostelium purpureum
ref|XP_003724412.1|  PREDICTED: E3 ubiquitin-protein ligase Topor...  52.4    5e-04   Strongylocentrotus purpuratus [purple urchin]
gb|EJY85929.1|  RING/U-box protein                                    52.4    5e-04   Oxytricha trifallax
ref|XP_005039403.1|  PREDICTED: protein SCAF11 isoform X1             52.4    5e-04   
gb|EAY77269.1|  hypothetical protein OsI_05242                        49.3    5e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_007524701.1|  PREDICTED: protein SCAF11                        52.4    5e-04   Erinaceus europaeus [common hedgehog]
ref|XP_010411913.1|  PREDICTED: protein SCAF11 isoform X2             52.4    6e-04   
ref|XP_010411914.1|  PREDICTED: protein SCAF11 isoform X3             52.4    6e-04   
ref|XP_008630993.1|  PREDICTED: protein SCAF11                        52.4    6e-04   
ref|XP_010411912.1|  PREDICTED: protein SCAF11 isoform X1             52.4    6e-04   
gb|KDO75096.1|  hypothetical protein CISIN_1g046606mg                 50.8    6e-04   Citrus sinensis [apfelsine]
ref|XP_010411916.1|  PREDICTED: protein SCAF11 isoform X5             52.4    6e-04   
ref|XP_003793682.1|  PREDICTED: protein SCAF11                        52.0    6e-04   
ref|XP_003476129.2|  PREDICTED: protein SCAF11                        52.0    6e-04   Cavia porcellus [guinea pig]
ref|XP_007503941.1|  PREDICTED: protein SCAF11 isoform X1             52.0    7e-04   Monodelphis domestica
ref|XP_002739463.1|  PREDICTED: E3 ubiquitin-protein ligase Topor...  52.0    7e-04   Saccoglossus kowalevskii
ref|XP_007503942.1|  PREDICTED: protein SCAF11 isoform X2             52.0    7e-04   
ref|XP_008839536.1|  PREDICTED: protein SCAF11 isoform X2             52.0    7e-04   Nannospalax galili
ref|XP_008839535.1|  PREDICTED: protein SCAF11 isoform X1             52.0    8e-04   Nannospalax galili
ref|NP_001182499.1|  SFRS2-interacting protein                        51.6    0.001   Gallus gallus [bantam]
ref|XP_004206190.1|  PREDICTED: uncharacterized protein LOC100204904  51.6    0.001   
ref|XP_004335241.1|  zinc finger, C3HC4 type (RING finger) domain...  51.2    0.001   Acanthamoeba castellanii str. Neff



>ref|XP_009624918.1| PREDICTED: uncharacterized protein LOC104115903 isoform X1 [Nicotiana 
tomentosiformis]
Length=247

 Score =   294 bits (752),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 177/219 (81%), Gaps = 4/219 (2%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            MAT  E    QLVN++QDLSI  Q KMKSTAEE  RVGCEN+HHG+CAICLNKI+L+ETA
Sbjct  1    MATVVEFECQQLVNELQDLSIEPQKKMKSTAEETHRVGCENNHHGICAICLNKIMLEETA  60

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF+F+ IHRALDGS+ DYMFEESVCLLLR
Sbjct  61   LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFDFIYIHRALDGSLRDYMFEESVCLLLR  120

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            ASWF+PL  + E+    +   D      +E+EED  ++ +  SSS +R+GNRRWGDNGYV
Sbjct  121  ASWFKPL--IVEERAEVNDDMDDLYMYDYEEEEDLAEDYFVSSSSRLRIGNRRWGDNGYV  178

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEPS--KEIMG  334
             AGRQEARPV RPN ++S AGPSR+PKKKE +  KE++G
Sbjct  179  SAGRQEARPVYRPNSQESSAGPSREPKKKEDAVPKELVG  217



>ref|XP_009796422.1| PREDICTED: uncharacterized protein LOC104243006 [Nicotiana sylvestris]
Length=246

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 176/218 (81%), Gaps = 3/218 (1%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            MAT  E   PQLVN +QDL++  Q+KMKSTAEE  RVGCEN+HHG+CAICLNKIVL+ETA
Sbjct  1    MATVVEFEFPQLVNDLQDLTVEPQNKMKSTAEETHRVGCENNHHGICAICLNKIVLEETA  60

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEF+ IHR LDGS+ DYMFEESVCLLLR
Sbjct  61   LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFVYIHRTLDGSLQDYMFEESVCLLLR  120

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            ASWF+PL  + E+    D   D      +E+EED  ++ +  SSS +R+GNRRWGDNGYV
Sbjct  121  ASWFKPL--IVEERAEVDDDMDDLYMYDYEEEEDLAEDYFVSSSSRLRIGNRRWGDNGYV  178

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEP-SKEIMG  334
             AGRQEARPV RPN ++S AGPSR+PKK++   KE++G
Sbjct  179  SAGRQEARPVYRPNSQESGAGPSREPKKEDAVPKELVG  216



>ref|XP_009624919.1| PREDICTED: uncharacterized protein LOC104115903 isoform X2 [Nicotiana 
tomentosiformis]
Length=246

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 177/219 (81%), Gaps = 5/219 (2%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            MAT  E    QLVN++QDLSI  Q KMKSTAEE  RVGCEN+HHG+CAICLNKI+L+ETA
Sbjct  1    MATVVEFECQQLVNELQDLSIEPQ-KMKSTAEETHRVGCENNHHGICAICLNKIMLEETA  59

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF+F+ IHRALDGS+ DYMFEESVCLLLR
Sbjct  60   LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFDFIYIHRALDGSLRDYMFEESVCLLLR  119

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            ASWF+PL  + E+    +   D      +E+EED  ++ +  SSS +R+GNRRWGDNGYV
Sbjct  120  ASWFKPL--IVEERAEVNDDMDDLYMYDYEEEEDLAEDYFVSSSSRLRIGNRRWGDNGYV  177

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEPS--KEIMG  334
             AGRQEARPV RPN ++S AGPSR+PKKKE +  KE++G
Sbjct  178  SAGRQEARPVYRPNSQESSAGPSREPKKKEDAVPKELVG  216



>ref|XP_006356360.1| PREDICTED: uncharacterized protein LOC102590911 [Solanum tuberosum]
Length=245

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 172/218 (79%), Gaps = 4/218 (2%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            MAT  E   PQLVN IQDL I  Q+KMKST EE  RVGCEN+HHG+CA+CLNKIVLQETA
Sbjct  1    MATVVEFESPQLVNDIQDLFIEPQNKMKSTTEETSRVGCENNHHGICAVCLNKIVLQETA  60

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATYK+EPTCPQCKHPFEFL IHR+LDGS+ DYMFEESVCLLLR
Sbjct  61   LVKGCEHAYCVTCILRWATYKEEPTCPQCKHPFEFLYIHRSLDGSLQDYMFEESVCLLLR  120

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            ASWF+PL     + + +   D   LY   + ++D  ++ +  SSS +R+GNRRWGDNGYV
Sbjct  121  ASWFKPL---IVEEKTEIDDDMDDLYMYDDADDDFTEDYFISSSSRLRIGNRRWGDNGYV  177

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEP-SKEIMG  334
             AGRQEARPV RPN ++S AG SR+P K+   SKE++G
Sbjct  178  SAGRQEARPVYRPNPQESGAGSSREPNKETAGSKELVG  215



>ref|XP_004250890.1| PREDICTED: uncharacterized protein LOC101260106 [Solanum lycopersicum]
Length=245

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 170/218 (78%), Gaps = 4/218 (2%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            MAT  E   PQL N +QDL I  Q+KMKST EE  RVGCEN+HHG+CA+CLNKIVLQETA
Sbjct  1    MATVVEFESPQLFNDMQDLFIEPQNKMKSTTEETSRVGCENNHHGICAVCLNKIVLQETA  60

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATYK+EPTCPQCKHPFEFL +HR+LDGS+ DYMFEESVCLLLR
Sbjct  61   LVKGCEHAYCVTCILRWATYKEEPTCPQCKHPFEFLYVHRSLDGSLQDYMFEESVCLLLR  120

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            ASWF+PL     + + +   D   +Y   + ++D  ++ +  SSS +R+GNRRWGDNGYV
Sbjct  121  ASWFKPL---IVEEKTEIDDDMDDMYMYDDADDDFTEDYFISSSSRLRIGNRRWGDNGYV  177

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKE-PSKEIMG  334
             AGRQEARPV RPN ++S AG SR P K+   SKE++G
Sbjct  178  SAGRQEARPVYRPNPQESGAGSSRVPNKETAASKELVG  215



>ref|XP_009592376.1| PREDICTED: uncharacterized protein LOC104089233 [Nicotiana tomentosiformis]
Length=247

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 168/221 (76%), Gaps = 8/221 (4%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            MA   E    QLVN I DLSI DQ+ MKS +EE   VGCE++HHGLCAICLNKI+LQETA
Sbjct  1    MAAVVEFEGQQLVNDILDLSIQDQTNMKSISEENHEVGCESNHHGLCAICLNKILLQETA  60

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATYKKEP CPQCKHPFEFL++HR+LDGSI DYMFEESVCLLLR
Sbjct  61   LVKGCEHAYCVTCILRWATYKKEPACPQCKHPFEFLHVHRSLDGSIQDYMFEESVCLLLR  120

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            ASWF PL       E  +  D+      +EDE+++L+  YF SSS  R+GNRRWGDNGYV
Sbjct  121  ASWFNPL----IVEEKQEVDDNMDYLYAYEDEDEELEHFYFTSSSHPRIGNRRWGDNGYV  176

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEPS----KEIMG  334
            RAGRQEA PV RPN +D  AG SRQ KKKE +    KE +G
Sbjct  177  RAGRQEATPVPRPNSQDFGAGSSRQTKKKEAAAVAPKEAVG  217



>ref|XP_009790732.1| PREDICTED: uncharacterized protein LOC104238141 isoform X1 [Nicotiana 
sylvestris]
Length=246

 Score =   271 bits (693),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 169/220 (77%), Gaps = 7/220 (3%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            MA   E    QLVN I DLSI DQ+ MKS +EE   V  E++HHG+CAICLN+IVLQETA
Sbjct  1    MAAVVEFEGQQLVNDILDLSIQDQTNMKSISEEKHEVDFESNHHGVCAICLNRIVLQETA  60

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATYKK+PTCPQCKHPFEFL+IHR+LDGSI DYMFEESVCLLLR
Sbjct  61   LVKGCEHAYCVTCILRWATYKKQPTCPQCKHPFEFLHIHRSLDGSIQDYMFEESVCLLLR  120

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            ASWF+PL       E  +  D+      +EDE+++L + YF+SSS +R+GNRRWGDNGYV
Sbjct  121  ASWFRPL----IVEEKQEVDDNMDYLYAYEDEDEELADFYFNSSSHLRIGNRRWGDNGYV  176

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEPS---KEIMG  334
            RAGRQEA PV RPN +D  AG SR+ KKKE     KE +G
Sbjct  177  RAGRQEAMPVPRPNSQDVGAGSSRRTKKKEADAAPKEAVG  216



>ref|XP_007015289.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY32908.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=240

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 165/217 (76%), Gaps = 7/217 (3%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            M +  +I   Q+VN + +LS+ DQ +MK+    V   GCEN H G+CAICL+KIVLQETA
Sbjct  1    MTSVIKIDAEQIVNALPNLSLQDQKEMKNKGA-VGEEGCEN-HSGICAICLDKIVLQETA  58

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATY K PTCPQCKHPFEFLN+HR+LDG I DYMFEESVCLLLR
Sbjct  59   LVKGCEHAYCVTCILRWATYSKMPTCPQCKHPFEFLNVHRSLDGRINDYMFEESVCLLLR  118

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            A+WF+PL       E  + + D        +E+DD DEAY+ SS S+R+GNRRWGDNGYV
Sbjct  119  AAWFEPL-----IVEDREELYDDLEDYYPYEEDDDQDEAYYASSPSLRIGNRRWGDNGYV  173

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            R+GRQEARPV R NF+DS AG SR+PKKKE +K  MG
Sbjct  174  RSGRQEARPVQRSNFQDSGAGSSREPKKKEVAKSTMG  210



>gb|KHG17577.1| Protein SCAF11 [Gossypium arboreum]
Length=246

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 177/218 (81%), Gaps = 3/218 (1%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            M +A EI   QLVN + DLSI DQ ++K     V+  GCEN H G+CAICL+KI+LQETA
Sbjct  1    MTSAVEINGEQLVNALPDLSIQDQIEVKKKGA-VVEEGCEN-HSGICAICLDKIMLQETA  58

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATY + PTCPQCKHPFEFL++HR+LDG I+DYMFEESVCLLLR
Sbjct  59   LVKGCEHAYCVTCILRWATYSQMPTCPQCKHPFEFLDVHRSLDGRIHDYMFEESVCLLLR  118

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            A+WF+PL+V+EE+ EV D ++ +Y Y  +EDE+D+ DE Y+ +S S+R+GNRRWGD+GYV
Sbjct  119  ATWFKPLIVLEEREEVYDNLESYYDYYPYEDEDDEEDEVYYTNSPSLRIGNRRWGDSGYV  178

Query  444  RAGRQEARPVNRPNFEDSD-AGPSRQPKKKEPSKEIMG  334
            R+GRQEARPV R NF+DS  AG SR+PK KE +K  MG
Sbjct  179  RSGRQEARPVQRSNFQDSTGAGSSREPKNKETTKSTMG  216



>ref|XP_006362753.1| PREDICTED: uncharacterized protein LOC102579503 [Solanum tuberosum]
Length=246

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 166/214 (78%), Gaps = 7/214 (3%)
 Frame = -2

Query  984  MATAAEIGVP--QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQE  811
            M+T  E+ +   +L+N IQD+SI +Q+++KS +EE  +V CEN++HG+CAICLNKIVLQE
Sbjct  1    MSTVVELEIEDQELLNNIQDISIGEQTEVKSNSEERYQVDCENNYHGVCAICLNKIVLQE  60

Query  810  TALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLL  631
            TALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFL+IHR+LDGSI DYMFEESVCLL
Sbjct  61   TALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLHIHRSLDGSIQDYMFEESVCLL  120

Query  630  LRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNG  451
            LRASWF+P        E  +  D       + +++++L++ +F SS S+R+GNRRWG+NG
Sbjct  121  LRASWFKPF-----VEEKQEVDDYMDFLYAYYEDDEELEDDHFTSSPSLRIGNRRWGNNG  175

Query  450  YVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPS  349
            YVR GRQEA P + PN  DS AG SRQ  K E +
Sbjct  176  YVREGRQEASPAHPPNSHDSGAGSSRQTTKNETA  209



>gb|EYU35944.1| hypothetical protein MIMGU_mgv1a011982mg [Erythranthe guttata]
Length=265

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 173/227 (76%), Gaps = 15/227 (7%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMK----STAEEVLRVGCE---------NDHHGLC  844
            M+   EI    L+  +Q L++ DQ+KMK    +  EE+ RV C+         N+HHG+C
Sbjct  1    MSAPVEIIGQNLIEDLQHLTVEDQNKMKGNCTAAVEEINRVECDANDTTNNNNNNHHGIC  60

Query  843  AICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIY  664
            AICLNKIVLQETALVKGCEHAYCV+CIL+WA+YK EPTCPQCKHPFEFLNIHRALDGSI+
Sbjct  61   AICLNKIVLQETALVKGCEHAYCVSCILKWASYKTEPTCPQCKHPFEFLNIHRALDGSIH  120

Query  663  DYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSI  484
            DYMFEESVCLLLRASWF+PLVVVE +   ++  D +Y Y+  E+E+ D +     SSSS+
Sbjct  121  DYMFEESVCLLLRASWFKPLVVVEHKVVDEEIEDYYYEYEDDEEEDLDDEVYLGGSSSSL  180

Query  483  RLGNRRWGDNGYVRAGRQEARP-VNRPNFEDSD-AGPSRQPKKKEPS  349
            R+GNRRWGDNGYVR GRQEARP V RPN +DS  AGPSR+P KK+ S
Sbjct  181  RIGNRRWGDNGYVRGGRQEARPVVYRPNLQDSSGAGPSREPNKKKES  227



>ref|XP_007015290.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY32909.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
Length=239

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 162/217 (75%), Gaps = 8/217 (4%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            M +  +I   Q+VN + +LS+ DQ      A  V   GCEN H G+CAICL+KIVLQETA
Sbjct  1    MTSVIKIDAEQIVNALPNLSLQDQEMKNKGA--VGEEGCEN-HSGICAICLDKIVLQETA  57

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCILRWATY K PTCPQCKHPFEFLN+HR+LDG I DYMFEESVCLLLR
Sbjct  58   LVKGCEHAYCVTCILRWATYSKMPTCPQCKHPFEFLNVHRSLDGRINDYMFEESVCLLLR  117

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            A+WF+PL       E  + + D        +E+DD DEAY+ SS S+R+GNRRWGDNGYV
Sbjct  118  AAWFEPL-----IVEDREELYDDLEDYYPYEEDDDQDEAYYASSPSLRIGNRRWGDNGYV  172

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            R+GRQEARPV R NF+DS AG SR+PKKKE +K  MG
Sbjct  173  RSGRQEARPVQRSNFQDSGAGSSREPKKKEVAKSTMG  209



>ref|XP_012065903.1| PREDICTED: uncharacterized protein LOC105628995 [Jatropha curcas]
 gb|KDP43239.1| hypothetical protein JCGZ_22791 [Jatropha curcas]
Length=246

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            M +   +   QL N +   SI DQ + +S  E      C N H G+CAICL+KIVLQETA
Sbjct  1    MTSLINVEAHQLTNTLAHFSIQDQVEAQSKVEANNEKSCGN-HGGVCAICLDKIVLQETA  59

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LV+GCEHAYCVTCILRWATY ++PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLR
Sbjct  60   LVRGCEHAYCVTCILRWATYSQKPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLR  119

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            A WF+PL+V E     DD    +Y Y+  +++EDDLDE Y   SS++R+GNRRWGDNGYV
Sbjct  120  APWFKPLIVEEHHNVYDDLEYYYYPYEYEDEDEDDLDEVYLSRSSNLRIGNRRWGDNGYV  179

Query  444  RAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            RAGRQEARPV+RPN +DS AGPSR+PK+KE +K+  G
Sbjct  180  RAGRQEARPVHRPNPQDSGAGPSREPKQKEAAKDRTG  216



>gb|KJB83578.1| hypothetical protein B456_013G253900 [Gossypium raimondii]
Length=246

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 176/218 (81%), Gaps = 3/218 (1%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            M +A EI   QLVN + DLSI DQ ++K     V+  GCEN H G+CAICL+KI+LQETA
Sbjct  1    MTSAVEINGEQLVNALPDLSIQDQIEVKKKGA-VVEEGCEN-HSGICAICLDKIILQETA  58

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            LVKGCEHAYCVTCIL+WATY + PTCPQCKHPFEFL++HR+LDG I+DYMFEESVCLLLR
Sbjct  59   LVKGCEHAYCVTCILQWATYSQMPTCPQCKHPFEFLDVHRSLDGRIHDYMFEESVCLLLR  118

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            A+WF+PL+V+EE+ EV D ++ +Y Y  +EDE+D+ DE Y+ +S S+R+GNRRWGD+GYV
Sbjct  119  ATWFKPLIVLEEREEVYDNLESYYDYYPYEDEDDEEDEVYYTNSPSLRIGNRRWGDSGYV  178

Query  444  RAGRQEARPVNRPNFEDSD-AGPSRQPKKKEPSKEIMG  334
            R+GRQEARPV R NF+DS  AG S +PK KE +K  +G
Sbjct  179  RSGRQEARPVQRSNFQDSTGAGSSCEPKNKETTKSTLG  216



>gb|KHN28150.1| hypothetical protein glysoja_023968 [Glycine soja]
Length=251

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 158/213 (74%), Gaps = 4/213 (2%)
 Frame = -2

Query  963  GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEH  784
            G   L N  QDLSI D S+ K T  E+ +VG    H G+CAICL+KIVLQETALVKGCEH
Sbjct  10   GEQVLTNDFQDLSIKDLSE-KGTEAEIHKVGSYGSHGGICAICLDKIVLQETALVKGCEH  68

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            AYCVTCIL WATY+++ TCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRASWF PL
Sbjct  69   AYCVTCILHWATYREKVTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRASWFTPL  128

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfD-SSSSIR-LGNRRWGDNGYVRAGRQ  430
             V E     D Y D    Y   +D++DD  +  +   SSS+R +GNRRWGDNGYVRAGRQ
Sbjct  129  SVEEHVVHEDAYEDLEDYYQYEDDDDDDDMDEVYYGGSSSLRVIGNRRWGDNGYVRAGRQ  188

Query  429  EARPVNRPNFEDSDA-GPSRQPKKKEPSKEIMG  334
            EARPV+RPNF+DS A   S +PKKKE  K I G
Sbjct  189  EARPVHRPNFQDSGASSSSHEPKKKEAGKIITG  221



>ref|NP_001242587.1| uncharacterized protein LOC100777135 [Glycine max]
 gb|ACU23961.1| unknown [Glycine max]
Length=251

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 158/213 (74%), Gaps = 4/213 (2%)
 Frame = -2

Query  963  GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEH  784
            G   L N  QDLSI D S+ K T  E+ +VG    H G+CAICL+KIVLQETALVKGCEH
Sbjct  10   GEQVLTNDFQDLSIKDLSE-KGTEAEIHKVGSYGSHGGICAICLDKIVLQETALVKGCEH  68

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            AYCVTCIL WATY+++ TCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRASWF PL
Sbjct  69   AYCVTCILHWATYREKVTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRASWFTPL  128

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfD-SSSSIR-LGNRRWGDNGYVRAGRQ  430
             V E     D Y D    Y   +D++DD  +  +   SSS+R +GNRRWGDNGYVRAGRQ
Sbjct  129  SVEEHVVHEDAYEDLEDYYQYEDDDDDDDMDEVYYGGSSSLRVIGNRRWGDNGYVRAGRQ  188

Query  429  EARPVNRPNFEDSDAG-PSRQPKKKEPSKEIMG  334
            EARPV+RPNF+DS A   S +PKKKE  K I G
Sbjct  189  EARPVHRPNFQDSGASFSSHEPKKKEAGKIITG  221



>ref|XP_009790741.1| PREDICTED: uncharacterized protein LOC104238141 isoform X2 [Nicotiana 
sylvestris]
Length=220

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 154/194 (79%), Gaps = 7/194 (4%)
 Frame = -2

Query  906  MKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTC  727
            MKS +EE   V  E++HHG+CAICLN+IVLQETALVKGCEHAYCVTCILRWATYKK+PTC
Sbjct  1    MKSISEEKHEVDFESNHHGVCAICLNRIVLQETALVKGCEHAYCVTCILRWATYKKQPTC  60

Query  726  PQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfyly  547
            PQCKHPFEFL+IHR+LDGSI DYMFEESVCLLLRASWF+PL       E  +  D+    
Sbjct  61   PQCKHPFEFLHIHRSLDGSIQDYMFEESVCLLLRASWFRPL----IVEEKQEVDDNMDYL  116

Query  546  dgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQP  367
              +EDE+++L + YF+SSS +R+GNRRWGDNGYVRAGRQEA PV RPN +D  AG SR+ 
Sbjct  117  YAYEDEDEELADFYFNSSSHLRIGNRRWGDNGYVRAGRQEAMPVPRPNSQDVGAGSSRRT  176

Query  366  KKKEPS---KEIMG  334
            KKKE     KE +G
Sbjct  177  KKKEADAAPKEAVG  190



>emb|CDP14460.1| unnamed protein product [Coffea canephora]
Length=277

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 170/226 (75%), Gaps = 25/226 (11%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKS----------TAEEVLRVGCEND--------------HHGL  847
            QL + ++DLSI DQS+M             A E+  VGCE+               H G+
Sbjct  14   QLTDSLRDLSIHDQSEMMEEEKMKGNGTYAAGEMTSVGCESSSGVADSHFDNNSPHHDGV  73

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            CAICLN I+LQETALVKGCEHAYCV CIL WA+YKKEPTCPQCK PFE LNIHR+LDGSI
Sbjct  74   CAICLNHIILQETALVKGCEHAYCVNCILHWASYKKEPTCPQCKQPFESLNIHRSLDGSI  133

Query  666  YDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSS  487
            +DYMFEESVCLLLRA+W++PL +VEE+ EV+D +  FY Y   ++EE+++DE YF  SSS
Sbjct  134  HDYMFEESVCLLLRATWYKPL-IVEERDEVEDDMGYFYSYAYEDEEEEEMDEIYFGGSSS  192

Query  486  IRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPS  349
            IR+GNRRWGDNGYVRAGRQEARP+ RPN +DS AGPSRQP+KKE +
Sbjct  193  IRIGNRRWGDNGYVRAGRQEARPIPRPNTQDSGAGPSRQPRKKETA  238



>ref|XP_007146324.1| hypothetical protein PHAVU_006G030700g [Phaseolus vulgaris]
 gb|ESW18318.1| hypothetical protein PHAVU_006G030700g [Phaseolus vulgaris]
Length=234

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 154/210 (73%), Gaps = 9/210 (4%)
 Frame = -2

Query  963  GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEH  784
            G   L N  QDLSI D S      E V+       H G+CAICL++I+LQETALVKGCEH
Sbjct  10   GEQVLTNDFQDLSIKDLS------EAVIHKVGNGTHGGICAICLDEILLQETALVKGCEH  63

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            AYCVTCILRWATY+++ TCPQCKHPFEFLNIHRALDGSI DYMFEESVCLLLRASWF+PL
Sbjct  64   AYCVTCILRWATYREKVTCPQCKHPFEFLNIHRALDGSIQDYMFEESVCLLLRASWFKPL  123

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEA  424
                 +  V        L + +  E+++++EAY+  SSS+R+GNRRWGDNGYVR GRQEA
Sbjct  124  ---SVEEHVVHEDAYEELEEYYPYEDEEMEEAYYGGSSSVRIGNRRWGDNGYVRGGRQEA  180

Query  423  RPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            RPV+R NF+DS A  SR+PKKK+  K   G
Sbjct  181  RPVHRSNFQDSGASSSREPKKKDAGKGSTG  210



>ref|XP_006446281.1| hypothetical protein CICLE_v10016417mg [Citrus clementina]
 gb|ESR59521.1| hypothetical protein CICLE_v10016417mg [Citrus clementina]
Length=247

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 163/218 (75%), Gaps = 6/218 (3%)
 Frame = -2

Query  987  VMATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            + ++ ++I   +LV  + +LSI DQ +M+S A+   R     +H G+CAICL+K VLQET
Sbjct  1    MTSSVSKIDGEELVKGLDNLSISDQGEMQSKADN--REMGFGNHGGVCAICLDKTVLQET  58

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            ALVKGCEHAYC TCILRWA+Y + PTCPQCKHPFEFL++HR+LDGSI DYMFEESVCLLL
Sbjct  59   ALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLL  118

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RA+WF+PL       +     DD      +EDEEDDLDE YF SSSS+R+GNRRWGDNGY
Sbjct  119  RATWFKPL----IVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGY  174

Query  447  VRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            VRAGRQEARPV RPN +D  A  SR+PKKKE +K   G
Sbjct  175  VRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTG  212



>gb|KDO54836.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=249

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 163/218 (75%), Gaps = 6/218 (3%)
 Frame = -2

Query  987  VMATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            + ++ ++I   +LV  + +LSI DQ +M+S A+   R     +H G+CAICL+K VLQET
Sbjct  1    MASSVSKIDGEELVKGLDNLSISDQGEMQSKADN--REMGFGNHGGVCAICLDKTVLQET  58

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            ALVKGCEHAYC TCILRWA+Y + PTCPQCKHPFEFL++HR+LDGSI DYMFEESVCLLL
Sbjct  59   ALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLL  118

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RA+WF+PL       +     DD      +EDEEDDLDE YF SSSS+R+GNRRWGDNGY
Sbjct  119  RATWFKPL----IVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGY  174

Query  447  VRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            VRAGRQEARPV RPN +D  A  SR+PKKKE +K   G
Sbjct  175  VRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTG  212



>ref|XP_004228498.1| PREDICTED: uncharacterized protein LOC101258982 [Solanum lycopersicum]
Length=238

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 159/214 (74%), Gaps = 15/214 (7%)
 Frame = -2

Query  984  MATAAEIGV--PQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQE  811
            M+T  E+ +   +L+N  QDLSI +Q++++S +EE  +V CEN++HG CAICLNKIVLQE
Sbjct  1    MSTVVELEIEGSELLNNFQDLSIGEQTEVESNSEERYQVDCENNYHGDCAICLNKIVLQE  60

Query  810  TALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLL  631
            TALVKGCEHAYCVTCILRWATYK EPTCPQCKHPFEFL+IHR+LDGSI DYMFEESVCLL
Sbjct  61   TALVKGCEHAYCVTCILRWATYKNEPTCPQCKHPFEFLHIHRSLDGSIQDYMFEESVCLL  120

Query  630  LRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNG  451
            LRASWF+P               +        +++++L++ +  SS S+R+ NRRWG+NG
Sbjct  121  LRASWFEPF-------------VEEIDDYMDYEDDEELEDFHVTSSPSLRISNRRWGNNG  167

Query  450  YVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPS  349
            YVRAGRQEA P + P+  DS AG SRQ  K E +
Sbjct  168  YVRAGRQEASPAHPPSSHDSSAGSSRQTTKNETA  201



>ref|XP_006470558.1| PREDICTED: uncharacterized protein LOC102609827 [Citrus sinensis]
Length=249

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 162/218 (74%), Gaps = 6/218 (3%)
 Frame = -2

Query  987  VMATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            + ++ ++I   +LV  + +LSI DQ +M+S A+   R     +H G+CAICL+K VLQET
Sbjct  1    MASSVSKIDGEELVKGLDNLSISDQGEMQSKADN--REMGFGNHGGVCAICLDKTVLQET  58

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            ALVKGCEHAYC TCILRWA+Y + PTCPQCKHPFEFL++HR+LDGSI DYMFEESVCLLL
Sbjct  59   ALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLL  118

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RA+WF+PL       +     DD      +EDEEDDLDE YF SSSS+R+GNRRWGDNGY
Sbjct  119  RATWFKPL----IVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGY  174

Query  447  VRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            VRAGRQEARPV  PN +D  A  SR+PKKKE +K   G
Sbjct  175  VRAGRQEARPVYCPNSQDVGASSSREPKKKEVAKVTTG  212



>ref|XP_008227622.1| PREDICTED: uncharacterized protein LOC103327113 [Prunus mume]
Length=245

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 163/211 (77%), Gaps = 5/211 (2%)
 Frame = -2

Query  963  GVPQLVNQIQDLSIPD-QSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCE  787
            G  QL++ + +LS    Q +M+S  + V +  C N H G+CAICL++IVLQETALVKGCE
Sbjct  9    GQDQLLSDLNNLSTQQHQGEMQSNTDNVEKR-CGN-HGGVCAICLDEIVLQETALVKGCE  66

Query  786  HAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQP  607
            HAYC TCILRW TY ++PTCPQCKHPFEFLN+HR+LDGSI+DYMFEESVCLLLRA WF+P
Sbjct  67   HAYCATCILRWVTYSQKPTCPQCKHPFEFLNVHRSLDGSIHDYMFEESVCLLLRAKWFEP  126

Query  606  LvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQE  427
            L  + E+ E      D Y Y   ++E+DDLDEAYF SSSSIR+GNRRWGDNGYVR GRQE
Sbjct  127  L--IVEEREDVYDDPDDYYYPYEDEEDDDLDEAYFSSSSSIRIGNRRWGDNGYVRGGRQE  184

Query  426  ARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            ARPV+R N EDS A  SR+P+KKE + +  G
Sbjct  185  ARPVHRSNIEDSGASSSREPRKKEAAMDKTG  215



>ref|XP_002299981.2| hypothetical protein POPTR_0001s28270g [Populus trichocarpa]
 gb|EEE84786.2| hypothetical protein POPTR_0001s28270g [Populus trichocarpa]
Length=240

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = -2

Query  963  GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEH  784
            G+ +++ ++       Q +M+S  E   R  C N H G+CAICL+KIVLQETALVKGCEH
Sbjct  3    GISEVIGELNLSGFRFQGEMESKVESSERA-CGN-HGGICAICLDKIVLQETALVKGCEH  60

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            AYCVTCILRW+TY K PTCPQCKHPFEFLNIHR+LDGSI DYMFEESVCLLLRASWF  L
Sbjct  61   AYCVTCILRWSTYTKNPTCPQCKHPFEFLNIHRSLDGSIQDYMFEESVCLLLRASWFMTL  120

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEA  424
             V + +   +D  D +      ED++DDLDE Y  SSS++R+GNRRWGDNGYVRAG QEA
Sbjct  121  TVEDHEDVYEDPEDYYPYEFEDEDDDDDLDEVYLSSSSNLRIGNRRWGDNGYVRAGHQEA  180

Query  423  RPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            RPV + +F+DS A  SR+PKKKE +K+  G
Sbjct  181  RPVYQADFKDSGACTSREPKKKEAAKDRTG  210



>gb|KDO54835.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=247

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 162/218 (74%), Gaps = 8/218 (4%)
 Frame = -2

Query  987  VMATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            + ++ ++I   +LV  + +LSI DQ +M+S A+   R     +H G+CAICL+K VLQET
Sbjct  1    MASSVSKIDGEELVKGLDNLSISDQGEMQSKADN--REMGFGNHGGVCAICLDKTVLQET  58

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            ALVKGCEHAYC TCILRWA+Y + PTCPQCKHPFEFL++HR+LDGS  DYMFEESVCLLL
Sbjct  59   ALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGS--DYMFEESVCLLL  116

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RA+WF+PL       +     DD      +EDEEDDLDE YF SSSS+R+GNRRWGDNGY
Sbjct  117  RATWFKPL----IVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGY  172

Query  447  VRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            VRAGRQEARPV RPN +D  A  SR+PKKKE +K   G
Sbjct  173  VRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTG  210



>ref|XP_003556822.1| PREDICTED: uncharacterized protein LOC100785472 [Glycine max]
 gb|KHN12078.1| hypothetical protein glysoja_044903 [Glycine soja]
Length=247

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 6/212 (3%)
 Frame = -2

Query  963  GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEH  784
            G   L N  QDLSI D  +  S AE +  VG    H G+CAICL+KIVLQETALVKGCEH
Sbjct  10   GEQVLTNDFQDLSIKDLGEKGSEAE-IHEVGY-GGHGGICAICLDKIVLQETALVKGCEH  67

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            AYCVTCIL WATY+++ TCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRASWF PL
Sbjct  68   AYCVTCILHWATYREKVTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRASWFTPL  127

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfDSSSSIR-LGNRRWGDNGYVRAGRQE  427
                E+    + V +        +++DD+DEAY+  SS++R +GNRRWGDNGYVRAGRQE
Sbjct  128  --SVEEHVAHEDVYEDLEDYYQYEDDDDMDEAYYGGSSNLRVIGNRRWGDNGYVRAGRQE  185

Query  426  ARPVNRPNFEDSDA-GPSRQPKKKEPSKEIMG  334
            ARPV+R NF+DS A   SR+PKKKE  K I G
Sbjct  186  ARPVHRLNFQDSGASSSSREPKKKEVGKIITG  217



>gb|ACU23925.1| unknown [Glycine max]
Length=247

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 6/212 (3%)
 Frame = -2

Query  963  GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEH  784
            G   L N  QDLSI D  +  S AE +  VG    H G+CAICL+KIVLQETALVKGCEH
Sbjct  10   GEQVLTNDFQDLSIKDLGEKGSEAE-IHEVGY-GGHGGICAICLDKIVLQETALVKGCEH  67

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            AYCVTCIL WATY+++ TCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRASWF PL
Sbjct  68   AYCVTCILHWATYREKVTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRASWFTPL  127

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfDSSSSIR-LGNRRWGDNGYVRAGRQE  427
                E+    + V +        +++DD+DEAY+  SS++R +GNRRWGDNGYVRAGRQE
Sbjct  128  --SVEEHVAHEDVYEDLEDYYQYEDDDDMDEAYYGGSSNLRVIGNRRWGDNGYVRAGRQE  185

Query  426  ARPVNRPNFEDSDA-GPSRQPKKKEPSKEIMG  334
            ARPV+R NF+DS A   SR+PKKKE  K I G
Sbjct  186  ARPVHRLNFQDSGASSSSREPKKKEVGKIITG  217



>ref|XP_007213836.1| hypothetical protein PRUPE_ppa010547mg [Prunus persica]
 gb|EMJ15035.1| hypothetical protein PRUPE_ppa010547mg [Prunus persica]
Length=245

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 158/206 (77%), Gaps = 4/206 (2%)
 Frame = -2

Query  951  LVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCV  772
            L + I   +   Q +M+S  + V +  C N H G+CAICL++I+LQETALVKGCEHAYC 
Sbjct  14   LSDLINSSTQQHQGEMQSNTDNVEKR-CGN-HGGVCAICLDEIMLQETALVKGCEHAYCA  71

Query  771  TCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvve  592
            TCILRW TY ++PTCPQCKHPFEFLN+HR+LDGSI+DYMFEESVCLLLRA WF+PL  + 
Sbjct  72   TCILRWVTYSQKPTCPQCKHPFEFLNVHRSLDGSIHDYMFEESVCLLLRAKWFEPL--IV  129

Query  591  eqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVN  412
            E+ E      D Y Y   ++E+DDLDEAYF SSSSIR+GNRRWGDNGYVR GRQEARPVN
Sbjct  130  EEREDVYDDPDDYYYPYEDEEDDDLDEAYFSSSSSIRIGNRRWGDNGYVRGGRQEARPVN  189

Query  411  RPNFEDSDAGPSRQPKKKEPSKEIMG  334
            R N EDS A  SR+P+KKE + +  G
Sbjct  190  RSNIEDSGASSSREPRKKEAAMDKTG  215



>ref|XP_011009127.1| PREDICTED: uncharacterized protein LOC105114310 [Populus euphratica]
Length=245

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 152/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  927  SIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWAT  748
            ++  Q +M+S  E   +  C N H G+CAICL+KIVLQETALVKGCEHAYCVTCILRWAT
Sbjct  16   ALQHQGEMESKVESCEKA-CGN-HGGICAICLDKIVLQETALVKGCEHAYCVTCILRWAT  73

Query  747  YKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeq----pe  580
            Y K  TCPQCK PFEFLN+HR+LDGSI DYMFEESVCLLLRA+WF PL V + +      
Sbjct  74   YSKNSTCPQCKQPFEFLNVHRSLDGSIQDYMFEESVCLLLRAAWFVPLTVEDHEDFYEDP  133

Query  579  vddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNF  400
             D Y  ++      E E+DDLD  Y  SSS++R+GNRRWGDNGYVR+GRQEARPV+R NF
Sbjct  134  DDYYPYEYEYEYEDESEDDDLDGVYLSSSSNLRIGNRRWGDNGYVRSGRQEARPVHRSNF  193

Query  399  EDSDAGPSRQPKKKEPSKEIMG  334
            +DS AG S +PKKKE +K+  G
Sbjct  194  DDSGAGSSHEPKKKEAAKDRTG  215



>ref|XP_011004228.1| PREDICTED: uncharacterized protein LOC105110764 [Populus euphratica]
Length=245

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 153/202 (76%), Gaps = 6/202 (3%)
 Frame = -2

Query  927  SIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWAT  748
            ++  Q +M+S  E   +  C N H G+CAICL+KIVLQETALVKGCEHAYCVTCILRWAT
Sbjct  16   ALQHQGEMESKVESCEKA-CGN-HGGICAICLDKIVLQETALVKGCEHAYCVTCILRWAT  73

Query  747  YKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeq----pe  580
            Y K  TCPQCK PFEFLN+HR+LDGSI DYMFEESVCLLLRA+WF PL V + +      
Sbjct  74   YSKNSTCPQCKQPFEFLNVHRSLDGSIQDYMFEESVCLLLRAAWFVPLTVEDHEDFYEDP  133

Query  579  vddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNF  400
             D Y  ++      EDE+DDLD  Y  SSS++R+GNRRWGDNGYVR+GRQEARPV+R NF
Sbjct  134  DDYYPYEYEYEYEDEDEDDDLDGVYLSSSSNLRIGNRRWGDNGYVRSGRQEARPVHRSNF  193

Query  399  EDSDAGPSRQPKKKEPSKEIMG  334
            +DS AG S +PKKKE +K+  G
Sbjct  194  DDSGAGSSHEPKKKEAAKDRTG  215



>gb|AFK39748.1| unknown [Medicago truncatula]
Length=244

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            ++ + +  LSI D  + +S  EE   VG    H G CAICL+ IVLQETALVKGCEHAYC
Sbjct  7    KIQDDLHRLSIKDLIENRSEEEENHHVGF-GKHGGTCAICLDNIVLQETALVKGCEHAYC  65

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            VTCIL WATY ++ TCPQCKHPFEFL +HR LDGSI DYMFEESVCLLLRA WF+PL V 
Sbjct  66   VTCILHWATYSQKVTCPQCKHPFEFLTVHRTLDGSIRDYMFEESVCLLLRAQWFKPLTVE  125

Query  594  eeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPV  415
            E   E D Y +    Y  FE+++D  DE Y+  S+S+R+GNRRWGDNG+VRAGRQEARPV
Sbjct  126  ERVVEEDIYEELVDYYYQFENDDDLDDEDYYGGSASVRIGNRRWGDNGFVRAGRQEARPV  185

Query  414  NRPNFEDSDA--GPSRQPKKKEPSKEIMG  334
            +RP+F+DS A    SR+PKKKE SK + G
Sbjct  186  HRPSFQDSGASSSSSREPKKKEDSKVMTG  214



>ref|XP_002530900.1| protein binding protein, putative [Ricinus communis]
 gb|EEF31476.1| protein binding protein, putative [Ricinus communis]
Length=253

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 158/209 (76%), Gaps = 5/209 (2%)
 Frame = -2

Query  951  LVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCV  772
            L N +  LS+ DQ +++ T  +V    C N H G+CAICL+KIVLQETAL+KGCEHAYCV
Sbjct  17   LPNSLSHLSVQDQVEVQ-TEVKVHENPCGN-HGGVCAICLDKIVLQETALIKGCEHAYCV  74

Query  771  TCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvve  592
             CILRWATY ++PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRA+WF PL+V  
Sbjct  75   MCILRWATYSQKPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRAAWFNPLIVES  134

Query  591  eqpevddyvddfylydgfedeeddldeayf--DSSSSIRLGNRRWGDNGYVRAGRQEARP  418
             +   DD  D +    G +D++D+ D A     SSS++R+GNR+WGDNGYVR+GRQEARP
Sbjct  135  HEDAYDDLDDYYVYEYGDDDDDDEDDLADVYLSSSSNLRIGNRKWGDNGYVRSGRQEARP  194

Query  417  VNRPNFEDSDAG-PSRQPKKKEPSKEIMG  334
              RPN +DS AG  S +PKKKE +++  G
Sbjct  195  AYRPNVQDSGAGSSSSEPKKKETARDRTG  223



>ref|XP_011090171.1| PREDICTED: uncharacterized protein LOC105170929 [Sesamum indicum]
Length=239

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 159/222 (72%), Gaps = 18/222 (8%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGC----ENDHHGLCAICLNKIVL  817
            M+ A  I   +L   +QDL + DQ +++        VGC     N  H  CAICL++I L
Sbjct  1    MSAAVVILDQELDKGVQDLQVQDQKQIRP-------VGCGTSSTNSIHD-CAICLDQIEL  52

Query  816  QETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVC  637
             E+A +KGCEHAYCVTCILRWA+YK++PTCPQCK PFEFLNIHR+LDG +YDY FEESVC
Sbjct  53   HESATIKGCEHAYCVTCILRWASYKQKPTCPQCKTPFEFLNIHRSLDGRVYDYTFEESVC  112

Query  636  LLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGD  457
            LLLRASWF+P+          + VD+      +EDEE+DL+E Y  SSS IR+GNRRWGD
Sbjct  113  LLLRASWFKPM-----VVVEREEVDEDLYDFYYEDEEEDLEEVYLGSSSGIRIGNRRWGD  167

Query  456  NGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPS-KEIMG  334
            NGYVRAGRQEARPV R + +DS AGPSRQPKKKE + KE +G
Sbjct  168  NGYVRAGRQEARPVCRQHLQDSGAGPSRQPKKKEGAVKETVG  209



>ref|XP_011080406.1| PREDICTED: uncharacterized protein LOC105163664 [Sesamum indicum]
Length=251

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 166/228 (73%), Gaps = 18/228 (8%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKS----TAEEVLRVGCENDHH------GLCAIC  835
            M++A EI   +LV  +QDL+I +Q+ MK       EE+ +  C+ ++       G+CAIC
Sbjct  1    MSSAPEIVGLELVQGLQDLAIHEQADMKENCTEAVEEINQGVCDTNNININNHHGVCAIC  60

Query  834  LNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYM  655
            LNKIVLQETALVKGCEH YCVTCILRWA+ KKEPTCPQCKHPFEFL I  AL  SI+DYM
Sbjct  61   LNKIVLQETALVKGCEHGYCVTCILRWASCKKEPTCPQCKHPFEFLPI-VALLNSIHDYM  119

Query  654  FEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLG  475
            FEESVCLLLRA+WF+PL       EV+           ++DEEDDLDE Y  SS S+R+G
Sbjct  120  FEESVCLLLRAAWFKPL------VEVEKEEMFEVEEYEYDDEEDDLDEVYLGSSPSLRIG  173

Query  474  NRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE-PSKEIMG  334
            NRRWGDNGYVRAGRQEARP+ RP+  D+ AGPS Q KKKE P+KE++G
Sbjct  174  NRRWGDNGYVRAGRQEARPIVRPSVLDAGAGPSHQRKKKETPAKELVG  221



>ref|XP_004291737.1| PREDICTED: uncharacterized protein LOC101305336 [Fragaria vesca 
subsp. vesca]
Length=248

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 147/179 (82%), Gaps = 3/179 (2%)
 Frame = -2

Query  870  CENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNI  691
            C+N H G+CAICL++IVLQETALVKGCEHAYC TCILRW TY K PTCPQCKHPFEFLN+
Sbjct  43   CDN-HGGVCAICLDEIVLQETALVKGCEHAYCATCILRWVTYSKSPTCPQCKHPFEFLNV  101

Query  690  HRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddlde  511
            HR+LDGS++DYMFEESVCLLLRA+WF+PL  V E  E     DD   Y  +EDEEDDLDE
Sbjct  102  HRSLDGSLHDYMFEESVCLLLRATWFEPL--VVEDREDVYAYDDHEDYYPYEDEEDDLDE  159

Query  510  ayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            AYF SSSSIR+GNRRWGDNGYV AGRQEARPV+R N +++ A  SR+P+KKE S +  G
Sbjct  160  AYFSSSSSIRIGNRRWGDNGYVSAGRQEARPVHRSNIQEAGASSSREPRKKEASMDKTG  218



>ref|XP_009349039.1| PREDICTED: uncharacterized protein LOC103940614 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009349042.1| PREDICTED: uncharacterized protein LOC103940615 isoform X2 [Pyrus 
x bretschneideri]
Length=243

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 165/209 (79%), Gaps = 6/209 (3%)
 Frame = -2

Query  951  LVNQIQDLSI---PDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHA  781
            L + + DLS      Q++++S  E V +  C N H G+CAICL++IVLQETALVKGCEHA
Sbjct  8    LSDDLTDLSTLQHHHQAELRSEEENVEK-KCGN-HGGVCAICLDEIVLQETALVKGCEHA  65

Query  780  YCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLv  601
            YC TCILRW TY ++PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRA WF+PL 
Sbjct  66   YCATCILRWVTYSQKPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRAKWFEPL-  124

Query  600  vveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEAR  421
            VVEE+ EV +  +D+Y Y   +++EDDLD+AYF SSS IR+GNRRWGDNGYVR+GRQEAR
Sbjct  125  VVEEREEVHEGHEDYYYYPYEDEDEDDLDDAYFSSSSVIRIGNRRWGDNGYVRSGRQEAR  184

Query  420  PVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            PV+R   +DS A  SR+P+KKE + +  G
Sbjct  185  PVHRSGTQDSGASSSREPRKKEAAMDKTG  213



>ref|XP_008803341.1| PREDICTED: uncharacterized protein LOC103716918 isoform X1 [Phoenix 
dactylifera]
Length=250

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 138/174 (79%), Gaps = 1/174 (1%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G CAICL KIVLQETALVKGCEH+YCVTCILRWATY ++P+CPQCKHPFE L++HR+LDG
Sbjct  47   GFCAICLEKIVLQETALVKGCEHSYCVTCILRWATYNQKPSCPQCKHPFESLHVHRSLDG  106

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevdd-yvddfylydgfedeeddldeayfDS  496
             I+DYMFEESVCLLLRA+WF PL V  ++    + +    Y  D  +D+++  +  Y   
Sbjct  107  CIHDYMFEESVCLLLRATWFVPLTVQTQEEASAEPHDYAQYYDDQDDDDDEIDESYYIGG  166

Query  495  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            SSSIR+GNRRWGDNGYVRAGR+EARPVNR   +DS AGPS+ PKKKEPSK+  G
Sbjct  167  SSSIRIGNRRWGDNGYVRAGRKEARPVNRQFLDDSGAGPSQCPKKKEPSKDATG  220



>ref|XP_008344988.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Malus domestica]
Length=250

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 162/210 (77%), Gaps = 7/210 (3%)
 Frame = -2

Query  951  LVNQIQDLSI----PDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEH  784
            L + + DLS      DQ +M+S  E V +  C N H G+CAICL++IVLQ+TALVKGCEH
Sbjct  14   LTDDLTDLSTLQHHHDQGEMQSKEENVEK-KCGN-HDGVCAICLDEIVLQDTALVKGCEH  71

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            AYC TCILRW TY ++PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRA WF+PL
Sbjct  72   AYCATCILRWVTYSQKPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRAKWFEPL  131

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEA  424
             VVEE+ +V +  +D+Y Y   ++E+DDLD+AYF SSS IR+GNRRWGDNGYVR GRQEA
Sbjct  132  -VVEEREDVYEGHEDYYCYPYEDEEDDDLDDAYFSSSSVIRIGNRRWGDNGYVRGGRQEA  190

Query  423  RPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            RPV R N +D  A  S +P+KKE + +  G
Sbjct  191  RPVRRSNIQDPGASSSGEPRKKEAAVDKTG  220



>ref|XP_009349038.1| PREDICTED: uncharacterized protein LOC103940614 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349041.1| PREDICTED: uncharacterized protein LOC103940615 isoform X1 [Pyrus 
x bretschneideri]
Length=248

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 163/209 (78%), Gaps = 5/209 (2%)
 Frame = -2

Query  960  VPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHA  781
            +  L +  Q L +P + +   + EE +   C N H G+CAICL++IVLQETALVKGCEHA
Sbjct  15   LSTLQHHHQALLLPAELR---SEEENVEKKCGN-HGGVCAICLDEIVLQETALVKGCEHA  70

Query  780  YCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLv  601
            YC TCILRW TY ++PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRA WF+PL 
Sbjct  71   YCATCILRWVTYSQKPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRAKWFEPL-  129

Query  600  vveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEAR  421
            VVEE+ EV +  +D+Y Y   +++EDDLD+AYF SSS IR+GNRRWGDNGYVR+GRQEAR
Sbjct  130  VVEEREEVHEGHEDYYYYPYEDEDEDDLDDAYFSSSSVIRIGNRRWGDNGYVRSGRQEAR  189

Query  420  PVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            PV+R   +DS A  SR+P+KKE + +  G
Sbjct  190  PVHRSGTQDSGASSSREPRKKEAAMDKTG  218



>ref|XP_011024967.1| PREDICTED: E3 ubiquitin-protein ligase RHF1A-like [Populus euphratica]
Length=239

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 148/195 (76%), Gaps = 3/195 (2%)
 Frame = -2

Query  918  DQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKK  739
            DQ +M+S  E +    C N H G+CAICL+KIVLQETAL+KGCEHAYCVTCILRW+TY K
Sbjct  18   DQVEMESKVE-ISERACGN-HGGICAICLDKIVLQETALIKGCEHAYCVTCILRWSTYTK  75

Query  738  EPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvdd  559
             PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLL RASWF  + +  E  E      +
Sbjct  76   NPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLRRASWF-VVTLTVEDHEDVYEDPE  134

Query  558  fylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGP  379
             Y    FEDE+DDLDE Y  S S++R+GNRRWGDNGYVRAG QEARPV + +F+DS A  
Sbjct  135  DYYPYEFEDEDDDLDEVYLSSLSNLRIGNRRWGDNGYVRAGHQEARPVYQAHFKDSGAST  194

Query  378  SRQPKKKEPSKEIMG  334
            SR+PKKKE  K+  G
Sbjct  195  SREPKKKEAGKDRTG  209



>ref|XP_009400091.1| PREDICTED: uncharacterized protein LOC103984324 [Musa acuminata 
subsp. malaccensis]
Length=240

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 142/176 (81%), Gaps = 3/176 (2%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G CAICL KI L E ALVKGCEHAYCV CILRWATY++ P+CPQCKHPFEFL++HR+LDG
Sbjct  35   GFCAICLEKIALPEMALVKGCEHAYCVMCILRWATYRERPSCPQCKHPFEFLSVHRSLDG  94

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevdd---yvddfylydgfedeeddldeayf  502
            SI DYMFEESVCLLLRASWF PL V  ++ EV +      + +L + +EDE DDLDE+YF
Sbjct  95   SIQDYMFEESVCLLLRASWFVPLAVQAQREEVQEDGFDELEDFLQNEYEDELDDLDESYF  154

Query  501  DSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
             S SSIR+GNRRWGDNGYVR GR+EARPVN  +F+D DAGPSR PKKKE +K+  G
Sbjct  155  ASRSSIRIGNRRWGDNGYVRTGRKEARPVNLQSFDDEDAGPSRTPKKKEAAKDSTG  210



>ref|XP_004513944.1| PREDICTED: uncharacterized protein LOC101496939 isoform X1 [Cicer 
arietinum]
 ref|XP_004513945.1| PREDICTED: uncharacterized protein LOC101496939 isoform X2 [Cicer 
arietinum]
Length=252

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 150/207 (72%), Gaps = 4/207 (2%)
 Frame = -2

Query  948  VNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVT  769
             N  QD  I + S+  S  EE   VG    H G+CAICL+KIVLQETALVKGCEHAYCVT
Sbjct  15   TNDFQDPLIKNLSEKGSDEEEDHLVGF-GKHGGICAICLDKIVLQETALVKGCEHAYCVT  73

Query  768  CILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvvee  589
            CIL+WATY  + TCPQCKHPFEFL +HR LDGSI DYMFEESVCLLLRA WF+PL V E 
Sbjct  74   CILQWATYSPKVTCPQCKHPFEFLTVHRTLDGSIQDYMFEESVCLLLRAQWFKPLTVEEH  133

Query  588  qpevddyvddfylydgfedeeddldeayfD-SSSSIRLGNRRWGDNGYVRAGRQEARPV-  415
                D Y +    Y  +E+ +DDLD+  +   SSS+R+GNRRWGDNG+VRAGRQEARPV 
Sbjct  134  VVHEDIYDEIEDYYYQYEEPDDDLDDEVYYGGSSSVRIGNRRWGDNGFVRAGRQEARPVI  193

Query  414  NRPNFEDSDAGPSRQPKKKEP-SKEIM  337
            +R NF D  A  SR+PKKKE  S +IM
Sbjct  194  HRSNFPDPGASSSREPKKKEKESAKIM  220



>ref|XP_009340141.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like isoform X1 
[Pyrus x bretschneideri]
Length=243

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 166/209 (79%), Gaps = 6/209 (3%)
 Frame = -2

Query  951  LVNQIQDLSI---PDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHA  781
            L + + DLS      Q++++S  E V +  C N H G+CAICL++IVLQETALVKGCEHA
Sbjct  8    LSDDLTDLSTLQHHHQAELRSEEENVEK-KCGN-HGGVCAICLDEIVLQETALVKGCEHA  65

Query  780  YCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLv  601
            YC TCILRW TY ++PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRA WF+P +
Sbjct  66   YCATCILRWVTYSQKPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRAKWFEP-L  124

Query  600  vveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEAR  421
            VVEE+ EV +  +D+Y Y   +++EDDLD+AYF SSS IR+GNRRWGDNGYVR+GRQEAR
Sbjct  125  VVEEREEVYEGHEDYYYYPYEDEDEDDLDDAYFSSSSVIRIGNRRWGDNGYVRSGRQEAR  184

Query  420  PVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            PV+R + +DS A  SR+P+KKE + +  G
Sbjct  185  PVHRSSTQDSGASSSREPRKKEAAMDKTG  213



>ref|XP_009337048.1| PREDICTED: uncharacterized protein LOC103929558 [Pyrus x bretschneideri]
Length=250

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 160/205 (78%), Gaps = 7/205 (3%)
 Frame = -2

Query  951  LVNQIQDLSI----PDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEH  784
            L + + DLS      +Q +M+S  E V +  C N H G+CAICL++IVLQ+TAL+KGCEH
Sbjct  14   LTDDLTDLSTLQHHHEQGEMQSKEENVEK-KCGN-HDGVCAICLDEIVLQDTALIKGCEH  71

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            AYC TCILRW TY ++PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRA WF+PL
Sbjct  72   AYCATCILRWVTYSQKPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRAKWFEPL  131

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEA  424
             VVEE+ +V D  +D+Y Y   ++E+DDLD+AYF SSS IR+GNRRWGDNGYVR GRQEA
Sbjct  132  -VVEEREDVYDGHEDYYYYPYEDEEDDDLDDAYFSSSSVIRIGNRRWGDNGYVRGGRQEA  190

Query  423  RPVNRPNFEDSDAGPSRQPKKKEPS  349
            RPV R N +D  A  S +P+KKE +
Sbjct  191  RPVRRSNIQDPGASSSCEPRKKEAA  215



>ref|XP_002280104.1| PREDICTED: uncharacterized protein LOC100260248 [Vitis vinifera]
 emb|CBI24239.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 154/219 (70%), Gaps = 10/219 (5%)
 Frame = -2

Query  984  MATAAEI-GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M T   I G  QL++  Q LS+ DQ ++K +     R G    H G+CAICL+ IVLQET
Sbjct  1    MTTVLNIDGDQQLLDTFQHLSVQDQREVKES-----RNG---SHGGVCAICLDTIVLQET  52

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEHAYCVTCILRWATY ++PTCPQCKHPFEFLNIHR+LDGSI+DYMFEESVCLLL
Sbjct  53   AMVKGCEHAYCVTCILRWATYSQKPTCPQCKHPFEFLNIHRSLDGSIHDYMFEESVCLLL  112

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS-SSIRLGNRRWGDNG  451
            RA+WF+PL+V E++   D+    +       D ++D  +  + ++ SSIR+GNRRWG NG
Sbjct  113  RAAWFKPLIVEEQEDIYDEEEYFYPYEINEVDIDEDDLDEVYYNNLSSIRIGNRRWGTNG  172

Query  450  YVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            Y+RAG QEARPV RPN + S A  SR     E  KE  G
Sbjct  173  YIRAGHQEARPVYRPNAQSSGASSSRDSGSSEAKKETKG  211



>gb|EEE56020.1| hypothetical protein OsJ_04797 [Oryza sativa Japonica Group]
Length=269

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 143/192 (74%), Gaps = 4/192 (2%)
 Frame = -2

Query  918  DQSKMKSTAEEVLRVGCENDHH---GLCAICLNKIVLQETALVKGCEHAYCVTCILRWAT  748
            D +++     E   VG   D     G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+
Sbjct  14   DNAQLNFKIPEAAAVGGGGDRAVDCGVCAICLDKIALQETALVKGCDHAYCVTCILRWAS  73

Query  747  YKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqpevddy  568
            YK+ P CPQCKHPF+FL++HR+LDG I+DYMFEESVCLLLRA+WF+PL+V   +  +D+ 
Sbjct  74   YKQTPQCPQCKHPFDFLSVHRSLDGCIHDYMFEESVCLLLRATWFEPLIVEAHEEALDEE  133

Query  567  vddfylydgfedeeddldeayfDSSS-SIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDS  391
                        E+D  +EAY+ S S SIR+GNRRWGDNGYVR GR+EARPV+R +  D+
Sbjct  134  ELYHIYQYDDGVEDDLDEEAYYMSRSPSIRIGNRRWGDNGYVRGGRKEARPVSRQSLNDT  193

Query  390  DAGPSRQPKKKE  355
            DAGPSR PKKK+
Sbjct  194  DAGPSRTPKKKD  205



>dbj|BAB64711.1| RING finger-like protein [Oryza sativa Japonica Group]
 dbj|BAB90773.1| RING finger-like protein [Oryza sativa Japonica Group]
 dbj|BAG89633.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPF+FL++HR+LDG
Sbjct  50   GVCAICLDKIALQETALVKGCDHAYCVTCILRWASYKQTPQCPQCKHPFDFLSVHRSLDG  109

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             I+DYMFEESVCLLLRA+WF+PL+V   +  +D+             E+D  +EAY+ S 
Sbjct  110  CIHDYMFEESVCLLLRATWFEPLIVEAHEEALDEEELYHIYQYDDGVEDDLDEEAYYMSR  169

Query  492  S-SIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            S SIR+GNRRWGDNGYVR GR+EARPV+R +  D+DAGPSR PKKK+
Sbjct  170  SPSIRIGNRRWGDNGYVRGGRKEARPVSRQSLNDTDAGPSRTPKKKD  216



>gb|KJB35685.1| hypothetical protein B456_006G124000 [Gossypium raimondii]
Length=248

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 163/220 (74%), Gaps = 5/220 (2%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            M +A  I   QL     +LS+ +Q +MK+    V   GCE+ H G+CAICL+KIVLQETA
Sbjct  1    MTSATNIVGEQLATAFPNLSLQEQKEMKNKGA-VGEEGCES-HSGICAICLDKIVLQETA  58

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            L+KGCEHAYCVTCILRWATY K P CPQCKHPFE LN+HR+LDG I DYMFEESVCLLLR
Sbjct  59   LIKGCEHAYCVTCILRWATYGKSPKCPQCKHPFESLNVHRSLDGRINDYMFEESVCLLLR  118

Query  624  ASWFQPLvvve-eqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            ASWF+PL V E E  +  +    +Y Y   +D++++ DE Y+ SS S+R+GNRRWGDNGY
Sbjct  119  ASWFKPLNVEECEVYDDLEGYYHYYPYPCEDDDDEEEDEVYYRSSPSLRIGNRRWGDNGY  178

Query  447  VRAGRQEARPV--NRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            VR+GR+EARPV  +  + ++SDA  S +PKKKE SK IMG
Sbjct  179  VRSGRREARPVQQSSSSSQNSDASSSSEPKKKEVSKSIMG  218



>ref|XP_010926978.1| PREDICTED: uncharacterized protein LOC105049116 [Elaeis guineensis]
Length=238

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G CAICL KIVLQE ALVKGCEHAYCVTCILRWA Y ++P+CPQCKHPFE L++HR+LDG
Sbjct  37   GFCAICLEKIVLQEMALVKGCEHAYCVTCILRWAAYNQKPSCPQCKHPFESLHVHRSLDG  96

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             I+DYMFEESVCLLLRA+WF PL  VE Q E  +  +D+  Y   +D+++  +  Y  +S
Sbjct  97   CIHDYMFEESVCLLLRATWFVPL-TVETQEEAPEEPEDYAQYYDDQDDDELDESYYISTS  155

Query  492  SSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            SSIR+GNRRWGDNGYVRAGR+EARPVNR  F+DS AGPSR PKKKEPSK+  G
Sbjct  156  SSIRIGNRRWGDNGYVRAGRKEARPVNRQFFDDSGAGPSRCPKKKEPSKDATG  208



>ref|XP_008356335.1| PREDICTED: uncharacterized protein LOC103420049 [Malus domestica]
 ref|XP_008364421.1| PREDICTED: uncharacterized protein LOC103428102 [Malus domestica]
Length=247

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = -2

Query  891  EEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKH  712
            EE +   C N H G+CAICL++IVLQETALVKGCEHAYC TCILRW TY ++PTCPQCKH
Sbjct  30   EENVEKKCGN-HGGVCAICLDEIVLQETALVKGCEHAYCATCILRWVTYSQKPTCPQCKH  88

Query  711  PFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfed  532
            PFEFLN+HR+LDGSI DYMFEESVCLLLRA WF+P +VVEE+ EV +  +D+Y Y   ++
Sbjct  89   PFEFLNVHRSLDGSIQDYMFEESVCLLLRAKWFEP-LVVEEREEVYEGHEDYYYYPYEDE  147

Query  531  eeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEP  352
            E+DDLD+AYF SSS IR+GNRRWGDNGYVR GRQEARPV+R + +DS A  SR+P+KKE 
Sbjct  148  EDDDLDDAYFSSSSVIRIGNRRWGDNGYVRGGRQEARPVHRSSTQDSGASSSREPRKKEA  207

Query  351  SKEIMG  334
            + +  G
Sbjct  208  AVDKTG  213



>ref|XP_010045057.1| PREDICTED: uncharacterized protein LOC104433874 [Eucalyptus grandis]
 gb|KCW87217.1| hypothetical protein EUGRSUZ_B03731 [Eucalyptus grandis]
Length=244

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 155/220 (70%), Gaps = 11/220 (5%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMK-STAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            MA   ++   +  + + D  + DQ KM  +T+ +        +H G+CAICL KIVLQET
Sbjct  1    MAAVFQLDGDRAADALPDSPVVDQEKMPIATSHDYA------NHGGVCAICLEKIVLQET  54

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            ALVKGCEHAYCVTCILRWA+ K+ PTCPQCKHPF+FLN+HR LDGSI DYMFEESVCLLL
Sbjct  55   ALVKGCEHAYCVTCILRWASCKERPTCPQCKHPFDFLNVHRLLDGSIRDYMFEESVCLLL  114

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RA+WF PL       +  D ++D+  Y+   ++EDD  E  + +S SIR+GNRRWGDNGY
Sbjct  115  RATWFMPL--EVHYEDTYDPLEDYCPYEDEVEDEDDDLEEAYFNSPSIRIGNRRWGDNGY  172

Query  447  VRAGRQEARPVNRPNFEDSDA-GPSRQPKKKE-PSKEIMG  334
            VRAGRQEARPV R N +D  A   S QPKKKE  +KE +G
Sbjct  173  VRAGRQEARPVYRANPQDEGASSSSHQPKKKEVAAKETVG  212



>gb|KHG12965.1| Protein SCAF11 [Gossypium arboreum]
Length=247

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 162/220 (74%), Gaps = 6/220 (3%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            M +A  I   QL     +LS+ +Q +MK+     +  GCE+ H G+CAICL+KIVLQETA
Sbjct  1    MTSATNIVGEQLATAFPNLSLQEQKEMKNKG--AVGEGCES-HSGICAICLDKIVLQETA  57

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            L+KGCEHAYCVTCILRWAT  K P CPQCKHPFE LN+HR+LDG I DYMFEESVCLLLR
Sbjct  58   LIKGCEHAYCVTCILRWATCGKSPKCPQCKHPFESLNVHRSLDGRINDYMFEESVCLLLR  117

Query  624  ASWFQPLvvve-eqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            ASWF+PL V E E  +  +    +Y Y   +D++++ DE Y+ SS S+R+GNRRWGDNGY
Sbjct  118  ASWFKPLNVEECEVYDDLEDYYHYYPYPCEDDDDEEEDEVYYRSSPSLRIGNRRWGDNGY  177

Query  447  VRAGRQEARPVNR--PNFEDSDAGPSRQPKKKEPSKEIMG  334
            VR+GR+EARPV R   + ++SDA  S +PKKKE SK IMG
Sbjct  178  VRSGRREARPVQRSSSSSQNSDASSSSEPKKKEVSKSIMG  217



>ref|XP_006645378.1| PREDICTED: uncharacterized protein LOC102722445 [Oryza brachyantha]
Length=278

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG
Sbjct  52   GVCAICLDKIALQETALVKGCDHAYCVTCILRWASYKQTPLCPQCKHPFEFLSVHRSLDG  111

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS-  496
             I+DYMFEESVCLLLRA+WF+PL+V   +  +D+         G +DE+D  +EAY+ S 
Sbjct  112  CIHDYMFEESVCLLLRAAWFEPLIVEPHEEALDEEELYHIYQYGDDDEDDLDEEAYYMSR  171

Query  495  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            S S+R+GNRRWGDNGYVR GR+EARPV+RP+    DAGPSR PKKK+
Sbjct  172  SPSVRIGNRRWGDNGYVRGGRKEARPVSRPSLNGVDAGPSRTPKKKD  218



>ref|XP_010938563.1| PREDICTED: uncharacterized protein LOC105057609 [Elaeis guineensis]
Length=247

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 138/181 (76%), Gaps = 8/181 (4%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL KIVLQE ALVKGCEHAYCVTCILRWA YK++P+CPQCKHPFE LN+HR+LDG
Sbjct  37   GVCAICLEKIVLQEMALVKGCEHAYCVTCILRWAAYKQKPSCPQCKHPFESLNVHRSLDG  96

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfy--------lydgfedeeddl  517
             I+DYMFEESVCLLLRA+WF PL V  ++   ++  D             D  +D ++  
Sbjct  97   CIHDYMFEESVCLLLRAAWFVPLTVEAQEEASEELEDYTQYYNDQDYADDDNDDDGDELD  156

Query  516  deayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIM  337
            +  Y  SSSSIR+GNRRWGDNGYVRAGR+EARPV + +F+DS AGPS+ PKKKE SK + 
Sbjct  157  ESYYISSSSSIRIGNRRWGDNGYVRAGRKEARPVGQRSFDDSGAGPSQCPKKKESSKVVT  216

Query  336  G  334
            G
Sbjct  217  G  217



>ref|XP_008782014.1| PREDICTED: uncharacterized protein LOC103701648 [Phoenix dactylifera]
Length=242

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 137/176 (78%), Gaps = 3/176 (2%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL KIVLQETALVKGCEHAYCVTCILRWA Y ++P+CPQCKHPFE LN+HR+LDG
Sbjct  37   GICAICLEKIVLQETALVKGCEHAYCVTCILRWAAYNQKPSCPQCKHPFESLNVHRSLDG  96

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddf---ylydgfedeeddldeayf  502
             I+DYMFEESV LLLRA+WF PL V  ++   ++  D        D  +D ++  +  Y 
Sbjct  97   CIHDYMFEESVWLLLRATWFVPLTVEAQEEASEELEDYARYYNDQDDDDDGDELDESYYI  156

Query  501  DSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
             SSSSIR+GNRRWGDNGYVRAGR+EARPV + +F+DS AG SR PKKKEPSK + G
Sbjct  157  SSSSSIRIGNRRWGDNGYVRAGRKEARPVGQRSFDDSGAGTSRCPKKKEPSKIVTG  212



>gb|AFK37549.1| unknown [Lotus japonicus]
Length=258

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = -2

Query  951  LVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCV  772
            L +   DLSI D    K + EE  + G  N H G+CAICL+KIVLQETALVKGCEHAYCV
Sbjct  16   LTHDFHDLSIEDHLVEKGSDEETHKGGFGN-HGGICAICLDKIVLQETALVKGCEHAYCV  74

Query  771  TCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvve  592
            TCILRWATY  + TCPQCK+PFEFLN+HR+LDGSI D MFEESVCLLLRA WF+PL V +
Sbjct  75   TCILRWATYNNKVTCPQCKNPFEFLNVHRSLDGSIEDCMFEESVCLLLRAKWFKPLTVED  134

Query  591  eqpevddyvddfylydgfedeeddldeayfD--SSSSIRLGNRRWGDNGYVRAGRQEARP  418
                 +D + D      +  EEDD D        SSS R+GNRRWGDNGYVRAGRQEARP
Sbjct  135  HVVVHEDTLLDELEDYYYHYEEDDEDLDDAYYGGSSSFRIGNRRWGDNGYVRAGRQEARP  194

Query  417  VNRPNFED  394
            V+R N ++
Sbjct  195  VHRSNTDN  202



>ref|XP_004971302.1| PREDICTED: uncharacterized protein LOC101754108 [Setaria italica]
Length=273

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG
Sbjct  46   GVCAICLDKIALQETALVKGCDHAYCVTCILRWASYKQTPLCPQCKHPFEFLSVHRSLDG  105

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             ++DY+FEESVCLLLRA+WF+PL+V   +  +++           ++++ D +  Y   S
Sbjct  106  CLHDYLFEESVCLLLRAAWFEPLIVEPHEEALEEDEFYHQYQYDDDEDDLDEETYYMSRS  165

Query  492  SSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
             S R+GNRRWGDNGY+R GR+EARPVN     D+ AGPSR PKKKE
Sbjct  166  PSFRIGNRRWGDNGYIRGGRREARPVN----NDAAAGPSRTPKKKE  207



>ref|XP_008449663.1| PREDICTED: uncharacterized protein LOC103491476 isoform X1 [Cucumis 
melo]
Length=276

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 154/222 (69%), Gaps = 11/222 (5%)
 Frame = -2

Query  987  VMATAAEIGV--PQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQ  814
            VM T++ I +   ++ + +Q+     Q +M    E  ++      H G CAICLNKI LQ
Sbjct  32   VMTTSSGISIQSAEISDAVQEQVTCHQLEMGKKVE--IQGTGHGSHDGACAICLNKIALQ  89

Query  813  ETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCL  634
            ETALV+GCEHAYC TCILRWA+Y ++PTCPQCKHPFEFL +HR+LDGSI+DYMFEESVCL
Sbjct  90   ETALVRGCEHAYCATCILRWASYTQKPTCPQCKHPFEFLIVHRSLDGSIHDYMFEESVCL  149

Query  633  LLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDN  454
            LLRASW++PL  + E+ E      +   Y  +ED++++L++AY   S S+R+GNRRWG N
Sbjct  150  LLRASWYKPL--IFEEREETYDEPEDDQYYHYEDDDEELEDAYLGESPSLRIGNRRWGYN  207

Query  453  GYVRAGRQEARPVNRPNFEDSDAGP--SRQPKKKEPSKEIMG  334
            GYVRAGRQEARPV R  F     GP  SR P  K+ SK+  G
Sbjct  208  GYVRAGRQEARPVLRQEF---TGGPSSSRDPVTKQASKDKTG  246



>ref|XP_006399746.1| hypothetical protein EUTSA_v10014482mg [Eutrema salsugineum]
 gb|ESQ41199.1| hypothetical protein EUTSA_v10014482mg [Eutrema salsugineum]
Length=251

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = -2

Query  942  QIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCI  763
            Q++ L +PDQ + K+  E++       +H G CAICL+ I LQETA+VKGCEHAYCVTCI
Sbjct  12   QVEVLPLPDQDEKKT--EQLGNEQSFGNHGGSCAICLDTIPLQETAMVKGCEHAYCVTCI  69

Query  762  LRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqp  583
            LRWA+YK++PTCPQCKHPF+FLN+HRALDGS+ D+MFEESVCLLLRASWFQPL  VE   
Sbjct  70   LRWASYKEKPTCPQCKHPFDFLNVHRALDGSVEDFMFEESVCLLLRASWFQPLDAVERVS  129

Query  582  evddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPV  415
            + D +  DF +   +EDE+DD  + ++   SS+RLGNRRWGDNG+VR+GRQEARPV
Sbjct  130  DNDIHNYDFEIPPEYEDEDDDDLDEFYLHGSSLRLGNRRWGDNGFVRSGRQEARPV  185



>ref|XP_010673753.1| PREDICTED: uncharacterized protein LOC104890082 [Beta vulgaris 
subsp. vulgaris]
Length=270

 Score =   207 bits (527),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 149/205 (73%), Gaps = 5/205 (2%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            +L N + DL IPD+ +M    E+  ++     + G+CAICL+ I LQETALVKGCEH YC
Sbjct  12   RLSNDLNDLIIPDKGEMNEEREKGGQMSAVAVNDGVCAICLDCIELQETALVKGCEHVYC  71

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            V CIL+WATY + P CPQCK+PF+ L++HRALDGS++DYMFEES+CLL+RASWF+PLVV 
Sbjct  72   VNCILQWATYHEHPKCPQCKNPFDTLSVHRALDGSLHDYMFEESLCLLVRASWFKPLVVE  131

Query  594  -----eeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQ  430
                  ++ +   Y    Y Y+  +  +DD ++ YF SS S+R+GNRRWGDNGY+ AGRQ
Sbjct  132  PYDDFYDELDDIFYYQYQYQYEYGDLGDDDFEDDYFHSSPSLRIGNRRWGDNGYISAGRQ  191

Query  429  EARPVNRPNFEDSDAGPSRQPKKKE  355
            EARPV+R N ++S A  SRQ KKKE
Sbjct  192  EARPVHRSNPQNSGASSSRQRKKKE  216



>ref|XP_008449664.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X2 [Cucumis 
melo]
Length=244

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 153/221 (69%), Gaps = 11/221 (5%)
 Frame = -2

Query  984  MATAAEIGV--PQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQE  811
            M T++ I +   ++ + +Q+     Q +M    E  ++      H G CAICLNKI LQE
Sbjct  1    MTTSSGISIQSAEISDAVQEQVTCHQLEMGKKVE--IQGTGHGSHDGACAICLNKIALQE  58

Query  810  TALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLL  631
            TALV+GCEHAYC TCILRWA+Y ++PTCPQCKHPFEFL +HR+LDGSI+DYMFEESVCLL
Sbjct  59   TALVRGCEHAYCATCILRWASYTQKPTCPQCKHPFEFLIVHRSLDGSIHDYMFEESVCLL  118

Query  630  LRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNG  451
            LRASW++PL  + E+ E      +   Y  +ED++++L++AY   S S+R+GNRRWG NG
Sbjct  119  LRASWYKPL--IFEEREETYDEPEDDQYYHYEDDDEELEDAYLGESPSLRIGNRRWGYNG  176

Query  450  YVRAGRQEARPVNRPNFEDSDAGP--SRQPKKKEPSKEIMG  334
            YVRAGRQEARPV R  F     GP  SR P  K+ SK+  G
Sbjct  177  YVRAGRQEARPVLRQEF---TGGPSSSRDPVTKQASKDKTG  214



>ref|XP_011657615.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X2 [Cucumis 
sativus]
Length=244

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 152/216 (70%), Gaps = 12/216 (6%)
 Frame = -2

Query  984  MATAAEIGV--PQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQE  811
            MAT++ I +   ++ + +Q+    DQ +M    E  ++      H G CAICLNKI LQE
Sbjct  1    MATSSGISIQSAEISDAVQEQVTCDQLEMGKKVE--IQGTGHGSHDGACAICLNKIALQE  58

Query  810  TALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLL  631
            TALV+GCEHAYC TCILRWA+Y K+PTCPQCKHPFEFL +HR+LDGSI+DYMFEESVCLL
Sbjct  59   TALVRGCEHAYCATCILRWASYTKKPTCPQCKHPFEFLIVHRSLDGSIHDYMFEESVCLL  118

Query  630  LRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNG  451
            LRASW++P   + E+ E      +   Y  +ED++++L++AY   S S+R+GNRRWG NG
Sbjct  119  LRASWYKP--PIIEEREETYDDPEDDQYYPYEDDDEELEDAYLGESPSLRIGNRRWGYNG  176

Query  450  YVRAGRQEARPVNRPNFEDSDAGP--SRQPKKKEPS  349
            YVRAGRQEARPV R  F     GP  SR+P  K+ S
Sbjct  177  YVRAGRQEARPVLRQEF----TGPSSSREPVTKQAS  208



>ref|XP_002456950.1| hypothetical protein SORBIDRAFT_03g046160 [Sorghum bicolor]
 gb|EES02070.1| hypothetical protein SORBIDRAFT_03g046160 [Sorghum bicolor]
Length=278

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 5/167 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL++I LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG
Sbjct  40   GVCAICLDRIALQETALVKGCDHAYCVTCILRWASYKQNPLCPQCKHPFEFLSVHRSLDG  99

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS-  496
             ++DY+FEESVCLLLRA+WF+PL+V   +  ++D       Y   +DE+D  +E+Y+ S 
Sbjct  100  CLHDYLFEESVCLLLRAAWFEPLIVEAHEEPLEDEEFFDQQYQYDDDEDDLDEESYYMSR  159

Query  495  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            SSSIR+GNRRWGDNGY+R GR+EARPVN     D+ AGPSR PKKK+
Sbjct  160  SSSIRIGNRRWGDNGYIRGGRKEARPVN----TDASAGPSRTPKKKK  202



>ref|XP_004140197.1| PREDICTED: uncharacterized protein LOC101206609 isoform X1 [Cucumis 
sativus]
 gb|KGN48101.1| hypothetical protein Csa_6G431760 [Cucumis sativus]
Length=276

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 152/217 (70%), Gaps = 12/217 (6%)
 Frame = -2

Query  987  VMATAAEIGV--PQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQ  814
             MAT++ I +   ++ + +Q+    DQ +M    E  ++      H G CAICLNKI LQ
Sbjct  32   AMATSSGISIQSAEISDAVQEQVTCDQLEMGKKVE--IQGTGHGSHDGACAICLNKIALQ  89

Query  813  ETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCL  634
            ETALV+GCEHAYC TCILRWA+Y K+PTCPQCKHPFEFL +HR+LDGSI+DYMFEESVCL
Sbjct  90   ETALVRGCEHAYCATCILRWASYTKKPTCPQCKHPFEFLIVHRSLDGSIHDYMFEESVCL  149

Query  633  LLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDN  454
            LLRASW++P   + E+ E      +   Y  +ED++++L++AY   S S+R+GNRRWG N
Sbjct  150  LLRASWYKP--PIIEEREETYDDPEDDQYYPYEDDDEELEDAYLGESPSLRIGNRRWGYN  207

Query  453  GYVRAGRQEARPVNRPNFEDSDAGP--SRQPKKKEPS  349
            GYVRAGRQEARPV R  F     GP  SR+P  K+ S
Sbjct  208  GYVRAGRQEARPVLRQEF----TGPSSSREPVTKQAS  240



>ref|XP_006400503.1| hypothetical protein EUTSA_v10014461mg [Eutrema salsugineum]
 gb|ESQ41956.1| hypothetical protein EUTSA_v10014461mg [Eutrema salsugineum]
Length=255

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -2

Query  984  MATAAEIGVPQ-LVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M++  EI   Q +V+ I+D+++ DQ K K   +E +      +H G CAICLN+I LQET
Sbjct  1    MSSVTEIVYEQQVVDGIEDMALQDQDKKK--IQEEMHEPSFGNHGGCCAICLNEIPLQET  58

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEH YCVTCILRWA+YK+ PTCPQCKHPF+FL++HRALDGSI D++FEESVCLLL
Sbjct  59   AMVKGCEHTYCVTCILRWASYKESPTCPQCKHPFDFLSVHRALDGSIEDFLFEESVCLLL  118

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RASWF PL  V E         D +      ++EDD  + ++   SS+RLGNRRWGDNG+
Sbjct  119  RASWFIPL-DVVEHASYSYGYHDDFDIPCEYEDEDDDLDEFYLHGSSLRLGNRRWGDNGF  177

Query  447  VRAGRQEARPVNRPN  403
            VR+GRQEARPV + N
Sbjct  178  VRSGRQEARPVQKYN  192



>ref|NP_001148564.1| LOC100282180 [Zea mays]
 gb|ACF85780.1| unknown [Zea mays]
 gb|ACG32054.1| zinc finger, C3HC4 type family protein [Zea mays]
 gb|ACL52636.1| unknown [Zea mays]
Length=283

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 134/167 (80%), Gaps = 5/167 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL++I LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG
Sbjct  47   GVCAICLDRIALQETALVKGCDHAYCVTCILRWASYKENPLCPQCKHPFEFLSVHRSLDG  106

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             ++DY+FEESVCLLLRA+WF+PL+V   +  +++       Y   +DE+D  +E+Y+ + 
Sbjct  107  CLHDYLFEESVCLLLRAAWFEPLIVEAHEEALEEEEFLHQQYQYDDDEDDLDEESYYMNR  166

Query  492  S-SIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            S SIR+GNRRWGDNGY+R GR+EARPVN     D  AGPSR PKKKE
Sbjct  167  SPSIRIGNRRWGDNGYIRGGRKEARPVN----TDVAAGPSRTPKKKE  209



>emb|CDX70877.1| BnaC03g09610D [Brassica napus]
Length=256

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -2

Query  981  ATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETAL  802
            +  A +   QLV  IQDL++ DQ K K   EE   +   N H G CAICLN I LQETA+
Sbjct  3    SVTAIVDEQQLVEAIQDLALQDQGKEK-IQEETHELNFGN-HGGCCAICLNAIPLQETAM  60

Query  801  VKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRA  622
            VKGCEH YCVTCILRWA+ K+ PTCPQCKHPF+FL++HR LDGSI D++FEESVCLLLRA
Sbjct  61   VKGCEHTYCVTCILRWASCKESPTCPQCKHPFDFLSVHRTLDGSIEDFLFEESVCLLLRA  120

Query  621  SWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVR  442
            SWF PL V+ EQ                + +EDD  +  +   S +R+GNRRWGDNG+VR
Sbjct  121  SWFIPLDVMVEQASYSYGYHHDDFDIPCDYDEDDDLDELYMHGSGLRIGNRRWGDNGFVR  180

Query  441  AGRQEARPVNR  409
            +GRQEARPV +
Sbjct  181  SGRQEARPVKK  191



>ref|XP_002873563.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49822.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 140/185 (76%), Gaps = 1/185 (1%)
 Frame = -2

Query  954  QLVNQIQ-DLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAY  778
            Q+V++ Q D+    Q + +   ++V       +H G CAICL+ I LQETA+VKGCEHAY
Sbjct  6    QIVDEQQVDVLSLHQDQDEKKTQQVFNELSFGNHGGCCAICLDTIPLQETAMVKGCEHAY  65

Query  777  CVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvv  598
            CVTCILRWA+YK++PTCPQCK PF+FLN+HRALDGS+ D+MFEESVCLLLRASWFQPL  
Sbjct  66   CVTCILRWASYKEKPTCPQCKLPFDFLNVHRALDGSVEDFMFEESVCLLLRASWFQPLEA  125

Query  597  veeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARP  418
            VE   + D++  DF +   +EDE+DD  + ++   SS+RLGNRRWGDNG+VRAGRQEARP
Sbjct  126  VERVSDNDNFNYDFDIPPEYEDEDDDDLDEFYMQGSSLRLGNRRWGDNGFVRAGRQEARP  185

Query  417  VNRPN  403
            V   N
Sbjct  186  VQHKN  190



>emb|CDX88890.1| BnaA03g07590D [Brassica napus]
Length=256

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 133/191 (70%), Gaps = 2/191 (1%)
 Frame = -2

Query  981  ATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETAL  802
            +  A +   Q+V  IQDL++ DQ K K   EE   +   N H G CAICLN I LQETA+
Sbjct  3    SVTAIVDEQQVVEAIQDLALQDQGKEK-IQEETHELNFGN-HGGCCAICLNAIPLQETAM  60

Query  801  VKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRA  622
            VKGCEH YCVTCILRWA+ K+ PTCPQCKHPF+FL++HR LDGSI D++FEESVCLLLRA
Sbjct  61   VKGCEHTYCVTCILRWASCKESPTCPQCKHPFDFLSVHRTLDGSIEDFLFEESVCLLLRA  120

Query  621  SWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVR  442
            SWF PL V+ EQ                + +EDD  + ++   S +R+GNRRWGDNG+VR
Sbjct  121  SWFIPLDVMVEQASYSYGYHHDDFDIPCDYDEDDDLDEFYMHGSGLRIGNRRWGDNGFVR  180

Query  441  AGRQEARPVNR  409
            +GRQEARPV +
Sbjct  181  SGRQEARPVKK  191



>ref|NP_568264.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 emb|CAC42892.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAM51588.1| AT5g19430/F7K24_180 [Arabidopsis thaliana]
 dbj|BAC42369.1| putative RING finger [Arabidopsis thaliana]
 gb|AED91790.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=254

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 144/196 (73%), Gaps = 6/196 (3%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA  805
            M+++ +I V +   Q+  L + DQ + K+   +V       +H G CAICL+ I LQETA
Sbjct  1    MSSSIQIVVEE--KQVDVLPLQDQDEKKTP--QVFNELSFGNHGGCCAICLDTIPLQETA  56

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            +VKGCEHAYCVTCILRWA+YK++PTCPQCK PF+FLN+HRALDGS+ D+MFEESVCLLLR
Sbjct  57   MVKGCEHAYCVTCILRWASYKEKPTCPQCKLPFDFLNVHRALDGSVEDFMFEESVCLLLR  116

Query  624  ASWFQPLvvveeqpevddyvddfyl--ydgfedeeddldeayfDSSSSIRLGNRRWGDNG  451
            ASWFQPL  VE   + D++  DF +      EDE+DD  + ++   SS+RLGNRRWGDNG
Sbjct  117  ASWFQPLEAVERVSDNDNFNYDFDIPPEYEEEDEDDDDLDEFYMQGSSLRLGNRRWGDNG  176

Query  450  YVRAGRQEARPVNRPN  403
            +VRAGRQEARPV   N
Sbjct  177  FVRAGRQEARPVQHKN  192



>ref|XP_010419820.1| PREDICTED: uncharacterized protein LOC104705504 [Camelina sativa]
Length=253

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 138/186 (74%), Gaps = 2/186 (1%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            Q+V++ Q   +P Q + +   +EV       +H G CAICL+ I LQETA+VKGCEHAYC
Sbjct  6    QIVDEQQLDVLPLQDQDEKKTQEVSNELGFGNHGGCCAICLDTIPLQETAMVKGCEHAYC  65

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            VTCILRWA+YK++PTCPQCK PF+FLN+HRALDGS+ D+MFEESVCLLLRA WFQPL  V
Sbjct  66   VTCILRWASYKEKPTCPQCKLPFDFLNVHRALDGSVEDFMFEESVCLLLRAVWFQPLEAV  125

Query  594  eeqpevddyvddfyl--ydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEAR  421
            E   + D++  DF +      ED++DD  + ++   SS+RLGNRRWGDNG+VRAGRQEAR
Sbjct  126  ERVSDSDNFNYDFDIPPEYEAEDDDDDDLDEFYLQGSSLRLGNRRWGDNGFVRAGRQEAR  185

Query  420  PVNRPN  403
            PV   N
Sbjct  186  PVQHKN  191



>dbj|BAK01918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG
Sbjct  56   GVCAICLDKIPLQETALVKGCDHAYCVTCILRWASYKQTPVCPQCKHPFEFLSVHRSLDG  115

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             ++DYMF+ESVCLLLRA+WF+PL VVE   E  +  D +  Y   + +EDDL E Y   S
Sbjct  116  CLHDYMFDESVCLLLRATWFKPL-VVEAHDEAQEEEDIYRSYQYDDGDEDDLYEEYISRS  174

Query  492  SSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
             SIR+GNRRWGDNGYVR GR+EARPV  P    +DA PSR P+KKE
Sbjct  175  PSIRIGNRRWGDNGYVRGGRREARPVVIPPA--ADAVPSRTPRKKE  218



>ref|XP_010453296.1| PREDICTED: uncharacterized protein LOC104735246 [Camelina sativa]
Length=255

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 136/188 (72%), Gaps = 4/188 (2%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            Q+V++ Q   +P Q + +   +EV       +H G CAICL+ I LQETA+VKGCEHAYC
Sbjct  6    QIVDEQQLDVLPLQDQDEKKTQEVSNELSFGNHGGCCAICLDTIPLQETAMVKGCEHAYC  65

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            VTCILRWA+YK++PTCPQCK PF+FLN+HRALDGS+ D+MFEESVCLLLRA WFQPL  V
Sbjct  66   VTCILRWASYKEKPTCPQCKLPFDFLNVHRALDGSVEDFMFEESVCLLLRAVWFQPLEAV  125

Query  594  eeqpevddyvddf----ylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQE  427
            E   + D++  DF          +D++DD    ++   SS+RLGNRRWGDNG+VRAGRQE
Sbjct  126  ERVSDSDNFNYDFDIPPEYEAEDDDDDDDDLNEFYLQGSSLRLGNRRWGDNGFVRAGRQE  185

Query  426  ARPVNRPN  403
            ARPV   N
Sbjct  186  ARPVQHKN  193



>ref|XP_010491989.1| PREDICTED: uncharacterized protein LOC104769470 [Camelina sativa]
Length=255

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 138/189 (73%), Gaps = 6/189 (3%)
 Frame = -2

Query  954  QLVN-QIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAY  778
            Q+V+ QI DL +P Q + +   +EV       +H G CAICL+ I LQETA+VKGCEHAY
Sbjct  6    QIVDEQILDL-LPLQHQDEKKTQEVSNELSFGNHGGCCAICLDTIPLQETAMVKGCEHAY  64

Query  777  CVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvv  598
            CVTCILRWA+YK++PTCPQCK PF+FLN+HRALDGS+ D+MFEESVCLLLRA WFQPL  
Sbjct  65   CVTCILRWASYKEKPTCPQCKLPFDFLNVHRALDGSVEDFMFEESVCLLLRAVWFQPLEA  124

Query  597  veeqpevddyvddf----ylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQ  430
            VE   + D +  DF          ED++DD  + ++   SS+RLGNRRWGDNG+VRAGRQ
Sbjct  125  VERVSDSDIFNYDFDIPPEYVAEDEDDDDDDLDEFYLQGSSLRLGNRRWGDNGFVRAGRQ  184

Query  429  EARPVNRPN  403
            EARPV   N
Sbjct  185  EARPVQHKN  193



>ref|XP_009131737.1| PREDICTED: uncharacterized protein LOC103856380 [Brassica rapa]
Length=257

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 132/192 (69%), Gaps = 3/192 (2%)
 Frame = -2

Query  981  ATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETAL  802
            +  A +   Q+V  IQDL++ DQ K K   EE   +   N H G CAICLN I LQETA+
Sbjct  3    SVTAIVDEQQVVEAIQDLALQDQGKEK-IQEETHELNFGN-HGGCCAICLNAIPLQETAM  60

Query  801  VKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRA  622
            VKGCEH YCVTCILRWA+ K+ PTCPQCKHPF+FL++HR LDGSI D++FEESVCLLLRA
Sbjct  61   VKGCEHTYCVTCILRWASCKESPTCPQCKHPFDFLSVHRTLDGSIEDFLFEESVCLLLRA  120

Query  621  SWFQPLvvveeqpevddyvddfylyd-gfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            SWF PL V+ EQ                  ++ED   + ++   S +R+GNRRWGDNG+V
Sbjct  121  SWFIPLDVMVEQASYSYGYHHDDFDIPCDYEDEDADLDEFYLHGSGLRIGNRRWGDNGFV  180

Query  444  RAGRQEARPVNR  409
            R+GRQEARPV +
Sbjct  181  RSGRQEARPVKK  192



>ref|NP_568374.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAK32770.1|AF361602_1 AT5g19430/F7K24_180 [Arabidopsis thaliana]
 gb|AAL15402.1| AT5g19430/F7K24_180 [Arabidopsis thaliana]
 gb|AED92705.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=255

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 139/193 (72%), Gaps = 4/193 (2%)
 Frame = -2

Query  984  MATAAEI-GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M++  EI    Q+++ IQDL++ +Q K K   EE+      N H G CAICL++I LQET
Sbjct  1    MSSVTEIVSEQQVIDGIQDLALQNQDK-KKIQEEIHEPSFGN-HGGCCAICLSEIPLQET  58

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEH YCVTCILRWA+ K+ PTCPQCKHPF+FL++HRALDGSI D++FEESVCLLL
Sbjct  59   AMVKGCEHTYCVTCILRWASCKESPTCPQCKHPFDFLSVHRALDGSIEDFLFEESVCLLL  118

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RASWF PL  V EQ        D +      ++EDD  + ++   SS+R+GNRRWG NG+
Sbjct  119  RASWFVPL-DVVEQASYSHGYHDDFDIPYDYEDEDDDLDEFYLHGSSLRIGNRRWGGNGF  177

Query  447  VRAGRQEARPVNR  409
            VR+GRQEARPV R
Sbjct  178  VRSGRQEARPVQR  190



>dbj|BAJ86745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG
Sbjct  54   GVCAICLDKIPLQETALVKGCDHAYCVTCILRWASYKQTPVCPQCKHPFEFLSVHRSLDG  113

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             ++ YMF+ESVCLLLRA+WF+PL VVE   E  +  D +  Y   + +EDDL E Y   S
Sbjct  114  CLHGYMFDESVCLLLRATWFKPL-VVEAHDEAQEEEDIYRSYQYDDGDEDDLYEEYISRS  172

Query  492  SSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
             SIR+GNRRWGDNGYVR GR+EARPV  P    +DA PSR P+KKE
Sbjct  173  PSIRIGNRRWGDNGYVRGGRREARPVVIPPA--ADAVPSRTPRKKE  216



>ref|XP_006286547.1| hypothetical protein CARUB_v10001792mg [Capsella rubella]
 gb|EOA19445.1| hypothetical protein CARUB_v10001792mg [Capsella rubella]
Length=252

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 138/181 (76%), Gaps = 3/181 (2%)
 Frame = -2

Query  942  QIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCI  763
            Q+  L + DQ + K+  +EV       +H G CAICL+ I LQETA+VKGCEHAYCVTCI
Sbjct  12   QLDVLPLHDQDERKT--QEVGNEQSFGNHGGCCAICLDTIPLQETAMVKGCEHAYCVTCI  69

Query  762  LRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqp  583
            LRWA+YK++PTCPQCK PF+FLN+HRALDGS+ D+MFEESVCLLLRA+WFQPL  VE   
Sbjct  70   LRWASYKEKPTCPQCKLPFDFLNVHRALDGSVEDFMFEESVCLLLRAAWFQPLEAVERVS  129

Query  582  evddyvddfyl-ydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRP  406
            + D++  DF +  +  E+E+DD  + ++   S++RLGNRRWGDNG+VRAGRQEARPV   
Sbjct  130  DNDNFNYDFDIPPEYEEEEDDDDLDEFYLQGSNLRLGNRRWGDNGFVRAGRQEARPVQHK  189

Query  405  N  403
            N
Sbjct  190  N  190



>emb|CDX78482.1| BnaA03g03940D [Brassica napus]
Length=264

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 136/197 (69%), Gaps = 13/197 (7%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMK-STAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M+++ +I V     Q++ LS+ DQ + K       L  G   +H G CAICL+ I LQET
Sbjct  1    MSSSIQIVVE---TQVEALSLKDQDEKKIEIVSNELSFG---NHGGCCAICLDTIPLQET  54

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEHAYCVTCILRWA+YK++PTCPQCKHPF+FLN+HRALDGS+ D+MFEESVCLLL
Sbjct  55   AMVKGCEHAYCVTCILRWASYKEKPTCPQCKHPFDFLNVHRALDGSVEDFMFEESVCLLL  114

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS------SSSIRLGNRR  466
            RASWF PL  VE      +   DF +   +   E + ++   D        S++RLGNRR
Sbjct  115  RASWFLPLEAVERVSYNGNDNYDFDIPPEYIPPEYEEEDDEDDLDEFYLHGSNLRLGNRR  174

Query  465  WGDNGYVRAGRQEARPV  415
            WGDNG+VR+GRQEARP 
Sbjct  175  WGDNGFVRSGRQEARPA  191



>ref|XP_002871884.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48143.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 138/193 (72%), Gaps = 4/193 (2%)
 Frame = -2

Query  984  MATAAEI-GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M++  EI    Q+++ IQD+S+ +Q K K   EE+      N H G CAICL++I LQET
Sbjct  1    MSSVTEIVSEQQVIDGIQDMSLQNQDK-KKIQEEIHEPSFGN-HGGCCAICLSEIPLQET  58

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEH YCVTCILRWA+ K+ PTCPQCKHPF+FL++HRALDGSI D++FEESVCLLL
Sbjct  59   AMVKGCEHTYCVTCILRWASCKESPTCPQCKHPFDFLSVHRALDGSIEDFLFEESVCLLL  118

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RASWF PL  V E         D +      ++EDD  + ++   SS+R+GNRRWG NG+
Sbjct  119  RASWFVPL-DVVELASYSYGYHDDFDIPCDYEDEDDDLDEFYLHGSSLRIGNRRWGGNGF  177

Query  447  VRAGRQEARPVNR  409
            VR+GRQEARPV R
Sbjct  178  VRSGRQEARPVQR  190



>ref|XP_009131277.1| PREDICTED: uncharacterized protein LOC103855973 [Brassica rapa]
 ref|XP_009131278.1| PREDICTED: uncharacterized protein LOC103855973 [Brassica rapa]
Length=264

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 136/197 (69%), Gaps = 13/197 (7%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMK-STAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M+++ +I V     Q++ LS+ DQ + K       L  G   +H G CAICL+ I LQET
Sbjct  1    MSSSIQIVVE---TQVEALSLKDQDEKKIEIVSNELSFG---NHGGCCAICLDTIPLQET  54

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEHAYCVTCILRWA+YK++PTCPQCKHPF+FLN+HRALDGS+ D+MFEESVCLLL
Sbjct  55   AMVKGCEHAYCVTCILRWASYKEKPTCPQCKHPFDFLNVHRALDGSVEDFMFEESVCLLL  114

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS------SSSIRLGNRR  466
            RASWF PL  VE      +   DF +   +   E + ++   D        S++RLGNRR
Sbjct  115  RASWFLPLEAVERVSYNGNDNYDFDIPPEYIPPEYEEEDDEDDLDEFYLHGSNLRLGNRR  174

Query  465  WGDNGYVRAGRQEARPV  415
            WGDNG+VR+GRQEARP 
Sbjct  175  WGDNGFVRSGRQEARPA  191



>emb|CDM86606.1| unnamed protein product [Triticum aestivum]
Length=280

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL++I LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LD 
Sbjct  41   GVCAICLDRIPLQETALVKGCDHAYCVTCILRWASYKQTPVCPQCKHPFEFLSVHRSLDS  100

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             ++DYMF+ESVCLLLRA+WF+PL  VE   E  +  D +  Y     +EDDL E Y   S
Sbjct  101  CLHDYMFDESVCLLLRATWFKPL-AVEAHEEAQEEEDIYRSYQYDYGDEDDLYEEYISRS  159

Query  492  SSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
             SIR+GNRRWGDNGYVR GR+EARPV  P     DA PSR PKKKE
Sbjct  160  PSIRIGNRRWGDNGYVRGGRREARPVVIPPV--VDAVPSRTPKKKE  203



>emb|CDX70471.1| BnaC03g05550D [Brassica napus]
Length=265

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 135/197 (69%), Gaps = 13/197 (7%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMK-STAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M+++ +I V     Q++ LS+ DQ + K       L  G   +H G CAICL+ I LQET
Sbjct  1    MSSSIQIVVE---TQVEALSLKDQDEKKIEIVSNELSFG---NHGGCCAICLDTIPLQET  54

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEHAYCVTCILRWA+YK++PTCPQCKHPF+FLN+HR LDGS+ D+MFEESVCLLL
Sbjct  55   AMVKGCEHAYCVTCILRWASYKEKPTCPQCKHPFDFLNVHRTLDGSVEDFMFEESVCLLL  114

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS------SSSIRLGNRR  466
            RASWF PL  VE      +   DF +   +   E + ++   D        S++RLGNRR
Sbjct  115  RASWFLPLEAVERVSYNGNDNYDFDIPPEYIPPEYEEEDEDDDLDEFYLHGSNLRLGNRR  174

Query  465  WGDNGYVRAGRQEARPV  415
            WGDNG+VR+GRQEARP 
Sbjct  175  WGDNGFVRSGRQEARPA  191



>ref|XP_003565098.2| PREDICTED: uncharacterized protein LOC100841314 [Brachypodium 
distachyon]
Length=354

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 131/168 (78%), Gaps = 9/168 (5%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG
Sbjct  126  GVCAICLDKIPLQETALVKGCDHAYCVTCILRWASYKESPLCPQCKHPFEFLSVHRSLDG  185

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             I+DY+F+ESVCLLLRA+WF+PLVV   +  +D+    +  Y   E +EDDL E  +  S
Sbjct  186  CIHDYLFDESVCLLLRATWFEPLVVEPHEEVLDEEEIFYRHYQYEEHDEDDLYEETYYMS  245

Query  492  SS--IRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
             S  +R+GNRRWGDNGY+R GR+EARPV       S+A PSR PKKKE
Sbjct  246  RSPIVRIGNRRWGDNGYIRGGRREARPV-------SNAVPSRTPKKKE  286



>tpg|DAA55776.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=283

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 131/167 (78%), Gaps = 5/167 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL++  LQETALVKG +H YCVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG
Sbjct  47   GVCAICLDRKALQETALVKGWDHPYCVTCILRWASYKENPLCPQCKHPFEFLSVHRSLDG  106

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
             ++DY+FEESVCLLLRA+WF+PL+V   +  +++       Y   +DE+D  +E+Y+ + 
Sbjct  107  CLHDYLFEESVCLLLRAAWFEPLIVEAHEEALEEEEFLHQQYQYDDDEDDLDEESYYMNR  166

Query  492  S-SIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            S SIR+GNRRWGDNGY+R GR+EARPVN     D  AGPSR PKKKE
Sbjct  167  SPSIRIGNRRWGDNGYIRGGRKEARPVN----TDVAAGPSRTPKKKE  209



>gb|KFK25505.1| hypothetical protein AALP_AA8G123400 [Arabis alpina]
Length=252

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 131/186 (70%), Gaps = 4/186 (2%)
 Frame = -2

Query  954  QLVN--QIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHA  781
            Q+V+  Q++  S+ DQ  +K T E    V   N H G CAICL+ I LQETA+VKGCEHA
Sbjct  6    QIVDEKQVEASSLQDQD-VKKTGEVGNEVSFGN-HGGCCAICLDTIPLQETAMVKGCEHA  63

Query  780  YCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLv  601
            YCVTCILRWA+YK++ TCPQC HPF+FLN+HR LDGS+ D+MFEESVCLLLRASWF PL 
Sbjct  64   YCVTCILRWASYKEKHTCPQCNHPFDFLNVHRTLDGSVEDFMFEESVCLLLRASWFVPLE  123

Query  600  vveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEAR  421
             V+     D            E+E+DD  E ++   +  RLGNRRWGDNG+VRAGRQEAR
Sbjct  124  AVDRFSGTDTDDFVIPPEYEEEEEDDDEIEEFYMHGAGPRLGNRRWGDNGFVRAGRQEAR  183

Query  420  PVNRPN  403
            PV+  N
Sbjct  184  PVHPKN  189



>ref|XP_009121860.1| PREDICTED: uncharacterized protein LOC103846649 [Brassica rapa]
 emb|CDX69690.1| BnaA10g20390D [Brassica napus]
Length=261

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 136/189 (72%), Gaps = 3/189 (2%)
 Frame = -2

Query  978  TAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALV  799
            +++ I +   +NQ + LS  DQ   K  AE V       +H G CAICL+ I LQETA+V
Sbjct  2    SSSLIQIVDDLNQAEFLSPGDQDGKK--AELVSSELSFGNHGGCCAICLDTIPLQETAMV  59

Query  798  KGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRAS  619
            KGCEHAYCVTCILRWA+YK+  TCPQCKHPF+FLN+HRALDGS+ D+MFEESVCLLLRAS
Sbjct  60   KGCEHAYCVTCILRWASYKEIHTCPQCKHPFDFLNVHRALDGSVEDFMFEESVCLLLRAS  119

Query  618  WFQPLvvveeqpevddyvddfyl-ydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVR  442
            WF+PL  VE     D    DF +  +  E+E+DD D   F   SS+RLGNRRWGDNG+VR
Sbjct  120  WFKPLEAVERVSYHDIDNYDFDIPPEYEEEEDDDDDLDEFLHGSSLRLGNRRWGDNGFVR  179

Query  441  AGRQEARPV  415
            +GRQEARP 
Sbjct  180  SGRQEARPA  188



>ref|XP_010493004.1| PREDICTED: uncharacterized protein LOC104770302 [Camelina sativa]
Length=256

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = -2

Query  984  MATAAEI-GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M++ AEI    Q+++ IQ+L++ DQ   K   E ++      +H G CAICL+ I LQET
Sbjct  1    MSSVAEIVSEQQVIDGIQELALKDQDN-KQIQEVMIHEPSFGNHGGCCAICLSDIPLQET  59

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEH YCVTCILRWA+ K+ PTCPQCK+PF+FL++HRALDGSI D++FEESVCLLL
Sbjct  60   AMVKGCEHTYCVTCILRWASCKESPTCPQCKNPFDFLSVHRALDGSIEDFLFEESVCLLL  119

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RASWF PL  V EQ       +D +      ++EDD  + ++   +S+R+GNRRWG NG+
Sbjct  120  RASWFVPL-DVMEQASYSHGYNDDFDIPCDYEDEDDDLDEFYLHGASLRIGNRRWGGNGF  178

Query  447  VRAGRQEARPVNR  409
            VR+GRQEARPV R
Sbjct  179  VRSGRQEARPVQR  191



>emb|CDX70467.1| BnaC03g05510D [Brassica napus]
Length=264

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 135/197 (69%), Gaps = 13/197 (7%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMK-STAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M+++ +I V     Q++ LS+ DQ + K       L  G   +H G CAICL+ I LQET
Sbjct  1    MSSSIQIVVE---TQVEALSLKDQDEKKIEIVSNELSFG---NHGGCCAICLDTIPLQET  54

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEHAYCVTCILRWA+YK++PTCPQCKHPF+FLN+HRALDGS+ D+MFEESVCLLL
Sbjct  55   AMVKGCEHAYCVTCILRWASYKEKPTCPQCKHPFDFLNVHRALDGSVEDFMFEESVCLLL  114

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS------SSSIRLGNRR  466
             ASWF PL  VE      +   DF +   +   E + ++   D        S++RLGNRR
Sbjct  115  CASWFLPLEAVERVSYNGNDNYDFDIPPEYIPPEYEEEDDEDDLDEFYLHGSNLRLGNRR  174

Query  465  WGDNGYVRAGRQEARPV  415
            WGDNG+VR+GRQEARP 
Sbjct  175  WGDNGFVRSGRQEARPA  191



>ref|XP_010420744.1| PREDICTED: uncharacterized protein LOC104706267 [Camelina sativa]
 ref|XP_010420745.1| PREDICTED: uncharacterized protein LOC104706267 [Camelina sativa]
Length=254

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 138/193 (72%), Gaps = 3/193 (2%)
 Frame = -2

Query  984  MATAAEI-GVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            M++ AEI    Q+++ IQ+L++ DQ   K   E ++      +H G CAICL++I LQET
Sbjct  1    MSSVAEIVSEQQVIDGIQELALKDQDN-KKIHEVMIHEPSFGNHGGCCAICLSEIPLQET  59

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLL  628
            A+VKGCEH YCVTCILRWA+ K+ PTCPQCK+PF+FL++HRALDGSI D++FEESVCLLL
Sbjct  60   AMVKGCEHTYCVTCILRWASCKESPTCPQCKNPFDFLSVHRALDGSIEDFLFEESVCLLL  119

Query  627  RASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGY  448
            RASWF PL  V EQ        D        ++EDD  + ++   +S+R+GNRRWG NG+
Sbjct  120  RASWFIPL-DVMEQASYSFGYHDDLDIPCDYEDEDDDLDEFYLHGASLRIGNRRWGGNGF  178

Query  447  VRAGRQEARPVNR  409
            VR+GRQEARPV R
Sbjct  179  VRSGRQEARPVQR  191



>ref|XP_010555026.1| PREDICTED: uncharacterized protein LOC104824623 [Tarenaya hassleriana]
Length=253

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 130/182 (71%), Gaps = 4/182 (2%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            QL   + DLS+ DQ   K   +         +H G CAICL+KI LQETA+VKGCEH+YC
Sbjct  8    QLTETLGDLSLQDQEDTKVGGQ--THPPSFGNHGGCCAICLDKIPLQETAMVKGCEHSYC  65

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            V CILRWA+Y ++PTCPQCK+PF+FLN+HRALDGSI D+MFEESVCLLLRASWFQPL V 
Sbjct  66   VMCILRWASYVEKPTCPQCKNPFDFLNVHRALDGSIQDFMFEESVCLLLRASWFQPLDVE  125

Query  594  eeqpevddyvddfy--lydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEAR  421
            E   + D +        YD   + EDD  + Y+   SS+R+GNRRWG +GYVR+GRQEAR
Sbjct  126  ERVSQDDGFEYFDIPCEYDIPCEYEDDDLDEYYLCGSSVRIGNRRWGGSGYVRSGRQEAR  185

Query  420  PV  415
            PV
Sbjct  186  PV  187



>ref|XP_010454216.1| PREDICTED: uncharacterized protein LOC104736009 isoform X2 [Camelina 
sativa]
Length=257

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 134/182 (74%), Gaps = 2/182 (1%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            Q+++ IQ+L++ DQ   K   E +++     +H G CAICL++I LQETA++KGCEH YC
Sbjct  13   QVIDGIQELALKDQDNRK-IQEVMIQEPSFGNHGGCCAICLSEIPLQETAMIKGCEHTYC  71

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            VTCILRWA+ K+ PTCPQCK+PF+FL++HRALDGSI D++FEESVCLLLRASWF PL  V
Sbjct  72   VTCILRWASCKESPTCPQCKNPFDFLSVHRALDGSIEDFLFEESVCLLLRASWFVPL-DV  130

Query  594  eeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPV  415
             EQ        D +      ++EDD  + ++   +S+R+GNRRWG NG+VR+GRQEARPV
Sbjct  131  MEQTSYSYGYHDDFDIPCDYEDEDDDLDEFYLHGASLRIGNRRWGGNGFVRSGRQEARPV  190

Query  414  NR  409
             R
Sbjct  191  QR  192



>emb|CDX97183.1| BnaC09g44420D [Brassica napus]
Length=258

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 132/189 (70%), Gaps = 4/189 (2%)
 Frame = -2

Query  975  AAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVK  796
            ++ I +   V Q + +S  DQ   K  AE V       +H G CAICL+ I LQETA+VK
Sbjct  2    SSSIQIVDDVKQAEIVSPVDQDGKK--AELVSNELSFGNHGGCCAICLDTIPLQETAMVK  59

Query  795  GCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASW  616
            GCEHAYCVTCILRWA+YK+  TCPQCKHPF+FLN+HRALDGS+ D+MFEESVCLLLRASW
Sbjct  60   GCEHAYCVTCILRWASYKEIHTCPQCKHPFDFLNVHRALDGSLEDFMFEESVCLLLRASW  119

Query  615  FQPLvvveeqpevddyvddfyl--ydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVR  442
            F+PL  VE     D    DF +      E+++DD D   F   SS+RLGNRRWGDNG+VR
Sbjct  120  FKPLEAVERVSYNDIDNYDFDIPPEYEEEEDDDDDDLDEFLHGSSLRLGNRRWGDNGFVR  179

Query  441  AGRQEARPV  415
            +GRQE RP 
Sbjct  180  SGRQEVRPA  188



>gb|EYU46200.1| hypothetical protein MIMGU_mgv1a013031mg [Erythranthe guttata]
Length=232

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 145/232 (63%), Gaps = 42/232 (18%)
 Frame = -2

Query  984  MATAAEIGVPQLVNQIQDLSIPDQSKMK------STAEEVLRVGCENDHHG------LCA  841
            M+   EI  PQLV    D +I  Q++ +      S  E   + GC  ++         CA
Sbjct  1    MSATLEIVSPQLVEGFHDPAIETQTETEAKNCSLSVHEINQQGGCGINNVNINNHHGFCA  60

Query  840  ICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYD  661
            IC N IVLQETALVKGCEHAYCVTCILRWA+ KKEPTCPQCK PF FLNIHR+LDGSI+D
Sbjct  61   ICWNTIVLQETALVKGCEHAYCVTCILRWASCKKEPTCPQCKIPFSFLNIHRSLDGSIHD  120

Query  660  YMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIR  481
            YMFEESVCLLLRASWF P+       EV+  V D      ++DEE+DL+  YF++SSS+R
Sbjct  121  YMFEESVCLLLRASWFNPI------VEVEKEVVDKVEAYYYDDEEEDLNGFYFNNSSSVR  174

Query  480  LGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE---PSKEIMG  334
            +GNRRWGDNG                      GPSRQPKKKE   P KE +G
Sbjct  175  IGNRRWGDNG---------------------VGPSRQPKKKEKETPDKEPVG  205



>ref|XP_006288184.1| hypothetical protein CARUB_v10001420mg [Capsella rubella]
 gb|EOA21082.1| hypothetical protein CARUB_v10001420mg [Capsella rubella]
Length=329

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 134/182 (74%), Gaps = 2/182 (1%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            Q+++ I +L++  Q K K   +EV+      +H G CAICL++I LQETA+VKGCEH YC
Sbjct  87   QVIDGIPELALQHQDKKK--IQEVIHEPSFGNHGGCCAICLSEIPLQETAMVKGCEHTYC  144

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            VTCILRWA+ K+ PTCPQCK+PF+FL++HRAL+GSI D++FEESVCLLLRASWF PL VV
Sbjct  145  VTCILRWASCKESPTCPQCKNPFDFLSVHRALNGSIEDFLFEESVCLLLRASWFVPLDVV  204

Query  594  eeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPV  415
             EQ        D +      +++DD  + ++   SS+R+GNRRWG NG+VR+GR+EARPV
Sbjct  205  VEQASYSYGYHDDFDIPCDYEDDDDDLDEFYLHGSSLRIGNRRWGGNGFVRSGRREARPV  264

Query  414  NR  409
             R
Sbjct  265  QR  266



>ref|XP_010454215.1| PREDICTED: uncharacterized protein LOC104736009 isoform X1 [Camelina 
sativa]
Length=260

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQ--SKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHA  781
            Q+++ IQ+L++ DQ     +   E +++     +H G CAICL++I LQETA++KGCEH 
Sbjct  13   QVIDGIQELALKDQLVQDNRKIQEVMIQEPSFGNHGGCCAICLSEIPLQETAMIKGCEHT  72

Query  780  YCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLv  601
            YCVTCILRWA+ K+ PTCPQCK+PF+FL++HRALDGSI D++FEESVCLLLRASWF PL 
Sbjct  73   YCVTCILRWASCKESPTCPQCKNPFDFLSVHRALDGSIEDFLFEESVCLLLRASWFVPL-  131

Query  600  vveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEAR  421
             V EQ        D +      ++EDD  + ++   +S+R+GNRRWG NG+VR+GRQEAR
Sbjct  132  DVMEQTSYSYGYHDDFDIPCDYEDEDDDLDEFYLHGASLRIGNRRWGGNGFVRSGRQEAR  191

Query  420  PVNR  409
            PV R
Sbjct  192  PVQR  195



>ref|NP_001190339.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED92706.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=240

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -2

Query  864  NDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHR  685
             +H G CAICL++I LQETA+VKGCEH YCVTCILRWA+ K+ PTCPQCKHPF+FL++HR
Sbjct  25   GNHGGCCAICLSEIPLQETAMVKGCEHTYCVTCILRWASCKESPTCPQCKHPFDFLSVHR  84

Query  684  ALDGSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeay  505
            ALDGSI D++FEESVCLLLRASWF PL  V EQ        D +      ++EDD  + +
Sbjct  85   ALDGSIEDFLFEESVCLLLRASWFVPL-DVVEQASYSHGYHDDFDIPYDYEDEDDDLDEF  143

Query  504  fDSSSSIRLGNRRWGDNGYVRAGRQEARPVNR  409
            +   SS+R+GNRRWG NG+VR+GRQEARPV R
Sbjct  144  YLHGSSLRIGNRRWGGNGFVRSGRQEARPVQR  175



>gb|KFK26206.1| hypothetical protein AALP_AA8G216300 [Arabis alpina]
Length=256

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 133/181 (73%), Gaps = 11/181 (6%)
 Frame = -2

Query  948  VNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVT  769
            VN +QD         ++  +E +R      H G CAICLN+I LQETA+VKGCEH YCVT
Sbjct  22   VNLVQD---------ENKNQEEIREPSFGSHGGCCAICLNEIPLQETAMVKGCEHTYCVT  72

Query  768  CILRWATYKKE-PTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvve  592
            CIL WA+YK++ PTCPQCKHPF+FL++HRALDGSI D++FEESVCLLLRASWF PL V E
Sbjct  73   CILNWASYKEDNPTCPQCKHPFDFLSVHRALDGSIEDFLFEESVCLLLRASWFLPLDVSE  132

Query  591  eqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVN  412
                   Y DDF +   +EDE+DDLDE Y     S+R+GNRRWGDNG+VR+GRQEARPV 
Sbjct  133  LASYSHGYHDDFDIPCDYEDEDDDLDEFYLR-GPSLRIGNRRWGDNGFVRSGRQEARPVK  191

Query  411  R  409
            +
Sbjct  192  K  192



>ref|XP_010248257.1| PREDICTED: uncharacterized protein LOC104591167 [Nelumbo nucifera]
Length=200

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  780  YCVTCILRWATYKKEPTCP----QCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWF  613
            Y VTCILRWATY ++PTCP    QCKHPFE LN+HR+LDGSI+DYMFEESVCLLLRASWF
Sbjct  15   YSVTCILRWATYNQKPTCPPSCPQCKHPFESLNVHRSLDGSIHDYMFEESVCLLLRASWF  74

Query  612  QPLvvveeqpevddyvddfylydgfedeeddldeayfD---SSSSIRLGNRRWGDNGYVR  442
             PL V  ++   D++ D +     +E E+++ D+       SSSSIR+GNRRWGDNGYVR
Sbjct  75   TPLAVEVQEEVYDEFDDLYEYQYEYEYEDEEDDDLDEGYFISSSSIRIGNRRWGDNGYVR  134

Query  441  AGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            AGR+EARPVNR NF+D+ AGPS   KKKE  K+  G
Sbjct  135  AGRKEARPVNRENFQDNGAGPSHGSKKKEAVKDTTG  170



>ref|XP_008803342.1| PREDICTED: uncharacterized protein LOC103716918 isoform X2 [Phoenix 
dactylifera]
Length=193

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            VTCILRWATY ++P+CPQCKHPFE L++HR+LDG I+DYMFEESVCLLLRA+WF PL V 
Sbjct  16   VTCILRWATYNQKPSCPQCKHPFESLHVHRSLDGCIHDYMFEESVCLLLRATWFVPLTVQ  75

Query  594  eeqpevdd-yvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARP  418
             ++    + +    Y  D  +D+++  +  Y   SSSIR+GNRRWGDNGYVRAGR+EARP
Sbjct  76   TQEEASAEPHDYAQYYDDQDDDDDEIDESYYIGGSSSIRIGNRRWGDNGYVRAGRKEARP  135

Query  417  VNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            VNR   +DS AGPS+ PKKKEPSK+  G
Sbjct  136  VNRQFLDDSGAGPSQCPKKKEPSKDATG  163



>ref|XP_006827514.1| PREDICTED: uncharacterized protein LOC18422960 [Amborella trichopoda]
 gb|ERM94930.1| hypothetical protein AMTR_s00009p00186290 [Amborella trichopoda]
Length=227

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = -2

Query  855  HGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALD  676
            HG CAICL KI+L+ETA V GCEHAYC TCILRWA+Y   P+CPQCKHPF  L +HR+LD
Sbjct  25   HGFCAICLEKILLEETAHVTGCEHAYCATCILRWASYNANPSCPQCKHPFLSLLVHRSLD  84

Query  675  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  496
            G I+DYMFEESVCLLLRA W+ P+     + + +   +       ++D +D +++A++ +
Sbjct  85   GRIHDYMFEESVCLLLRAPWYTPV---TLETQKEAIEEQEEHQYEYDDVDDYVEDAFYGN  141

Query  495  SSSIRLGNRRWGDNGYVRAGRQEARP-VNRPNFEDSDAGPSRQPKKKEPS  349
             + +R+GNRRWGD GYVRAGR+EA P V R      +AG S + + K+P+
Sbjct  142  MAGLRIGNRRWGDGGYVRAGRKEAMPIVERARSHGQEAGGSSRAQGKKPA  191



>ref|XP_006399745.1| hypothetical protein EUTSA_v10014482mg [Eutrema salsugineum]
 gb|ESQ41198.1| hypothetical protein EUTSA_v10014482mg [Eutrema salsugineum]
Length=196

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  804  LVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLR  625
            +VKGCEHAYCVTCILRWA+YK++PTCPQCKHPF+FLN+HRALDGS+ D+MFEESVCLLLR
Sbjct  1    MVKGCEHAYCVTCILRWASYKEKPTCPQCKHPFDFLNVHRALDGSVEDFMFEESVCLLLR  60

Query  624  ASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYV  445
            ASWFQPL  VE   + D +  DF +   +EDE+DD  + ++   SS+RLGNRRWGDNG+V
Sbjct  61   ASWFQPLDAVERVSDNDIHNYDFEIPPEYEDEDDDDLDEFYLHGSSLRLGNRRWGDNGFV  120

Query  444  RAGRQEARPVN  412
            R+GRQEARPV 
Sbjct  121  RSGRQEARPVQ  131



>gb|KDO54837.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=195

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 113/147 (77%), Gaps = 4/147 (3%)
 Frame = -2

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
             TCILRWA+Y + PTCPQCKHPFEFL++HR+LDGSI DYMFEESVCLLLRA+WF+PL   
Sbjct  16   ATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPL---  72

Query  594  eeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPV  415
                +     DD      +EDEEDDLDE YF SSSS+R+GNRRWGDNGYVRAGRQEARPV
Sbjct  73   -IVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAGRQEARPV  131

Query  414  NRPNFEDSDAGPSRQPKKKEPSKEIMG  334
             RPN +D  A  SR+PKKKE +K   G
Sbjct  132  CRPNSQDVGASSSREPKKKEVAKVTTG  158



>ref|XP_009340142.1| PREDICTED: uncharacterized protein LOC103932304 isoform X2 [Pyrus 
x bretschneideri]
Length=196

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = -2

Query  792  CEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWF  613
            C      TCILRW TY ++PTCPQCKHPFEFLN+HR+LDGSI DYMFEESVCLLLRA WF
Sbjct  15   CNITISATCILRWVTYSQKPTCPQCKHPFEFLNVHRSLDGSIQDYMFEESVCLLLRAKWF  74

Query  612  QPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGR  433
            +  +VVEE+ EV +  +D+Y Y   +++EDDLD+AYF SSS IR+GNRRWGDNGYVR+GR
Sbjct  75   E-PLVVEEREEVYEGHEDYYYYPYEDEDEDDLDDAYFSSSSVIRIGNRRWGDNGYVRSGR  133

Query  432  QEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            QEARPV+R + +DS A  SR+P+KKE + +  G
Sbjct  134  QEARPVHRSSTQDSGASSSREPRKKEAAMDKTG  166



>gb|ABK22142.1| unknown [Picea sitchensis]
Length=249

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 127/208 (61%), Gaps = 18/208 (9%)
 Frame = -2

Query  945  NQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTC  766
            N +   ++ D+ K  +T +    +  + D   LCAICL+ I  +ETA +KGC H YCVTC
Sbjct  24   NAVACETVQDEEKQSNTPKVAALL--DADDSWLCAICLDTIQPEETAQIKGCGHNYCVTC  81

Query  765  ILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeq  586
            ILRWA+Y   P CPQCKH F  L ++RALDGS++DYM EES+CLLLRASWF+ L      
Sbjct  82   ILRWASYVANPWCPQCKHSFSSLFVYRALDGSMHDYMLEESICLLLRASWFELL------  135

Query  585  pevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVN--  412
                         +  +   +D  +  +  +S++RLGNRRWGD+GYVRAGR+EARPV   
Sbjct  136  ------PLQEAYDEQDDYPYEDEIDEEYYGTSNVRLGNRRWGDSGYVRAGRKEARPVGTR  189

Query  411  RPNFEDSDAGPS--RQPKKKEPSKEIMG  334
            + +  + +AG S  R  K KE SK+  G
Sbjct  190  QGHGANHEAGGSSARASKGKEVSKDAGG  217



>gb|EPS60559.1| hypothetical protein M569_14245, partial [Genlisea aurea]
Length=199

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 118/187 (63%), Gaps = 12/187 (6%)
 Frame = -2

Query  951  LVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCV  772
            L+  ++ L I DQ+    T+  V  +    DH   C IC NKI LQETAL+KGCEH +CV
Sbjct  13   LIQPMETLDILDQTNKIGTSNVVEELHHRLDH---CPICWNKIELQETALIKGCEHPHCV  69

Query  771  TCILRWATYKKEPT----CPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            TCILRW + K E      CP CK  FE L +HRALDGS++DY+ EESVCLLLRASWF P 
Sbjct  70   TCILRWVSIKNEQNEEFRCPMCKLRFESLYVHRALDGSLHDYLHEESVCLLLRASWFNP-  128

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEA  424
                      D VD+      + +E  + DE Y    SSIR+GNRR+G+ GYVR+GRQEA
Sbjct  129  ----SIVVERDEVDEETEDYYYYEEGAEADEFYLSRPSSIRIGNRRFGEQGYVRSGRQEA  184

Query  423  RPVNRPN  403
            RPVNR N
Sbjct  185  RPVNRIN  191



>gb|KCW87218.1| hypothetical protein EUGRSUZ_B03731 [Eucalyptus grandis]
Length=194

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = -2

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            VTCILRWA+ K+ PTCPQCKHPF+FLN+HR LDGSI DYMFEESVCLLLRA+WF PL   
Sbjct  16   VTCILRWASCKERPTCPQCKHPFDFLNVHRLLDGSIRDYMFEESVCLLLRATWFMPL--E  73

Query  594  eeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPV  415
                +  D ++D+  Y+   ++EDD  E  + +S SIR+GNRRWGDNGYVRAGRQEARPV
Sbjct  74   VHYEDTYDPLEDYCPYEDEVEDEDDDLEEAYFNSPSIRIGNRRWGDNGYVRAGRQEARPV  133

Query  414  NRPNFEDSDA-GPSRQPKKKE-PSKEIMG  334
             R N +D  A   S QPKKKE  +KE +G
Sbjct  134  YRANPQDEGASSSSHQPKKKEVAAKETVG  162



>gb|EMT03322.1| hypothetical protein F775_30097 [Aegilops tauschii]
Length=215

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 108/143 (76%), Gaps = 3/143 (2%)
 Frame = -2

Query  783  AYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
             +CVTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG ++DYMF+ESVCLLLRA+WF+PL
Sbjct  8    GFCVTCILRWASYKQTPVCPQCKHPFEFLSVHRSLDGCLHDYMFDESVCLLLRATWFKPL  67

Query  603  vvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEA  424
             VVE   E  +  D +  Y   + +EDDL E Y   S SIR+GNRRWGDNGYVR GR+EA
Sbjct  68   -VVEAHEEAQEEEDIYRSYQYDDGDEDDLYEEYISRSPSIRIGNRRWGDNGYVRGGRREA  126

Query  423  RPVNRPNFEDSDAGPSRQPKKKE  355
            RPV  P     DA PSR PKKKE
Sbjct  127  RPVVIPPV--VDAVPSRTPKKKE  147



>gb|AIA26132.1| ring finger-like protein, partial [Phyllostachys edulis]
 gb|AIA26133.1| ring finger-like protein, partial [Phyllostachys edulis]
 gb|AIA26134.1| ring finger-like protein, partial [Phyllostachys edulis]
 gb|AIA26135.1| ring finger-like protein, partial [Phyllostachys edulis]
Length=145

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KIVLQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPF+FL++HR+LDG
Sbjct  17   GVCAICLDKIVLQETALVKGCDHAYCVTCILRWASYKQAPLCPQCKHPFDFLSVHRSLDG  76

Query  672  SIYDYMFEESVCLLLRASWFQPL  604
             I+DY+FEESV LLLRA+WF+PL
Sbjct  77   CIHDYLFEESVTLLLRATWFEPL  99



>gb|AIA26130.1| ring finger-like protein, partial [Phyllostachys nigra var. henonis]
Length=129

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KIVLQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPF+FL++HR+LDG
Sbjct  17   GVCAICLDKIVLQETALVKGCDHAYCVTCILRWASYKQAPLCPQCKHPFDFLSVHRSLDG  76

Query  672  SIYDYMFEESVCLLLRASWFQPL  604
             I+DY FEESV LLLRA+WF+PL
Sbjct  77   CIHDYXFEESVTLLLRATWFEPL  99



>gb|AIA26131.1| ring finger-like protein, partial [Phyllostachys nidularia]
Length=145

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPF+FL++HR+LDG
Sbjct  17   GVCAICLDKIALQETALVKGCDHAYCVTCILRWASYKQAPLCPQCKHPFDFLSVHRSLDG  76

Query  672  SIYDYMFEESVCLLLRASWFQPL  604
             I+DY+FEESV LLLRA+WF+PL
Sbjct  77   CIHDYLFEESVTLLLRATWFEPL  99



>gb|AIA26125.1| ring finger-like protein, partial [Fargesia spathacea]
 gb|AIA26126.1| ring finger-like protein, partial [Fargesia nitida]
 gb|AIA26127.1| ring finger-like protein, partial [Fargesia nitida]
 gb|AIA26128.1| ring finger-like protein, partial [Fargesia nitida]
 gb|AIA26129.1| ring finger-like protein, partial [Fargesia nitida]
Length=145

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPF+FL++HR+LDG
Sbjct  17   GVCAICLDKIALQETALVKGCDHAYCVTCILRWASYKQAPLCPQCKHPFDFLSVHRSLDG  76

Query  672  SIYDYMFEESVCLLLRASWFQPL  604
             I+DY+FEESV LLLRA+WF+PL
Sbjct  77   CIHDYLFEESVTLLLRATWFEPL  99



>gb|EMS60622.1| hypothetical protein TRIUR3_12364 [Triticum urartu]
Length=231

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = -2

Query  777  CVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvv  598
             VTCILRWA+YK+ P CPQCKHPFEFL++HR+LDG ++DYMF+ESVCLLLRA+WF+PL V
Sbjct  18   TVTCILRWASYKQTPVCPQCKHPFEFLSVHRSLDGCLHDYMFDESVCLLLRATWFKPL-V  76

Query  597  veeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARP  418
            VE   E  +  D +  Y   + +EDDL E Y   S SIR+GNRRWGDNGYVR GR+EARP
Sbjct  77   VEAHEEAQEEEDIYRSYQYDDGDEDDLYEEYISRSPSIRIGNRRWGDNGYVRGGRREARP  136

Query  417  VNRPNFEDSDAGPSRQPKKKE  355
            V  P     DA PSR PKKKE
Sbjct  137  VVIPPV--VDAVPSRTPKKKE  155



>ref|XP_002987496.1| hypothetical protein SELMODRAFT_446999 [Selaginella moellendorffii]
 gb|EFJ11332.1| hypothetical protein SELMODRAFT_446999 [Selaginella moellendorffii]
Length=268

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 105/164 (64%), Gaps = 14/164 (9%)
 Frame = -2

Query  888  EVLRVGCENDHHG-----LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCP  724
            E+   G     HG     LCAICL KI +++TA +KGC+HAYC  CILRWA+YK+ P CP
Sbjct  59   EIAAEGSSALKHGFSPSWLCAICLEKIRVEDTAQIKGCDHAYCANCILRWASYKESPWCP  118

Query  723  QCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylyd  544
            QCK PF  L + + LDG + D+M EESVCLLLR++WF+PL                    
Sbjct  119  QCKLPFSSLFVCKTLDGRMSDFMVEESVCLLLRSTWFKPL---------PPAAAQEPEDV  169

Query  543  gfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVN  412
                +ED+L E  +  +S++RLGNRRWGD+GYVR GR+EARPV+
Sbjct  170  EDYQDEDELYEEEYYYTSNVRLGNRRWGDSGYVRGGRKEARPVS  213



>ref|XP_001783242.1| predicted protein [Physcomitrella patens]
 gb|EDQ51937.1| predicted protein, partial [Physcomitrella patens]
Length=190

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 102/145 (70%), Gaps = 13/145 (9%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            CAICL++I L ET+ +KGCEH+YCVTCILRWA Y+    CPQC+ PF  + ++R+LDGS+
Sbjct  1    CAICLDRIKLAETSQIKGCEHSYCVTCILRWALYQNNTWCPQCRLPFTEMYVYRSLDGSL  60

Query  666  YDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSS  487
             DY+ EESVCLLLRASWF+ + V  +  E +DY +D    D +               S+
Sbjct  61   NDYLIEESVCLLLRASWFEGMPVFAQPEEPEDYYEDEEFDDYYF-------------KSN  107

Query  486  IRLGNRRWGDNGYVRAGRQEARPVN  412
            +R+GNRRWGDNGYVRAGR+EARPV 
Sbjct  108  VRIGNRRWGDNGYVRAGRREARPVG  132



>ref|XP_002992803.1| hypothetical protein SELMODRAFT_448908 [Selaginella moellendorffii]
 gb|EFJ06093.1| hypothetical protein SELMODRAFT_448908 [Selaginella moellendorffii]
Length=268

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 100/146 (68%), Gaps = 9/146 (6%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGS  670
            LCAICL KI +++TA +KGC+HAYC  CILRWA+YK+ P CPQCK PF  L + + LDG 
Sbjct  77   LCAICLEKIRVEDTAQIKGCDHAYCANCILRWASYKESPWCPQCKLPFSSLFVCKTLDGR  136

Query  669  IYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSS  490
            + D+M EESVCLLLR++WF+PL                        +ED+L E  +  +S
Sbjct  137  MSDFMVEESVCLLLRSTWFKPL---------PPAAAQEPEDVEDYQDEDELYEEEYYYTS  187

Query  489  SIRLGNRRWGDNGYVRAGRQEARPVN  412
            ++RLGNRRWGD+GYVR GR+EARPV+
Sbjct  188  NVRLGNRRWGDSGYVRGGRKEARPVS  213



>ref|XP_010097998.1| hypothetical protein L484_001486 [Morus notabilis]
 gb|EXB74316.1| hypothetical protein L484_001486 [Morus notabilis]
Length=242

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -2

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvv  595
            VTCIL+WATY K PTCPQCKH FEFLN+HR+LDGSI+DYMFEESVCLLLRASWF+PL V 
Sbjct  65   VTCILQWATYSKNPTCPQCKHRFEFLNVHRSLDGSIHDYMFEESVCLLLRASWFKPLTVE  124

Query  594  eeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEA--R  421
            E+     +  D  +  + + +++ D       SSS   +GNRRWGDNGYVR GRQEA  R
Sbjct  125  EQANAYSEIEDFDFFEEEYLEDDLDEVYYRSSSSSIR-IGNRRWGDNGYVRGGRQEARPR  183

Query  420  PVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            PV + NF+DS AG S Q  +KE +K   G
Sbjct  184  PVYQSNFQDSGAGSSSQSAQKEAAKSKTG  212



>ref|XP_002947166.1| hypothetical protein VOLCADRAFT_103400 [Volvox carteri f. nagariensis]
 gb|EFJ51756.1| hypothetical protein VOLCADRAFT_103400 [Volvox carteri f. nagariensis]
Length=284

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 102/198 (52%), Gaps = 17/198 (9%)
 Frame = -2

Query  918  DQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKK  739
            D +  K++A      G + D   +CAICLN I L++ A++KGCEH YCV CIL+WAT K+
Sbjct  32   DTALDKTSANASANKGSKVDISEVCAICLNTIELEDLAIIKGCEHEYCVNCILQWATCKE  91

Query  738  EPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvdd  559
             P CPQCK PF +L  HR LDG++ D   EESVCL+ RASWF   V   E+ +       
Sbjct  92   APWCPQCKKPFNYLYCHRLLDGTLSDMPVEESVCLMKRASWFVEYVKTMEKGKAISGSMA  151

Query  558  fyl-----------------ydgfedeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQ  430
                                    +++ +    +     + + LGNRR G+NGY+RAGR 
Sbjct  152  EEEIPAEWADPYQYYDDEEDEYDEDEQIEKYYFSSAAGRARVVLGNRRLGENGYMRAGRM  211

Query  429  EARPVNRPNFEDSDAGPS  376
             ARP    N   +    S
Sbjct  212  YARPTTNGNTSQASGSAS  229



>ref|XP_010097999.1| hypothetical protein L484_001487 [Morus notabilis]
 gb|EXB74317.1| hypothetical protein L484_001487 [Morus notabilis]
Length=210

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  774  VTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWFQPL  604
            VTCIL+WATY K PTCPQCKHPFEFLN+HR+LDGSI+DYMFEESVCLLLRASWF+PL
Sbjct  113  VTCILQWATYSKNPTCPQCKHPFEFLNVHRSLDGSIHDYMFEESVCLLLRASWFKPL  169



>ref|XP_001699127.1| hypothetical protein CHLREDRAFT_95886 [Chlamydomonas reinhardtii]
 gb|EDO98982.1| predicted protein [Chlamydomonas reinhardtii]
Length=122

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  867  ENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIH  688
            E  +  +CAICL +I L ETA++KGCEH YCV CIL+WA  K+ P CPQCK PF +L  H
Sbjct  4    EELNEDVCAICLGEIELAETAIIKGCEHQYCVNCILQWAVQKEAPWCPQCKKPFNYLYTH  63

Query  687  RALDGSIYDYMFEESVCLLLRASWF  613
            R LDG++ D   EESVCLL RA+WF
Sbjct  64   RLLDGTLSDAPCEESVCLLKRATWF  88



>ref|XP_005849394.1| hypothetical protein CHLNCDRAFT_143887 [Chlorella variabilis]
 gb|EFN57292.1| hypothetical protein CHLNCDRAFT_143887 [Chlorella variabilis]
Length=348

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 88/161 (55%), Gaps = 17/161 (11%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGS-  670
            CAICL  I L+  ALVKGC+H YC TCIL WA +K+EP CPQCK PF +L  +R+LDG  
Sbjct  76   CAICLGGIPLENMALVKGCDHMYCATCILHWALHKEEPWCPQCKQPFSYLLTYRSLDGGL  135

Query  669  ----IYDYMFEESVCLLLRASWFQP------------Lvvveeqpevddyvddfylydgf  538
                + D+  EE VCLL RA WF+             +       ++           G 
Sbjct  136  NVSPVRDFPAEEPVCLLKRAPWFEEHLRFVDRGSASLVEESRLADQMAWQEYAGDYDLGE  195

Query  537  edeeddldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPV  415
            ++E +    +     + + LGNRR+G+ G++  GR++ARPV
Sbjct  196  DEEIESFYFSSAAGRARVVLGNRRYGEGGFISGGRRQARPV  236



>ref|XP_006379115.1| hypothetical protein POPTR_0009s07480g [Populus trichocarpa]
 gb|ERP56912.1| hypothetical protein POPTR_0009s07480g [Populus trichocarpa]
Length=345

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = -2

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddlde--ayfD  499
            SI DYMFEESVCLLLRA+WF PL V + +   +D  D +     +E E++D D    Y  
Sbjct  15   SIQDYMFEESVCLLLRAAWFMPLTVEDHEDFYEDPDDYYPYEYEYEYEDEDDDLDGVYLS  74

Query  498  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            SSS++R+GNRRWGDNGYVRAGRQEARPV+R NF+DS AG SR+PKKKE +K+  G
Sbjct  75   SSSNLRIGNRRWGDNGYVRAGRQEARPVHRSNFDDSGAGSSREPKKKEAAKDRTG  129



>gb|EAY77270.1| hypothetical protein OsI_05243 [Oryza sativa Indica Group]
Length=188

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -2

Query  672  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  493
            SI+DYMFEESVCLLLRA+WF+PL+V   +  +D+             E+D  +EAY+ S 
Sbjct  18   SIHDYMFEESVCLLLRATWFEPLIVEAHEEALDEEELYHIYQYDDGVEDDLDEEAYYMSR  77

Query  492  S-SIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            S SIR+GNRRWGDNGYVR GR+EARPV+R +  D+DAGPSR PKKK+
Sbjct  78   SPSIRIGNRRWGDNGYVRGGRKEARPVSRQSLNDTDAGPSRTPKKKD  124



>gb|KDO54834.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=224

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 119/219 (54%), Gaps = 33/219 (15%)
 Frame = -2

Query  987  VMATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
            + ++ ++I   +LV  + +LSI DQ +M+S A+   R     +H G+CAICL+K VLQET
Sbjct  1    MASSVSKIDGEELVKGLDNLSISDQGEMQSKADN--REMGFGNHGGVCAICLDKTVLQET  58

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDY-MFEESVCLL  631
            ALVK    ++    +L                P   +NIH  L  S++   +   SV   
Sbjct  59   ALVKAQLASFDGPHMLGI-------------QPAHSVNIH--LSSSMFTVPLMAASVITC  103

Query  630  LRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRLGNRRWGDNG  451
             R    Q                D      +EDEEDDLDE YF SSSS+R+GNRRWGDNG
Sbjct  104  SRRVLVQD---------------DLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNG  148

Query  450  YVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            YVRAGRQEARPV RPN +D  A  SR+PKKKE +K   G
Sbjct  149  YVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTG  187



>dbj|BAK05709.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=922

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRAL  679
            G+CAICL+KI LQETALVKGC+HAYCVTCILRWA+YK+ P CPQCKHPFEFL++HR+L
Sbjct  68   GVCAICLDKIPLQETALVKGCDHAYCVTCILRWASYKQTPVCPQCKHPFEFLSVHRSL  125



>ref|XP_007146325.1| hypothetical protein PHAVU_006G030800g, partial [Phaseolus vulgaris]
 gb|ESW18319.1| hypothetical protein PHAVU_006G030800g, partial [Phaseolus vulgaris]
Length=133

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = -2

Query  669  IYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSS  490
            I DYMFEESVCLLLR SWF+PL V E     D Y +    Y   ++E ++        SS
Sbjct  1    IQDYMFEESVCLLLRGSWFKPLSVEEHVVHEDAYEELEEYYPYEDEEMEEAYYG---GSS  57

Query  489  SIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            S+R+GN RWGDNGYVR GRQEARPV+R NF+DS A  SR+PKKK+  K   G
Sbjct  58   SVRIGNCRWGDNGYVRGGRQEARPVHRSNFQDSGASSSREPKKKDAGKGSTG  109



>gb|KDO54839.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=141

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = -2

Query  657  MFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRL  478
            MFEESVCLLLRA+WF+PL+V +     DD  DD+   D  +D ++        SSSS+R+
Sbjct  1    MFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFR----SSSSLRI  56

Query  477  GNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            GNRRWGDNGYVRAGRQEARPV RPN +D  A  SR+PKKKE +K   G
Sbjct  57   GNRRWGDNGYVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTG  104



>emb|CDP20833.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            G CAICLN+++LQETALVKGC+HAYCVTCILRWA+YK++PTCP C  PFEFL  HR+ DG
Sbjct  434  GDCAICLNRMMLQETALVKGCQHAYCVTCILRWASYKEQPTCPLCTRPFEFLITHRSPDG  493



>ref|XP_005648124.1| hypothetical protein COCSUDRAFT_15265 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23580.1| hypothetical protein COCSUDRAFT_15265 [Coccomyxa subellipsoidea 
C-169]
Length=122

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            CAICL++I ++E   VKGCEH YC  CIL WA  K+   CPQCK PF  L  +R LDG++
Sbjct  30   CAICLDQIKVEEICAVKGCEHVYCGKCILAWAVQKEPVWCPQCKAPFSTLLTYRKLDGTL  89

Query  666  YDYMFEESVCLLLRASWFQ  610
             D+  EESVCLL RA WF+
Sbjct  90   SDFPVEESVCLLKRAHWFE  108



>ref|XP_005769571.1| hypothetical protein EMIHUDRAFT_470326 [Emiliania huxleyi CCMP1516]
 gb|EOD17142.1| hypothetical protein EMIHUDRAFT_470326 [Emiliania huxleyi CCMP1516]
Length=303

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 80/170 (47%), Gaps = 15/170 (9%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGS  670
            LCAIC   I   E ALV+GC+H +C  CIL WA  K  P CP C+  F  L +++ LDGS
Sbjct  32   LCAICHGNIAPLEVALVQGCDHPFCCGCILNWALQK--PKCPLCQVGFSHLWMYKQLDGS  89

Query  669  IYDYMFEESVCLLLRASWF----------QPLvvveeqpevddyvddfylydgfedeedd  520
              DY+ EES+ LL RA WF          QP+   +E  E   Y       +  E     
Sbjct  90   YNDYLREESLSLLHRAVWFRKAVSSEYSPQPVDDEDEYHEFLQYEFSGRRDEEEEQMYYL  149

Query  519  ldeayfDSSSSIR--LGNRRWGDNGYVRAGRQEARPVN-RPNFEDSDAGP  379
              +         R  +GNR +G  G V+ GR +ARP+   P F      P
Sbjct  150  EMQERAALGRQSRRAIGNRMFGSGGVVQGGRLKARPLPVTPKFTSKKGAP  199



>gb|KDO54838.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=152

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  498  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKEPSKEIMG  334
            SSSS+R+GNRRWGDNGYVRAGRQEARPV RPN +D  A  SR+PKKKE +K   G
Sbjct  61   SSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTG  115



>ref|XP_011396423.1| Protein SCAF11 [Auxenochlorella protothecoides]
 gb|KFM23549.1| Protein SCAF11 [Auxenochlorella protothecoides]
Length=188

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            +LV+ +  L++P+    K   ++VL    + D    CAICLN   L++ A++ GC+H YC
Sbjct  3    ELVDHMDGLTLPETGDDKGK-QQVLE---DEDDSNPCAICLNTTALKDVAILPGCDHVYC  58

Query  774  VTCILRWATYKK--EPTCPQCKHPFEFLNIHRALDGSIYDYMFEES  643
              CI+ WA+ K+  +  CPQCK PF  +  +R LDG++ D+  + S
Sbjct  59   AHCIIHWASLKEQGDACCPQCKTPFSEIITYRNLDGTLQDFPVQNS  104



>ref|XP_003054864.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60116.1| predicted protein [Micromonas pusilla CCMP1545]
Length=404

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 52/94 (55%), Gaps = 14/94 (15%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYK--------------KEPTCPQCK  715
            G CAICL  I   + ALVK C HA+C  CI+RW +++               +PTCP CK
Sbjct  33   GACAICLEIIPPADVALVKTCLHAFCAPCIVRWTSFQLDNAAKRLRSPSRSSDPTCPCCK  92

Query  714  HPFEFLNIHRALDGSIYDYMFEESVCLLLRASWF  613
             PF  L  +R LDG + + + EES CLL RA W 
Sbjct  93   VPFSSLLTYRTLDGRLTEDLREESACLLRRARWL  126



>tpg|DAA55777.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=120

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 4/47 (9%)
 Frame = -2

Query  495  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            S SIR+GNRRWGDNGY+R GR+EARPVN     D  AGPSR PKKKE
Sbjct  4    SPSIRIGNRRWGDNGYIRGGRKEARPVN----TDVAAGPSRTPKKKE  46



>gb|ACN35218.1| unknown [Zea mays]
Length=127

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 4/47 (9%)
 Frame = -2

Query  495  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            S SIR+GNRRWGDNGY+R GR+EARPVN     D  AGPSR PKKKE
Sbjct  11   SPSIRIGNRRWGDNGYIRGGRKEARPVN----TDVAAGPSRTPKKKE  53



>emb|CEF99954.1| Zinc finger, RING/FYVE/PHD-type [Ostreococcus tauri]
Length=262

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 68/153 (44%), Gaps = 13/153 (8%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYK---KEPTCPQCKHPFEFLNIHRALD  676
            CAICL     ++ AL   C H +C +C++RWA++        CP C      + + R LD
Sbjct  9    CAICLTTPAPEDVALAPACLHVFCASCLVRWASFTAPGASTKCPCCARALRTVLLRRGLD  68

Query  675  GSI--YDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayf  502
            G++    Y+ EES+CLL RA W +            D  D     D    E+        
Sbjct  69   GTVDAGGYLREESLCLLARARWTED------GTWSGDERDGRGESDDDAYEDAAEAILDR  122

Query  501  DSSSSIRLGNRRWGDNGYVR--AGRQEARPVNR  409
             +   + LGNRR+G  G+V    GR  A P  R
Sbjct  123  SARRRVVLGNRRFGRGGFVANGGGRTYATPAAR  155



>tpg|DAA55775.1| TPA: putative RING zinc finger domain superfamily protein, partial 
[Zea mays]
Length=292

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 4/47 (9%)
 Frame = -2

Query  495  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAGPSRQPKKKE  355
            S SIR+GNRRWGDNGY+R GR+EARPVN     D  AGPSR PKKKE
Sbjct  176  SPSIRIGNRRWGDNGYIRGGRKEARPVN----TDVAAGPSRTPKKKE  218



>ref|XP_001420848.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99141.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=273

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 5/82 (6%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPT---CPQCKHPFEFLNIHRALD  676
            CA+CL +   ++ ALV  C HA+C +C+ +WA + +      CP C+   E + + RALD
Sbjct  17   CAVCLARPDARDVALVVACLHAFCASCVTKWAEFTRAGARTRCPLCQASCERVLVRRALD  76

Query  675  GSIYD--YMFEESVCLLLRASW  616
            G   +   M EES+CLL RA W
Sbjct  77   GRALEDGGMQEESLCLLRRARW  98



>gb|KDD72042.1| hypothetical protein H632_c3960p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=147

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 45/80 (56%), Gaps = 12/80 (15%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKE------------PTCPQCKHPFE  703
            CAICL+ I  ++ AL+ GC+H YC  C+LRWA +  E            P CPQCK PFE
Sbjct  68   CAICLSAIAPEDLALLPGCDHVYCAPCLLRWAAHALEPRALPAPPVPPVPRCPQCKVPFE  127

Query  702  FLNIHRALDGSIYDYMFEES  643
             L  +R LDG   D+  E S
Sbjct  128  SLMTYRGLDGRSLDFPEENS  147



>ref|XP_005769873.1| hypothetical protein EMIHUDRAFT_451415, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD17444.1| hypothetical protein EMIHUDRAFT_451415, partial [Emiliania huxleyi 
CCMP1516]
Length=345

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 68/144 (47%), Gaps = 14/144 (10%)
 Frame = -2

Query  810  TALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSIYDYMFEESVCLL  631
             A+ + C+H +C  CIL WA  K  P CP C+  F  L +++ LDGS  DY+ EES+ LL
Sbjct  164  VAVPRRCDHPFCCGCILNWALQK--PKCPLCQVGFSHLWMYKQLDGSYNDYLREESLSLL  221

Query  630  LRASWF----------QPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIR  481
             RA WF          QP+   +E  E   Y       +  E       +         R
Sbjct  222  HRAVWFRKAVSSEYSPQPVDDEDEYHEFLQYEFSGRRDEEEEQMYYLEMQERAALGRQSR  281

Query  480  --LGNRRWGDNGYVRAGRQEARPV  415
              +GNR +G  G V+ GR +ARP+
Sbjct  282  RAIGNRMFGSGGVVQGGRLKARPL  305



>ref|XP_004365935.1| hypothetical protein CAOG_01064 [Capsaspora owczarzaki ATCC 30864]
Length=287

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGS  670
            +CAICL  +  +  A +  C H +C+ C+L W+T +    CP CK  F  ++ H  LDG+
Sbjct  122  VCAICLEDMFDESKAQLPPCLHEFCIRCVLTWSTVRS--CCPLCKTEFSHVSTHFGLDGA  179

Query  669  IYDYMFEESVCLLLRASWF  613
                      CLL++A W 
Sbjct  180  FNAQRMPNLACLLVKARWL  198



>ref|XP_006379116.1| hypothetical protein POPTR_0009s07490g [Populus trichocarpa]
 gb|ERP56913.1| hypothetical protein POPTR_0009s07490g [Populus trichocarpa]
Length=82

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = -2

Query  927  SIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCV  772
            ++  Q +M+S  E   +  C N H G+CAICL+KIVLQETALVKGCEHAY +
Sbjct  16   ALQHQGEMESKVESSEK-ACGN-HGGICAICLDKIVLQETALVKGCEHAYWI  65



>ref|XP_010482836.1| PREDICTED: uncharacterized protein LOC104761451 isoform X2 [Camelina 
sativa]
Length=79

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYC  775
            Q+V++ Q   +P Q + +   +EV       +H G CAICL+ I LQETA+VKGCEHAYC
Sbjct  6    QIVDEQQLDVLPLQDQDEKKTQEVSNELGFGNHGGCCAICLDTIPLQETAMVKGCEHAYC  65



>ref|XP_004597936.1| PREDICTED: protein SCAF11 [Ochotona princeps]
Length=1552

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 44/86 (51%), Gaps = 2/86 (2%)
 Frame = -2

Query  924  IPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATY  745
            IP ++  + T E+        D  G C ICLN +  +E    +GC H +CV+CIL+WA  
Sbjct  113  IPGEAGSEGTGEDTAATRLRYDKSGRCPICLNCLSEKEVGFPEGCSHVFCVSCILQWAET  172

Query  744  KKEPTCPQCKHPFEFLNIHRALDGSI  667
                +CP  + PF+ +     L+G +
Sbjct  173  LA--SCPIDRKPFQAVLKFSTLEGCV  196



>ref|XP_007512089.1| unknown protein [Bathycoccus prasinos]
 emb|CCO66177.1| unknown protein [Bathycoccus prasinos]
Length=478

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 48/113 (42%), Gaps = 35/113 (31%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKE-----------------------  736
            CAICL    L+ +     C H++C  CI+RWA +++E                       
Sbjct  122  CAICLTAPALENSCFTVPCLHSFCARCIVRWANFQEEEENEQRKKRGLSSTHHQHHRHGS  181

Query  735  -------PTCPQCKHPFEFLNIHRALDGSIYDY-----MFEESVCLLLRASWF  613
                     CP C+ PFE L  +R LDGS++       + E  +CLL R+ W 
Sbjct  182  GGGSSFAAKCPSCRVPFENLLCYRELDGSVHKLRGELDLREHPLCLLKRSKWL  234



>gb|EHL03248.1| hypothetical protein M7I_0683 [Glarea lozoyensis 74030]
Length=233

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 11/113 (10%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA-------LVK  796
            Q+V QI+  + P+Q ++   A  +  V  E+ H G+C I +   V  E A       ++ 
Sbjct  70   QIVTQIEG-NTPEQEEILVRAISIEEVPEEDRHCGICRITMG--VPDEGAEARIERPVIT  126

Query  795  GCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI-YDYMFEESV  640
            GC+H +   C+ +WA+ ++EP CP C+   EF  +   +D  I  D   EE++
Sbjct  127  GCKHVFGDLCLKQWASEREEPDCPLCRKRIEFPKVMPTIDQRIEADITLEENI  179



>ref|XP_009687468.1| PREDICTED: LOW QUALITY PROTEIN: protein SCAF11 [Struthio camelus 
australis]
Length=1363

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 43/88 (49%), Gaps = 8/88 (9%)
 Frame = -2

Query  861  DHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRA  682
            D    C ICLN ++ QE    + C H +C+TCIL+WA  K   +CP  + PF+ +    A
Sbjct  37   DEGDKCPICLNCLLEQEIGFPENCSHTFCMTCILKWAETKA--SCPIDRRPFQAIRKLDA  94

Query  681  LDGSIYDY------MFEESVCLLLRASW  616
            LD            M EE +C+  +  +
Sbjct  95   LDQIKVQVKKQLREMEEEEICVRNKGKY  122



>gb|KIY99316.1| hypothetical protein MNEG_8649 [Monoraphidium neglectum]
Length=328

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = -2

Query  729  CPQCKHPFEFLNIHRALDGSIYDYMFEESVCLLLRASWF  613
            CPQCK PF  L  HR LDG+  DY  EE V LL RA WF
Sbjct  6    CPQCKAPFSHLYTHRHLDGTPSDYPLEEGVTLLKRARWF  44



>ref|XP_010482835.1| PREDICTED: uncharacterized protein LOC104761451 isoform X1 [Camelina 
sativa]
Length=116

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETALVKGCEHAY  778
            Q+V++ Q   +P Q + +   +EV       +H G CAICL+ I LQETA+VKGCEHAY
Sbjct  6    QIVDEQQLDVLPLQDQDEKKTQEVSNELGFGNHGGCCAICLDTIPLQETAMVKGCEHAY  64



>ref|XP_006489137.1| PREDICTED: E3 ubiquitin-protein ligase Topors-like [Citrus sinensis]
Length=294

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF  706
            C ICL+ + ++ TA++K C HAYC+ CI +W+  K+   CP C  PF
Sbjct  37   CPICLDNLTVRRTAVLKVCTHAYCLECIEKWSNLKR--ICPLCNAPF  81



>ref|XP_006419647.1| hypothetical protein CICLE_v10005542mg [Citrus clementina]
 gb|ESR32887.1| hypothetical protein CICLE_v10005542mg [Citrus clementina]
Length=294

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF  706
            C ICL+ + ++ TA++K C HAYC+ CI +W+  K+   CP C  PF
Sbjct  37   CPICLDNLTVRRTAVLKVCTHAYCLECIEKWSNLKR--NCPLCNAPF  81



>ref|XP_006476564.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
Length=120

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 43/94 (46%), Gaps = 2/94 (2%)
 Frame = -2

Query  987  VMATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
             +A   E+ +P L++  Q+L    + + K     + RV  E      CAICL +  +   
Sbjct  23   TVADQMELLMPGLIDHRQELRSRRRDESKQANTNLKRVKIEESQSCSCAICLEEFSVGSE  82

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF  706
            A   GC H Y   CI+RW   K   +CP C+H  
Sbjct  83   ACCVGCSHMYHDNCIVRW--LKNNNSCPLCRHRL  114



>ref|XP_010004590.1| PREDICTED: protein SCAF11 [Chaetura pelagica]
Length=1362

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGS  670
            +C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ ++   AL+  
Sbjct  39   MCPICLNCLIEQEIGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVHRLDALEER  96

Query  669  I  667
            I
Sbjct  97   I  97



>ref|XP_009075429.1| PREDICTED: protein SCAF11 [Acanthisitta chloris]
Length=1351

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGS  670
            +C ICLN ++ QE    + C H +C+TCIL+WA  + E +CP  + PF+ +    ALD  
Sbjct  39   MCPICLNCLLEQEIGFPENCGHTFCMTCILKWA--EAEASCPIDRRPFQAVCRLGALDKQ  96

Query  669  I  667
            I
Sbjct  97   I  97



>gb|ACN36095.1| unknown [Zea mays]
Length=156

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +1

Query  673  SIKSTVDV*KLKWMLALRAGRFLLVGRPT*DASHTVGMLATFYKSSFLQHYLIQANRTQP  852
            +++  V   + +WMLAL A R LLVG P  +  HTVG++AT  +   L+ Y ++A+   P
Sbjct  7    AVERAVHAEEFEWMLALWAERVLLVGCPPQNTGHTVGVVATLDEGRLLERYPVEADGAHP  66

Query  853  MM  858
             +
Sbjct  67   AI  68



>ref|XP_010188928.1| PREDICTED: protein SCAF11 [Mesitornis unicolor]
Length=1365

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 5/58 (9%)
 Frame = -2

Query  870  CENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFL  697
            C+ D    C ICLN ++ QE A  + C H +C+TCIL+WA  + E +CP  + PF+ +
Sbjct  35   CDGD---TCPICLNCLLEQEVAFPENCSHTFCMTCILKWA--ETEASCPIDRRPFQAV  87



>ref|XP_002124973.1| PREDICTED: protein SCAF11 [Ciona intestinalis]
Length=1966

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 3/79 (4%)
 Frame = -2

Query  864  NDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHR  685
            +D    CAICLN+   Q+  +   C H +CV CIL W+  K   +CP  +  FE + ++R
Sbjct  60   SDGDASCAICLNEFTKQKVGVPNNCRHIFCVDCILEWS--KNANSCPVDRIEFEAIQVYR  117

Query  684  ALDGS-IYDYMFEESVCLL  631
               G  +++ + E+ + ++
Sbjct  118  RFGGVFVHELVVEKKINVV  136



>ref|XP_010222545.1| PREDICTED: protein SCAF11 [Tinamus guttatus]
Length=1382

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -2

Query  864  NDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHR  685
            +D    C ICLN ++ QE    + C H +C+TCIL+WA  K   +CP  + PF+ +    
Sbjct  36   SDEGDKCPICLNCLLEQEIGFPENCSHTFCMTCILKWAETKA--SCPIDRRPFQAICKLD  93

Query  684  ALDGSI  667
            AL+  I
Sbjct  94   ALENQI  99



>ref|XP_010250551.1| PREDICTED: E3 ubiquitin-protein ligase Topors [Nelumbo nucifera]
Length=279

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 2/47 (4%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF  706
            C ICLN +  +  A++ GC HAYC  CI RW+ +K+  TCP C   F
Sbjct  23   CPICLNPVEDRRAAVLSGCMHAYCTDCIRRWSQFKR--TCPLCNSNF  67



>ref|XP_008083170.1| RING/U-box [Glarea lozoyensis ATCC 20868]
 gb|EPE29061.1| RING/U-box [Glarea lozoyensis ATCC 20868]
Length=363

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 11/113 (10%)
 Frame = -2

Query  954  QLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQETA-------LVK  796
            Q+V QI+  + P+Q ++   A  +  V  E+ H G+C I +   V  E A       ++ 
Sbjct  200  QIVTQIEG-NTPEQEEILVRAISIEEVPEEDRHCGICRITMG--VPDEGAEARIERPVIT  256

Query  795  GCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI-YDYMFEESV  640
            GC+H +   C+ +WA+ ++EP CP C+   EF  +   +D  I  D   EE++
Sbjct  257  GCKHVFGDLCLKQWASEREEPDCPLCRKRIEFPKVMPTIDQRIEADITLEENI  309



>ref|XP_009464423.1| PREDICTED: protein SCAF11 [Nipponia nippon]
Length=1366

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGS  670
             C ICLN ++ QET   + C H +C+TCIL+WA  + + +CP  + PF+ +    AL+  
Sbjct  39   TCPICLNCLLEQETGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALEKQ  96

Query  669  I  667
            I
Sbjct  97   I  97



>gb|EOB08370.1| SFRS2-interacting protein, partial [Anas platyrhynchos]
Length=1390

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFL  697
            +C ICLN ++ QE  + + C H +C+TCIL+WA  + + +CP  + PF+ +
Sbjct  19   MCPICLNGLLEQEIGVPESCSHTFCMTCILKWA--ETQASCPIDRRPFQAV  67



>ref|XP_002630911.1| Hypothetical protein CBG02635 [Caenorhabditis briggsae]
Length=707

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFE  703
            C ICL+    QE   V GC HA+C +CI  W T    P+CP C+H  E
Sbjct  25   CTICLSSKFSQE-CRVNGCNHAFCFSCISEWVTQSMRPSCPMCRHDIE  71



>ref|XP_007238014.1| PREDICTED: protein SCAF11 isoform X2 [Astyanax mexicanus]
Length=1363

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 2/69 (3%)
 Frame = -2

Query  873  GCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLN  694
            G E++ +  C ICLN     E A+  GC H YC  CILRWA   +   CP  + PF  + 
Sbjct  15   GSEDEENQRCPICLNTPSPSERAVPDGCSHFYCFNCILRWAQMVQ--VCPVDRRPFSAIC  72

Query  693  IHRALDGSI  667
                L G I
Sbjct  73   KQNPLLGYI  81



>ref|XP_006439544.1| hypothetical protein CICLE_v10023541mg [Citrus clementina]
 gb|ESR52784.1| hypothetical protein CICLE_v10023541mg [Citrus clementina]
Length=120

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 43/92 (47%), Gaps = 2/92 (2%)
 Frame = -2

Query  987  VMATAAEIGVPQLVNQIQDLSIPDQSKMKSTAEEVLRVGCENDHHGLCAICLNKIVLQET  808
             +A   E+ +P L++  Q+L    + + K     + RV  E      CAICL +  +   
Sbjct  23   TVADQMELLMPGLIDHRQELPSRRRDESKQANTNMKRVKIEESQSCCCAICLEEFSVGSE  82

Query  807  ALVKGCEHAYCVTCILRWATYKKEPTCPQCKH  712
            A   GC H Y   CI+RW   K   +CP C+H
Sbjct  83   ACCVGCSHMYHDDCIVRW--LKNNNSCPLCRH  112



>ref|XP_003771424.1| PREDICTED: protein SCAF11 [Sarcophilus harrisii]
Length=1445

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICL+ ++ +E A  + C H +C+TCIL+WA  +  P+CP  + PF+ +    AL+G +
Sbjct  40   CPICLSCMLKKEVAFPENCNHIFCITCILKWA--ETLPSCPIDRKPFQSVYKFSALEGCV  97



>ref|XP_005010007.1| PREDICTED: protein SCAF11 isoform X2 [Anas platyrhynchos]
Length=1395

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 2/52 (4%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFL  697
             +C ICLN ++ QE  + + C H +C+TCIL+WA  + + +CP  + PF+ +
Sbjct  38   SMCPICLNGLLEQEIGVPESCSHTFCMTCILKWA--ETQASCPIDRRPFQAV  87



>emb|CAP23915.2| Protein CBG02635 [Caenorhabditis briggsae]
Length=721

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFE  703
            C ICL+    QE   V GC HA+C +CI  W T    P+CP C+H  E
Sbjct  25   CTICLSSKFSQE-CRVNGCNHAFCFSCISEWVTQSMRPSCPMCRHDIE  71



>ref|XP_005010006.1| PREDICTED: protein SCAF11 isoform X1 [Anas platyrhynchos]
Length=1425

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 2/52 (4%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFL  697
             +C ICLN ++ QE  + + C H +C+TCIL+WA  + + +CP  + PF+ +
Sbjct  68   SMCPICLNGLLEQEIGVPESCSHTFCMTCILKWA--ETQASCPIDRRPFQAV  117



>ref|XP_007238013.1| PREDICTED: protein SCAF11 isoform X1 [Astyanax mexicanus]
Length=1373

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 2/69 (3%)
 Frame = -2

Query  873  GCENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLN  694
            G E++ +  C ICLN     E A+  GC H YC  CILRWA   +   CP  + PF  + 
Sbjct  15   GSEDEENQRCPICLNTPSPSERAVPDGCSHFYCFNCILRWAQMVQ--VCPVDRRPFSAIC  72

Query  693  IHRALDGSI  667
                L G I
Sbjct  73   KQNPLLGYI  81



>ref|XP_009325873.1| PREDICTED: protein SCAF11 [Pygoscelis adeliae]
Length=1382

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = -2

Query  870  CENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNI  691
            C+ D    C ICLN I+ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +  
Sbjct  35   CDGD---TCPICLNCILEQEIGFPENCSHTFCMTCILKWA--ETQASCPMDRRPFQAVCR  89

Query  690  HRALDGSI  667
              AL+  I
Sbjct  90   LDALEKQI  97



>ref|XP_009284482.1| PREDICTED: protein SCAF11 isoform X2 [Aptenodytes forsteri]
Length=1274

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = -2

Query  870  CENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNI  691
            C+ D    C ICLN I+ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +  
Sbjct  35   CDGD---TCPICLNCILEQEIGFPENCSHTFCMTCILKWA--ETQASCPMDRRPFQAVCR  89

Query  690  HRALDGSI  667
              AL+  I
Sbjct  90   LDALEKQI  97



>ref|XP_009284481.1| PREDICTED: protein SCAF11 isoform X1 [Aptenodytes forsteri]
Length=1382

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = -2

Query  870  CENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNI  691
            C+ D    C ICLN I+ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +  
Sbjct  35   CDGD---TCPICLNCILEQEIGFPENCSHTFCMTCILKWA--ETQASCPMDRRPFQAVCR  89

Query  690  HRALDGSI  667
              AL+  I
Sbjct  90   LDALEKQI  97



>ref|XP_005010008.1| PREDICTED: protein SCAF11 isoform X3 [Anas platyrhynchos]
Length=1399

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFL  697
            +C ICLN ++ QE  + + C H +C+TCIL+WA  + + +CP  + PF+ +
Sbjct  69   MCPICLNGLLEQEIGVPESCSHTFCMTCILKWA--ETQASCPIDRRPFQAV  117



>ref|XP_005519354.1| PREDICTED: protein SCAF11 [Pseudopodoces humilis]
Length=1359

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 3/65 (5%)
 Frame = -2

Query  858  HHG-LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRA  682
            H G  C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    A
Sbjct  35   HDGNTCPICLNCLLEQEIGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCRLDA  92

Query  681  LDGSI  667
            LD  I
Sbjct  93   LDRQI  97



>ref|XP_009093333.1| PREDICTED: protein SCAF11 [Serinus canaria]
Length=1336

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   NTCPICLNCLLEQEIGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   QI  97



>ref|XP_002194545.2| PREDICTED: protein SCAF11 [Taeniopygia guttata]
Length=1360

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   NTCPICLNCLLEQEIGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   QI  97



>ref|XP_005419312.1| PREDICTED: protein SCAF11 [Geospiza fortis]
Length=1359

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   NTCPICLNCLLEQEIGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   QI  97



>ref|XP_008924795.1| PREDICTED: protein SCAF11 [Manacus vitellinus]
Length=1359

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   NTCPICLNCLLEQEIGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   QI  97



>ref|XP_005480595.1| PREDICTED: protein SCAF11 [Zonotrichia albicollis]
Length=1375

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   NTCPICLNCLLEQEIGFPESCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   QI  97



>ref|XP_008493961.1| PREDICTED: protein SCAF11 [Calypte anna]
Length=1367

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 3/65 (5%)
 Frame = -2

Query  858  HHG-LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRA  682
            H G  C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PFE +    A
Sbjct  35   HDGDTCPICLNCLLEQEIGFPENCNHTFCMTCILKWA--ETQASCPIDRRPFEAVCRLDA  92

Query  681  LDGSI  667
            L+  I
Sbjct  93   LEEQI  97



>ref|XP_003292173.1| hypothetical protein DICPUDRAFT_82806 [Dictyostelium purpureum]
 gb|EGC31296.1| hypothetical protein DICPUDRAFT_82806 [Dictyostelium purpureum]
Length=455

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 4/54 (7%)
 Frame = -2

Query  867  ENDHHGLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF  706
            EN+H   C IC++KI   + A +  C H YC  CI+ W+ Y+++ TCP C+ PF
Sbjct  333  ENEHQ--CTICMDKIEPSKLATI-DCNHNYCYDCIMEWS-YRRDNTCPNCRAPF  382



>ref|XP_003724412.1| PREDICTED: E3 ubiquitin-protein ligase Topors-like [Strongylocentrotus 
purpuratus]
 ref|XP_011662134.1| PREDICTED: E3 ubiquitin-protein ligase Topors-like [Strongylocentrotus 
purpuratus]
Length=866

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 5/62 (8%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICL K   ++ +   GC H +C  CI  WA  K   TCP CK PF+ + IH  +   +
Sbjct  48   CPICLGK--FKDKSFSDGCFHRFCFQCIREWAKVKS--TCPLCKTPFKSI-IHNVVSSDV  102

Query  666  YD  661
            YD
Sbjct  103  YD  104



>gb|EJY85929.1| RING/U-box protein [Oxytricha trifallax]
Length=954

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = -2

Query  849  LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF  706
            +C IC  ++ LQ+ A ++ C H +C  CI  WAT K E TCP CK  F
Sbjct  268  MCTICQCEMELQDQATIESCIHVFCFVCIKEWAT-KAENTCPLCKQKF  314



>ref|XP_005039403.1| PREDICTED: protein SCAF11 isoform X1 [Ficedula albicollis]
 ref|XP_005039404.1| PREDICTED: protein SCAF11 isoform X2 [Ficedula albicollis]
Length=1372

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   STCPICLNCLLEQEIGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   RI  97



>gb|EAY77269.1| hypothetical protein OsI_05242 [Oryza sativa Indica Group]
Length=109

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAY  778
            G+CAICL+KI LQETALVKGC+HAY
Sbjct  50   GVCAICLDKIALQETALVKGCDHAY  74



>ref|XP_007524701.1| PREDICTED: protein SCAF11 [Erinaceus europaeus]
Length=1454

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICLN ++ +E    + C HA+C+TCIL+WA  +   +CP  + PF+ +    AL+G +
Sbjct  41   CPICLNCLLEKEVGFPESCNHAFCMTCILKWA--ETLASCPIDRKPFQAVFKFSALEGCV  98



>ref|XP_010411913.1| PREDICTED: protein SCAF11 isoform X2 [Corvus cornix cornix]
Length=1405

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  71   NTCPICLNCLLEQEIGFPESCSHIFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  128

Query  672  SI  667
             I
Sbjct  129  QI  130



>ref|XP_010411914.1| PREDICTED: protein SCAF11 isoform X3 [Corvus cornix cornix]
Length=1392

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  58   NTCPICLNCLLEQEIGFPESCSHIFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  115

Query  672  SI  667
             I
Sbjct  116  QI  117



>ref|XP_008630993.1| PREDICTED: protein SCAF11 [Corvus brachyrhynchos]
Length=1356

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   NTCPICLNCLLEQEIGFPESCSHIFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   QI  97



>ref|XP_010411912.1| PREDICTED: protein SCAF11 isoform X1 [Corvus cornix cornix]
 ref|XP_010411918.1| PREDICTED: protein SCAF11 isoform X1 [Corvus cornix cornix]
Length=1372

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   NTCPICLNCLLEQEIGFPESCSHIFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   QI  97



>gb|KDO75096.1| hypothetical protein CISIN_1g046606mg [Citrus sinensis]
Length=246

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 2/48 (4%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFE  703
            C ICL+ +  + TA++K C HAYC+ CI +W+  K+   CP C  PF 
Sbjct  37   CPICLDNLTDRRTAVLKVCTHAYCLECIEKWSNLKR--NCPLCNAPFR  82



>ref|XP_010411916.1| PREDICTED: protein SCAF11 isoform X5 [Corvus cornix cornix]
Length=1335

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
              C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    ALD 
Sbjct  38   NTCPICLNCLLEQEIGFPESCSHIFCMTCILKWA--ETQASCPIDRRPFQAVCRLDALDK  95

Query  672  SI  667
             I
Sbjct  96   QI  97



>ref|XP_003793682.1| PREDICTED: protein SCAF11 [Otolemur garnettii]
Length=1499

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICLN +V +E    + C H +C+TCIL+WA  +   +CP  + PF+ +    AL+G I
Sbjct  80   CPICLNCLVEKEVGFPESCNHVFCMTCILKWA--ETLASCPIDRKPFQAVFKFSALEGCI  137



>ref|XP_003476129.2| PREDICTED: protein SCAF11 [Cavia porcellus]
Length=1494

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICLN ++ +E    + C H +C+TCIL+WA  +   +CP  + PF+ +    AL+G I
Sbjct  41   CPICLNYLLEKEVGFPESCNHVFCMTCILKWA--ETLASCPIDRKPFQAVFKFSALEGCI  98



>ref|XP_007503941.1| PREDICTED: protein SCAF11 isoform X1 [Monodelphis domestica]
Length=1453

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICL+ I+ +E    + C H +C+TCIL+WA  +  P+CP  + PF+ +    A +G I
Sbjct  40   CPICLSCIIEKEVGFPENCNHIFCITCILKWA--ETLPSCPIDRKPFQAIYKFSASEGCI  97



>ref|XP_002739463.1| PREDICTED: E3 ubiquitin-protein ligase Topors-like [Saccoglossus 
kowalevskii]
Length=1112

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 33/65 (51%), Gaps = 5/65 (8%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C+ICL K   +  +   GC H +C  CI+ W+  K   TCP CK  F+ + IH      +
Sbjct  66   CSICLGK--FENKSFTDGCFHTFCFVCIMEWSKVKA--TCPLCKTSFKSI-IHNIKSNEM  120

Query  666  YDYMF  652
            YD  F
Sbjct  121  YDQYF  125



>ref|XP_007503942.1| PREDICTED: protein SCAF11 isoform X2 [Monodelphis domestica]
Length=1437

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICL+ I+ +E    + C H +C+TCIL+WA  +  P+CP  + PF+ +    A +G I
Sbjct  40   CPICLSCIIEKEVGFPENCNHIFCITCILKWA--ETLPSCPIDRKPFQAIYKFSASEGCI  97



>ref|XP_008839536.1| PREDICTED: protein SCAF11 isoform X2 [Nannospalax galili]
Length=1432

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICLN ++ +E    + C H +C+TCIL+WA      +CP  + PF+ +    AL+G +
Sbjct  41   CPICLNYLLGKEVGFPESCNHVFCITCILKWAETLA--SCPIDRKPFQAVLKFSALEGCV  98



>ref|XP_008839535.1| PREDICTED: protein SCAF11 isoform X1 [Nannospalax galili]
Length=1448

 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDGSI  667
            C ICLN ++ +E    + C H +C+TCIL+WA      +CP  + PF+ +    AL+G +
Sbjct  41   CPICLNYLLGKEVGFPESCNHVFCITCILKWAETLA--SCPIDRKPFQAVLKFSALEGCV  98



>ref|NP_001182499.1| SFRS2-interacting protein [Gallus gallus]
Length=1361

 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 3/65 (5%)
 Frame = -2

Query  858  HHG-LCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRA  682
            H G  C ICLN ++ QE    + C H +C+TCIL+WA  + + +CP  + PF+ +    A
Sbjct  35   HDGDTCPICLNCLLEQEIGFPENCSHTFCMTCILKWA--ETQASCPIDRRPFQAVCQLGA  92

Query  681  LDGSI  667
            L+  I
Sbjct  93   LEDQI  97



>ref|XP_004206190.1| PREDICTED: uncharacterized protein LOC100204904 [Hydra vulgaris]
Length=1274

 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = -2

Query  852  GLCAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPFEFLNIHRALDG  673
            GLC ICL++   Q   + K C H +C+ C+  WA  KK   CP  +  F F+ +++  DG
Sbjct  53   GLCPICLSEFTNQMVGVPKTCNHVFCLECLQEWA--KKINNCPVDRTKFNFVLVYKIKDG  110

Query  672  SIYDYMFEE  646
             + + ++ E
Sbjct  111  PLVEEIYIE  119



>ref|XP_004335241.1| zinc finger, C3HC4 type (RING finger) domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR13228.1| zinc finger, C3HC4 type (RING finger) domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=459

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 2/47 (4%)
 Frame = -2

Query  846  CAICLNKIVLQETALVKGCEHAYCVTCILRWATYKKEPTCPQCKHPF  706
            CAICL++   ++ A+V+GC H++C  CI  WA     P CP CK  F
Sbjct  170  CAICLSRPTRRDGAVVEGCYHSFCFVCIAHWAALN--PACPLCKRRF  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2543375385617