BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5626

Length=1183
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801486.1|  PREDICTED: protein unc-50 homolog                  482   6e-168   Nicotiana sylvestris
ref|XP_009629275.1|  PREDICTED: protein unc-50 homolog                  478   2e-166   Nicotiana tomentosiformis
ref|XP_006346362.1|  PREDICTED: protein unc-50 homolog                  477   1e-165   Solanum tuberosum [potatoes]
ref|XP_004230735.1|  PREDICTED: protein unc-50 homolog                  475   4e-165   Solanum lycopersicum
ref|XP_011092536.1|  PREDICTED: protein unc-50 homolog isoform X1       459   7e-159   Sesamum indicum [beniseed]
gb|KJB47362.1|  hypothetical protein B456_008G022900                    458   2e-158   Gossypium raimondii
ref|XP_007042528.1|  UNC-50 family protein isoform 1                    457   3e-158   
ref|XP_012075870.1|  PREDICTED: protein unc-50 homolog                  455   4e-157   Jatropha curcas
gb|EYU42697.1|  hypothetical protein MIMGU_mgv1a012334mg                455   4e-157   Erythranthe guttata [common monkey flower]
emb|CDO97222.1|  unnamed protein product                                455   5e-157   Coffea canephora [robusta coffee]
ref|XP_002282581.2|  PREDICTED: protein unc-50 homolog                  451   1e-155   Vitis vinifera
ref|XP_011001154.1|  PREDICTED: protein unc-50 homolog                  451   1e-155   Populus euphratica
emb|CBI40262.3|  unnamed protein product                                445   5e-153   Vitis vinifera
ref|XP_010691673.1|  PREDICTED: protein unc-50 homolog                  444   5e-153   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010271205.1|  PREDICTED: protein unc-50 homolog isoform X1       444   7e-153   Nelumbo nucifera [Indian lotus]
ref|XP_006379181.1|  UNC-50 family protein                              442   5e-152   Populus trichocarpa [western balsam poplar]
ref|XP_006487004.1|  PREDICTED: protein unc-50 homolog                  441   2e-151   Citrus sinensis [apfelsine]
ref|XP_004136958.1|  PREDICTED: protein unc-50 homolog                  439   9e-151   Cucumis sativus [cucumbers]
gb|KEH44101.1|  UNC-50 family protein                                   438   2e-150   Medicago truncatula
ref|XP_010530733.1|  PREDICTED: protein unc-50 homolog                  438   2e-150   Tarenaya hassleriana [spider flower]
gb|KJB11965.1|  hypothetical protein B456_002G009400                    437   5e-150   Gossypium raimondii
gb|AFK46272.1|  unknown                                                 437   6e-150   Medicago truncatula
gb|AFK38140.1|  unknown                                                 436   1e-149   Lotus japonicus
ref|XP_006422929.1|  hypothetical protein CICLE_v10029109mg             436   1e-149   Citrus clementina [clementine]
ref|XP_008356380.1|  PREDICTED: protein unc-50 homolog                  436   1e-149   Malus domestica [apple tree]
ref|XP_008454998.1|  PREDICTED: protein unc-50 homolog                  434   9e-149   Cucumis melo [Oriental melon]
emb|CDY63605.1|  BnaCnng42360D                                          433   2e-148   Brassica napus [oilseed rape]
ref|XP_007201388.1|  hypothetical protein PRUPE_ppa010309mg             432   4e-148   Prunus persica
ref|XP_008236376.1|  PREDICTED: protein unc-50 homolog                  431   7e-148   Prunus mume [ume]
ref|XP_004496941.1|  PREDICTED: protein unc-50 homolog                  431   9e-148   Cicer arietinum [garbanzo]
ref|XP_010547978.1|  PREDICTED: protein unc-50 homolog isoform X1       431   1e-147   Tarenaya hassleriana [spider flower]
ref|XP_011467754.1|  PREDICTED: protein unc-50 homolog                  431   2e-147   Fragaria vesca subsp. vesca
ref|XP_010057258.1|  PREDICTED: protein unc-50 homolog                  430   3e-147   Eucalyptus grandis [rose gum]
gb|KHN42364.1|  Protein unc-50 like                                     429   9e-147   Glycine soja [wild soybean]
emb|CDY48219.1|  BnaA07g03880D                                          428   2e-146   Brassica napus [oilseed rape]
ref|XP_007143055.1|  hypothetical protein PHAVU_007G039900g             427   4e-146   Phaseolus vulgaris [French bean]
ref|NP_001235443.1|  uncharacterized protein LOC100500001               427   4e-146   Glycine max [soybeans]
gb|KJB47366.1|  hypothetical protein B456_008G022900                    426   6e-146   Gossypium raimondii
ref|XP_003555962.1|  PREDICTED: protein unc-50 homolog                  427   6e-146   Glycine max [soybeans]
ref|XP_009102331.1|  PREDICTED: protein unc-50 homolog                  425   2e-145   Brassica rapa
ref|XP_009335832.1|  PREDICTED: protein unc-50 homolog                  424   5e-145   Pyrus x bretschneideri [bai li]
ref|XP_010518032.1|  PREDICTED: protein unc-50 homolog                  423   1e-144   Camelina sativa [gold-of-pleasure]
ref|XP_010467286.1|  PREDICTED: protein unc-50 homolog                  423   1e-144   Camelina sativa [gold-of-pleasure]
ref|XP_010488944.1|  PREDICTED: protein unc-50 homolog                  422   3e-144   Camelina sativa [gold-of-pleasure]
ref|XP_006409583.1|  hypothetical protein EUTSA_v10022824mg             422   4e-144   Eutrema salsugineum [saltwater cress]
ref|XP_002885951.1|  hypothetical protein ARALYDRAFT_899735             422   4e-144   Arabidopsis lyrata subsp. lyrata
ref|XP_010928386.1|  PREDICTED: protein unc-50 homolog isoform X1       420   2e-143   Elaeis guineensis
emb|CDY52420.1|  BnaCnng22410D                                          418   1e-142   Brassica napus [oilseed rape]
ref|XP_009123230.1|  PREDICTED: protein unc-50 homolog                  418   2e-142   Brassica rapa
ref|XP_006844040.1|  PREDICTED: protein unc-50 homolog                  417   2e-142   Amborella trichopoda
ref|XP_002298750.2|  hypothetical protein POPTR_0001s30740g             417   4e-142   Populus trichocarpa [western balsam poplar]
ref|XP_007042529.1|  UNC-50 family protein isoform 2                    415   1e-141   
ref|XP_011030395.1|  PREDICTED: protein unc-50 homolog                  413   2e-140   Populus euphratica
gb|AAM61449.1|  unknown                                                 410   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565370.1|  UNC-50 family protein                                 409   6e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296617.1|  hypothetical protein CARUB_v10014338mg             409   9e-139   
ref|XP_009396396.1|  PREDICTED: protein unc-50 homolog                  402   3e-136   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799595.1|  PREDICTED: protein unc-50 homolog isoform X2       399   3e-135   Phoenix dactylifera
gb|KHG13402.1|  Protein unc-50                                          393   6e-133   Gossypium arboreum [tree cotton]
ref|XP_004956281.1|  PREDICTED: protein unc-50 homolog                  390   1e-131   Setaria italica
ref|XP_008651375.1|  PREDICTED: uncharacterized protein LOC100280...    390   1e-131   
ref|XP_006660415.1|  PREDICTED: protein unc-50 homolog                  390   2e-131   Oryza brachyantha
ref|XP_003576742.1|  PREDICTED: protein unc-50 homolog                  389   2e-131   Brachypodium distachyon [annual false brome]
ref|XP_002462031.1|  hypothetical protein SORBIDRAFT_02g013040          387   1e-130   Sorghum bicolor [broomcorn]
ref|NP_001062566.1|  Os09g0109500                                       386   3e-130   
gb|KJB11966.1|  hypothetical protein B456_002G009400                    378   2e-127   Gossypium raimondii
gb|KHN06766.1|  Protein unc-50 like                                     377   5e-127   Glycine soja [wild soybean]
gb|ACN35099.1|  unknown                                                 379   5e-127   Zea mays [maize]
ref|XP_010271213.1|  PREDICTED: protein unc-50 homolog isoform X2       375   4e-126   Nelumbo nucifera [Indian lotus]
gb|ABK21352.1|  unknown                                                 375   6e-126   Picea sitchensis
ref|XP_010547979.1|  PREDICTED: protein unc-50 homolog isoform X2       374   2e-125   Tarenaya hassleriana [spider flower]
gb|EPS67574.1|  hypothetical protein M569_07201                         373   3e-125   Genlisea aurea
ref|XP_001773436.1|  predicted protein                                  374   3e-125   
gb|KJB47365.1|  hypothetical protein B456_008G022900                    372   3e-124   Gossypium raimondii
gb|KJB47363.1|  hypothetical protein B456_008G022900                    366   7e-123   Gossypium raimondii
ref|XP_010928388.1|  PREDICTED: protein unc-50 homolog isoform X3       363   1e-121   Elaeis guineensis
ref|XP_010928387.1|  PREDICTED: protein unc-50 homolog isoform X2       362   8e-121   
ref|XP_011092537.1|  PREDICTED: protein unc-50 homolog isoform X2       361   1e-120   
ref|XP_006422931.1|  hypothetical protein CICLE_v10029109mg             362   1e-120   
ref|XP_001783677.1|  predicted protein                                  351   2e-116   
tpg|DAA60647.1|  TPA: hypothetical protein ZEAMMB73_532880              341   7e-113   
gb|ABK24141.1|  unknown                                                 335   1e-110   Picea sitchensis
ref|XP_002963517.1|  hypothetical protein SELMODRAFT_165762             328   1e-107   Selaginella moellendorffii
ref|XP_002981564.1|  hypothetical protein SELMODRAFT_114708             326   2e-106   Selaginella moellendorffii
ref|XP_010096286.1|  hypothetical protein L484_027024                   320   1e-103   
dbj|BAK01787.1|  predicted protein                                      310   9e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008799585.1|  PREDICTED: protein unc-50 homolog isoform X1       313   1e-100   
gb|KEH44100.1|  UNC-50 family protein                                   306   1e-99    Medicago truncatula
gb|KJB47364.1|  hypothetical protein B456_008G022900                    300   4e-97    Gossypium raimondii
ref|XP_007042530.1|  UNC-50 family protein isoform 3                    291   1e-93    
gb|KJB11964.1|  hypothetical protein B456_002G009400                    287   3e-92    Gossypium raimondii
ref|XP_002518676.1|  conserved hypothetical protein                     273   6e-87    
ref|XP_005652231.1|  UNC-50                                             275   8e-87    Coccomyxa subellipsoidea C-169
gb|ADI46868.1|  UNC50f                                                  273   6e-86    Volvox carteri f. nagariensis
gb|ADI46908.1|  UNC50m                                                  272   1e-85    Volvox carteri f. nagariensis
ref|XP_002503978.1|  unc-50 family protein                              272   2e-85    Micromonas commoda
ref|XP_001696427.1|  UNC-50 family protein                              263   4e-82    Chlamydomonas reinhardtii
ref|XP_003054963.1|  unc-50 family protein                              259   1e-80    Micromonas pusilla CCMP1545
gb|KIZ03662.1|  putative Protein unc-50 like protein                    251   1e-77    Monoraphidium neglectum
ref|XP_005716895.1|  unnamed protein product                            248   5e-76    Chondrus crispus [carageen]
ref|XP_008360793.1|  PREDICTED: protein unc-50 homolog                  231   5e-71    
dbj|GAM19513.1|  hypothetical protein SAMD00019534_026880               234   7e-71    Acytostelium subglobosum LB1
ref|XP_005848175.1|  hypothetical protein CHLNCDRAFT_22928              234   9e-71    Chlorella variabilis
gb|EMS49427.1|  hypothetical protein TRIUR3_32733                       233   4e-70    Triticum urartu
ref|XP_629704.1|  UNC-50 family protein                                 231   2e-69    Dictyostelium discoideum AX4
ref|XP_003294507.1|  hypothetical protein DICPUDRAFT_159511             230   3e-69    Dictyostelium purpureum
ref|XP_003082233.1|  putative UNC50 (ISS)                               230   9e-69    Ostreococcus tauri
ref|XP_001420594.1|  predicted protein                                  223   1e-66    Ostreococcus lucimarinus CCE9901
gb|EXX54778.1|  Gmh1p                                                   215   1e-62    Rhizophagus irregularis DAOM 197198w
ref|XP_004354055.1|  hypothetical protein ACA1_165790                   205   6e-60    Acanthamoeba castellanii str. Neff
ref|XP_006676512.1|  hypothetical protein BATDEDRAFT_9454               206   2e-59    Batrachochytrium dendrobatidis JAM81
gb|ESA04707.1|  hypothetical protein GLOINDRAFT_38971                   202   7e-59    
ref|XP_007511940.1|  predicted protein                                  201   1e-57    Bathycoccus prasinos
emb|CDH59652.1|  unc-50-like protein                                    199   4e-57    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_008338222.1|  PREDICTED: protein unc-50 homolog                  192   2e-56    
ref|XP_008612241.1|  hypothetical protein SDRG_08150                    197   6e-56    Saprolegnia diclina VS20
gb|ETL47305.1|  hypothetical protein L916_02928                         197   8e-56    Phytophthora parasitica
dbj|GAN10508.1|  UNC-50-like protein                                    196   9e-56    Mucor ambiguus
gb|KFH64319.1|  hypothetical protein MVEG_10144                         196   2e-55    Mortierella verticillata NRRL 6337
emb|CDX98085.1|  BnaA06g08360D                                          190   2e-55    
gb|EPB86813.1|  hypothetical protein HMPREF1544_06429                   193   3e-55    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008916126.1|  hypothetical protein PPTG_19429                    195   4e-55    Phytophthora parasitica INRA-310
emb|CDR40017.1|  CYFA0S04e01750g1_1                                     195   4e-55    Cyberlindnera fabianii
gb|ACU18710.1|  unknown                                                 188   1e-54    Glycine max [soybeans]
emb|CDS07641.1|  hypothetical protein LRAMOSA01590                      189   5e-54    Lichtheimia ramosa
ref|XP_002899351.1|  transmembrane protein, putative                    192   6e-54    Phytophthora infestans T30-4
ref|XP_009537820.1|  hypothetical protein PHYSODRAFT_565867             192   6e-54    Phytophthora sojae
ref|XP_011401270.1|  Unc-50-like protein                                188   2e-53    Auxenochlorella protothecoides
gb|EPB86721.1|  hypothetical protein HMPREF1544_06507                   189   2e-53    Mucor circinelloides f. circinelloides 1006PhL
gb|EMS24311.1|  UNC-50-like protein                                     188   4e-53    Rhodotorula toruloides NP11
ref|XP_002112386.1|  hypothetical protein TRIADDRAFT_24802              187   1e-52    Trichoplax adhaerens
ref|XP_007197375.1|  PREDICTED: protein unc-50 homolog                  186   6e-52    Balaenoptera acutorostrata scammoni
gb|KDO25449.1|  hypothetical protein SPRG_09392                         189   7e-52    Saprolegnia parasitica CBS 223.65
ref|NP_001146770.1|  uncharacterized protein LOC100280372               180   1e-51    
emb|CDS07387.1|  hypothetical protein LRAMOSA01336                      184   1e-51    Lichtheimia ramosa
ref|XP_008844068.1|  PREDICTED: protein unc-50 homolog                  184   1e-51    Nannospalax galili
ref|XP_007501158.1|  PREDICTED: protein unc-50 homolog isoform X2       184   1e-51    Monodelphis domestica
gb|EFA81996.1|  UNC-50 family protein                                   182   2e-51    Heterostelium album PN500
ref|NP_620274.1|  protein unc-50 homolog                                184   3e-51    Rattus norvegicus [brown rat]
ref|XP_008978360.1|  PREDICTED: protein unc-50 homolog isoform X2       184   3e-51    Callithrix jacchus [common marmoset]
ref|XP_005359995.1|  PREDICTED: protein unc-50 homolog                  183   4e-51    Microtus ochrogaster [prairie voles]
ref|XP_006177666.1|  PREDICTED: protein unc-50 homolog                  183   4e-51    Camelus ferus
ref|XP_009664646.1|  PREDICTED: protein unc-50 homolog                  183   6e-51    Struthio camelus australis
ref|XP_006203938.1|  PREDICTED: protein unc-50 homolog                  183   7e-51    Vicugna pacos
ref|XP_004369383.1|  PREDICTED: protein unc-50 homolog                  182   8e-51    Trichechus manatus latirostris
ref|XP_005339664.1|  PREDICTED: protein unc-50 homolog isoform X1       182   9e-51    Ictidomys tridecemlineatus
emb|CAB45714.1|  hypothetical protein                                   182   1e-50    Homo sapiens [man]
ref|XP_003794391.1|  PREDICTED: protein unc-50 homolog                  182   1e-50    Otolemur garnettii
ref|XP_005400780.1|  PREDICTED: protein unc-50 homolog isoform X1       182   1e-50    Chinchilla lanigera
ref|XP_005075445.1|  PREDICTED: protein unc-50 homolog                  182   1e-50    Mesocricetus auratus [Syrian golden hamster]
ref|XP_006980507.1|  PREDICTED: protein unc-50 homolog                  182   1e-50    Peromyscus maniculatus bairdii
ref|XP_005400781.1|  PREDICTED: protein unc-50 homolog isoform X2       182   1e-50    Chinchilla lanigera
ref|XP_002611641.1|  hypothetical protein BRAFLDRAFT_63694              181   2e-50    Branchiostoma floridae
ref|XP_009055533.1|  hypothetical protein LOTGIDRAFT_153387             181   2e-50    Lottia gigantea
ref|XP_006166648.1|  PREDICTED: protein unc-50 homolog                  182   2e-50    Tupaia chinensis
ref|XP_002811726.1|  PREDICTED: protein unc-50 homolog                  181   2e-50    Pongo abelii [orang utan]
ref|XP_004669848.1|  PREDICTED: protein unc-50 homolog                  181   2e-50    Jaculus jaculus
ref|NP_054763.2|  protein unc-50 homolog                                181   2e-50    Homo sapiens [man]
gb|KFP47788.1|  Protein unc-50                                          181   2e-50    Cathartes aura
ref|XP_006870815.1|  PREDICTED: protein unc-50 homolog                  181   2e-50    Chrysochloris asiatica
ref|XP_004315896.1|  PREDICTED: protein unc-50 homolog isoform 1        182   2e-50    
ref|XP_004315897.1|  PREDICTED: protein unc-50 homolog isoform 2        181   2e-50    Tursiops truncatus [Atlantic bottle-nosed dolphin]
gb|EDL14524.1|  unc-50 homolog (C. elegans), isoform CRA_b              181   2e-50    Mus musculus [mouse]
ref|XP_004594279.1|  PREDICTED: protein unc-50 homolog                  181   3e-50    Ochotona princeps [southern American pika]
ref|XP_003124957.1|  PREDICTED: protein unc-50 homolog isoform 2        181   3e-50    Sus scrofa [pigs]
ref|XP_007109670.1|  PREDICTED: protein unc-50 homolog isoform X2       181   3e-50    
ref|XP_003765692.1|  PREDICTED: protein unc-50 homolog                  184   3e-50    Sarcophilus harrisii
ref|XP_004277814.1|  PREDICTED: protein unc-50 homolog isoform 2        181   3e-50    Orcinus orca [Orca]
ref|XP_004615859.1|  PREDICTED: protein unc-50 homolog                  181   3e-50    Sorex araneus [Eurasian shrew]
ref|NP_080399.1|  protein unc-50 homolog                                181   3e-50    Mus musculus [mouse]
ref|XP_004277813.1|  PREDICTED: protein unc-50 homolog isoform 1        181   3e-50    
gb|KFZ63733.1|  Protein unc-50                                          181   3e-50    Podiceps cristatus
ref|XP_007615954.1|  PREDICTED: protein unc-50 homolog isoform X3       181   3e-50    
dbj|GAN07871.1|  UNC-50-like protein                                    181   3e-50    Mucor ambiguus
ref|XP_006879434.1|  PREDICTED: protein unc-50 homolog                  181   4e-50    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003413641.1|  PREDICTED: protein unc-50 homolog                  181   4e-50    
ref|XP_005212372.1|  PREDICTED: protein unc-50 homolog isoform X3       181   4e-50    Bos taurus [bovine]
ref|XP_005977165.1|  PREDICTED: protein unc-50 homolog                  181   4e-50    Pantholops hodgsonii [Tibetan antelope]
ref|XP_005263970.1|  PREDICTED: protein unc-50 homolog isoform X2       181   4e-50    
gb|ELR46035.1|  Protein unc-50-like protein                             181   4e-50    Bos mutus
ref|XP_854439.1|  PREDICTED: protein unc-50 homolog isoform X2          181   4e-50    Canis lupus familiaris [dogs]
emb|CDH60549.1|  unc-50-like protein                                    181   4e-50    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010641529.1|  PREDICTED: protein unc-50 homolog                  181   4e-50    
ref|XP_001363404.2|  PREDICTED: protein unc-50 homolog isoform X1       184   4e-50    Monodelphis domestica
ref|XP_003471703.1|  PREDICTED: protein unc-50 homolog isoform X1       181   4e-50    Cavia porcellus [guinea pig]
ref|XP_003218830.1|  PREDICTED: protein unc-50 homolog                  181   4e-50    Anolis carolinensis [Carolina anole]
ref|XP_002710038.1|  PREDICTED: protein unc-50 homolog                  181   5e-50    Oryctolagus cuniculus [domestic rabbit]
ref|XP_009321854.1|  PREDICTED: protein unc-50 homolog                  181   5e-50    Pygoscelis adeliae
ref|XP_009694201.1|  PREDICTED: protein unc-50 homolog                  181   5e-50    Cariama cristata
ref|XP_007383729.1|  UNC-50-like protein                                181   5e-50    Punctularia strigosozonata HHB-11173 SS5
ref|XP_004006198.1|  PREDICTED: protein unc-50 homolog                  180   5e-50    Ovis aries [domestic sheep]
ref|XP_009865405.1|  PREDICTED: protein unc-50 homolog                  180   6e-50    Apaloderma vittatum
ref|XP_005228739.1|  PREDICTED: protein unc-50 homolog                  180   6e-50    Falco peregrinus [peregrine]
ref|XP_008064240.1|  PREDICTED: protein unc-50 homolog                  180   6e-50    Carlito syrichta
ref|NP_001014921.1|  protein unc-50 homolog                             180   6e-50    Bos taurus [bovine]
ref|XP_007957650.1|  PREDICTED: protein unc-50 homolog                  180   6e-50    Orycteropus afer afer
ref|XP_008978361.1|  PREDICTED: protein unc-50 homolog isoform X3       180   6e-50    Callithrix jacchus [common marmoset]
ref|XP_004686209.1|  PREDICTED: protein unc-50 homolog                  180   6e-50    Condylura cristata
ref|XP_003983960.1|  PREDICTED: protein unc-50 homolog                  180   7e-50    Felis catus [cat]
ref|XP_011811937.1|  PREDICTED: protein unc-50 homolog isoform X1       180   7e-50    Colobus angolensis palliatus
ref|XP_010725972.1|  PREDICTED: protein unc-50 homolog                  180   7e-50    Meleagris gallopavo [common turkey]
ref|XP_005686328.1|  PREDICTED: protein unc-50 homolog isoform X1       180   7e-50    
ref|XP_002757453.1|  PREDICTED: protein unc-50 homolog isoform X1       180   7e-50    Callithrix jacchus [common marmoset]
ref|XP_009470844.1|  PREDICTED: protein unc-50 homolog                  180   7e-50    Nipponia nippon
ref|XP_001493222.2|  PREDICTED: protein unc-50 homolog                  180   7e-50    
ref|NP_001182377.1|  unc-50 homolog                                     180   7e-50    Macaca mulatta [rhesus macaque]
ref|XP_011911048.1|  PREDICTED: protein unc-50 homolog                  180   8e-50    Cercocebus atys
ref|XP_010163802.1|  PREDICTED: protein unc-50 homolog                  180   8e-50    Antrostomus carolinensis
ref|XP_005502640.1|  PREDICTED: protein unc-50 homolog                  180   8e-50    Columba livia [carrier pigeon]
ref|XP_007466942.1|  PREDICTED: protein unc-50 homolog                  180   8e-50    Lipotes vexillifer [baiji]
ref|XP_011811938.1|  PREDICTED: protein unc-50 homolog isoform X2       180   8e-50    Colobus angolensis palliatus
ref|XP_004474429.1|  PREDICTED: protein unc-50 homolog isoform 1        180   9e-50    Dasypus novemcinctus
ref|XP_002920011.1|  PREDICTED: protein unc-50 homolog                  180   9e-50    Ailuropoda melanoleuca
ref|XP_010727867.1|  PREDICTED: protein unc-50 homolog                  179   1e-49    
ref|XP_007521910.1|  PREDICTED: protein unc-50 homolog                  179   1e-49    
ref|XP_010310695.1|  PREDICTED: protein unc-50 homolog                  179   1e-49    Balearica regulorum gibbericeps
ref|XP_010135874.1|  PREDICTED: protein unc-50 homolog                  179   1e-49    Buceros rhinoceros silvestris
gb|EHH55775.1|  hypothetical protein EGM_05043                          179   1e-49    Macaca fascicularis [crab eating macaque]
ref|XP_005706263.1|  UNC-50 family protein isoform 2                    178   1e-49    Galdieria sulphuraria
ref|XP_006059966.1|  PREDICTED: protein unc-50 homolog                  179   1e-49    Bubalus bubalis [domestic water buffalo]
ref|XP_004633238.1|  PREDICTED: protein unc-50 homolog                  180   1e-49    
ref|XP_010360423.1|  PREDICTED: protein unc-50 homolog isoform X1       179   1e-49    Rhinopithecus roxellana
ref|XP_005706262.1|  UNC-50 family protein isoform 1                    178   1e-49    Galdieria sulphuraria
ref|XP_007244197.1|  PREDICTED: protein unc-50 homolog                  181   1e-49    
gb|AAH39078.1|  Unc-50 homolog (C. elegans)                             179   1e-49    Homo sapiens [man]
ref|XP_009635948.1|  PREDICTED: protein unc-50 homolog                  179   1e-49    Egretta garzetta
ref|XP_009280076.1|  PREDICTED: protein unc-50 homolog isoform X1       179   1e-49    Aptenodytes forsteri
dbj|BAD96319.1|  unc-50 homolog                                         179   1e-49    Homo sapiens [man]
ref|XP_006734276.1|  PREDICTED: protein unc-50 homolog isoform X1       179   2e-49    Leptonychotes weddellii
ref|XP_004896629.1|  PREDICTED: protein unc-50 homolog isoform X2       179   2e-49    
ref|XP_010118916.1|  PREDICTED: protein unc-50 homolog                  179   2e-49    Chlamydotis macqueenii
ref|XP_009078456.1|  PREDICTED: protein unc-50 homolog                  179   2e-49    Acanthisitta chloris
ref|XP_006734277.1|  PREDICTED: protein unc-50 homolog isoform X2       179   2e-49    Leptonychotes weddellii
ref|XP_004400190.1|  PREDICTED: protein unc-50 homolog isoform 1        179   2e-49    Odobenus rosmarus divergens
ref|XP_005212369.2|  PREDICTED: protein unc-50 homolog isoform X2       180   2e-49    
gb|EFB24064.1|  hypothetical protein PANDA_008691                       179   2e-49    Ailuropoda melanoleuca
ref|XP_011272571.1|  putative membrane protein                          180   2e-49    Wickerhamomyces ciferrii
ref|XP_005750571.1|  PREDICTED: protein unc-50 homolog                  179   2e-49    Pundamilia nyererei
ref|XP_004575434.1|  PREDICTED: protein unc-50 homolog                  179   2e-49    Maylandia zebra
ref|XP_006807177.1|  PREDICTED: LOW QUALITY PROTEIN: protein unc-...    179   2e-49    Neolamprologus brichardi [lyretail cichlid]
ref|XP_004704408.1|  PREDICTED: protein unc-50 homolog                  179   2e-49    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004752941.1|  PREDICTED: protein unc-50 homolog isoform X1       179   3e-49    Mustela putorius furo [black ferret]
ref|XP_010070908.1|  PREDICTED: protein unc-50 homolog                  178   3e-49    Pterocles gutturalis
ref|XP_005013489.1|  PREDICTED: protein unc-50 homolog                  178   3e-49    
ref|XP_009901345.1|  PREDICTED: protein unc-50 homolog                  178   3e-49    Picoides pubescens
ref|XP_004896628.1|  PREDICTED: protein unc-50 homolog isoform X1       179   3e-49    
ref|XP_005151440.1|  PREDICTED: protein unc-50 homolog                  178   4e-49    Melopsittacus undulatus
ref|XP_009501868.1|  PREDICTED: protein unc-50 homolog                  178   4e-49    Phalacrocorax carbo [common cormorant]
ref|XP_002196813.1|  PREDICTED: protein unc-50 homolog                  178   4e-49    
gb|EHB10596.1|  unc-50-like protein                                     178   4e-49    Heterocephalus glaber [naked mole rat]
ref|XP_005212368.1|  PREDICTED: protein unc-50 homolog isoform X1       179   5e-49    
ref|XP_006909479.1|  PREDICTED: protein unc-50 homolog isoform X1       178   5e-49    Pteropus alecto
ref|XP_008932429.1|  PREDICTED: protein unc-50 homolog                  178   5e-49    
ref|XP_009083646.1|  PREDICTED: protein unc-50 homolog                  178   5e-49    Serinus canaria [canary]
ref|XP_005516582.1|  PREDICTED: protein unc-50 homolog                  178   5e-49    Pseudopodoces humilis [Tibetan ground-jay]
gb|AAP20057.1|  HSD23                                                   177   6e-49    Homo sapiens [man]
ref|XP_005037641.1|  PREDICTED: protein unc-50 homolog isoform X1       177   7e-49    
ref|NP_001264682.1|  protein unc-50 homolog                             177   9e-49    Gallus gallus [bantam]
emb|CCA22710.1|  transmembrane protein putative                         180   1e-48    Albugo laibachii Nc14
ref|XP_005862266.1|  PREDICTED: protein unc-50 homolog isoform X2       177   1e-48    Myotis brandtii
ref|XP_006097790.1|  PREDICTED: protein unc-50 homolog                  177   1e-48    Myotis lucifugus
ref|XP_001636568.1|  predicted protein                                  176   1e-48    Nematostella vectensis
ref|XP_003498333.1|  PREDICTED: protein unc-50 homolog isoform X1       176   2e-48    Cricetulus griseus [Chinese hamsters]
ref|XP_008322929.1|  PREDICTED: protein unc-50 homolog                  176   2e-48    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006773107.1|  PREDICTED: protein unc-50 homolog isoform X1       176   2e-48    Myotis davidii
ref|XP_001742979.1|  hypothetical protein                               175   5e-48    Monosiga brevicollis MX1
gb|EMD34649.1|  hypothetical protein CERSUDRAFT_116823                  175   6e-48    Gelatoporia subvermispora B
ref|XP_008154732.1|  PREDICTED: protein unc-50 homolog                  176   6e-48    
ref|XP_009982050.1|  PREDICTED: protein unc-50 homolog                  174   9e-48    Tauraco erythrolophus
ref|XP_009942198.1|  PREDICTED: protein unc-50 homolog                  173   1e-47    Opisthocomus hoazin [hoatzin]
ref|XP_002180372.1|  predicted protein                                  172   1e-47    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003455933.1|  PREDICTED: protein unc-50 homolog                  174   1e-47    Oreochromis niloticus
ref|XP_007069043.1|  PREDICTED: protein unc-50 homolog                  173   3e-47    Chelonia mydas [green seaturtle]
ref|XP_010145856.1|  PREDICTED: protein unc-50 homolog                  173   3e-47    Eurypyga helias
ref|XP_008496291.1|  PREDICTED: protein unc-50 homolog                  173   3e-47    Calypte anna
ref|XP_009556227.1|  PREDICTED: protein unc-50 homolog                  173   3e-47    Cuculus canorus
ref|XP_005811435.1|  PREDICTED: protein unc-50 homolog                  173   3e-47    Xiphophorus maculatus
ref|XP_010014017.1|  PREDICTED: protein unc-50 homolog                  173   3e-47    Nestor notabilis
ref|NP_956541.1|  protein unc-50 homolog                                173   3e-47    Danio rerio [leopard danio]
ref|XP_009996985.1|  PREDICTED: protein unc-50 homolog                  173   4e-47    
gb|KIY48492.1|  UNC-50 protein                                          173   4e-47    
gb|KIM42215.1|  hypothetical protein M413DRAFT_444663                   172   4e-47    
gb|KFQ83584.1|  Protein unc-50                                          172   4e-47    
ref|XP_006137461.1|  PREDICTED: protein unc-50 homolog isoform X1       172   5e-47    
ref|XP_008279277.1|  PREDICTED: protein unc-50 homolog                  172   6e-47    
ref|XP_006819262.1|  PREDICTED: protein unc-50 homolog A-like           172   7e-47    
ref|NP_001290995.1|  unc-50 homolog                                     172   8e-47    
ref|NP_001135705.1|  unc-50 homolog                                     172   9e-47    
ref|XP_007313694.1|  hypothetical protein SERLADRAFT_457222             172   1e-46    
ref|XP_009578261.1|  PREDICTED: protein unc-50 homolog                  172   1e-46    
gb|EPT05753.1|  hypothetical protein FOMPIDRAFT_1111164                 172   1e-46    
gb|KDD76873.1|  UNC-50 family protein                                   171   1e-46    
ref|XP_007889335.1|  PREDICTED: protein unc-50 homolog                  171   2e-46    
ref|NP_001085372.1|  protein unc-50 homolog A                           171   2e-46    
ref|NP_001088522.1|  protein unc-50 homolog B                           171   3e-46    
ref|XP_009861515.1|  PREDICTED: protein unc-50 homolog isoform X1       171   3e-46    
gb|KIL62269.1|  hypothetical protein M378DRAFT_165972                   170   4e-46    
ref|XP_010216133.1|  PREDICTED: protein unc-50 homolog                  170   4e-46    
gb|KGL79450.1|  Protein unc-50                                          169   6e-46    
gb|ELK14782.1|  Protein unc-50 like protein                             174   6e-46    
ref|XP_008937797.1|  PREDICTED: protein unc-50 homolog                  169   8e-46    
gb|ETE68935.1|  Protein unc-50-like A                                   169   1e-45    
ref|XP_004343182.1|  hypothetical protein CAOG_07323                    171   1e-45    
ref|XP_005283277.1|  PREDICTED: protein unc-50 homolog                  169   2e-45    
ref|XP_005106924.1|  PREDICTED: protein unc-50 homolog                  169   2e-45    
ref|XP_002288807.1|  predicted protein                                  167   2e-45    
gb|KDE06096.1|  hypothetical protein MVLG_03515                         169   2e-45    
ref|XP_006259401.1|  PREDICTED: protein unc-50 homolog                  168   2e-45    
ref|XP_006026387.1|  PREDICTED: protein unc-50 homolog isoform X3       168   2e-45    
ref|XP_006026386.1|  PREDICTED: protein unc-50 homolog isoform X2       168   3e-45    
ref|XP_003328223.2|  hypothetical protein PGTG_09517                    170   3e-45    
ref|XP_005855343.1|  unc-50 family protein                              168   3e-45    
ref|XP_007428815.1|  PREDICTED: protein unc-50 homolog isoform X1       168   3e-45    
gb|EWM29534.1|  unc-50 family protein                                   168   3e-45    
ref|XP_007878595.1|  hypothetical protein PFL1_02891                    167   3e-45    
emb|CCI42182.1|  unnamed protein product                                176   3e-45    
ref|XP_008045490.1|  UNC-50-like protein                                167   4e-45    
ref|XP_006026385.1|  PREDICTED: protein unc-50 homolog isoform X1       167   4e-45    
gb|KIJ99107.1|  hypothetical protein K443DRAFT_680257                   167   4e-45    
gb|ACI66574.1|  unc-50 homolog                                          167   6e-45    
gb|KFM58730.1|  hypothetical protein X975_25795                         167   7e-45    
ref|XP_007370707.1|  UNC-50-like protein                                166   8e-45    
ref|XP_785090.2|  PREDICTED: protein unc-50 homolog                     167   8e-45    
ref|XP_001884712.1|  predicted protein                                  166   8e-45    
ref|XP_001838985.2|  hypothetical protein CC1G_05538                    166   8e-45    
gb|KII91286.1|  hypothetical protein PLICRDRAFT_38019                   166   9e-45    
ref|XP_004066662.1|  PREDICTED: protein unc-50 homolog                  166   9e-45    
ref|XP_969730.1|  PREDICTED: protein unc-50 homolog                     166   9e-45    
gb|KIM69493.1|  hypothetical protein SCLCIDRAFT_1207927                 166   1e-44    
ref|XP_009965644.1|  PREDICTED: protein unc-50 homolog                  165   1e-44    
ref|XP_007775373.1|  UNC-50-like protein                                166   1e-44    
ref|XP_006010677.1|  PREDICTED: protein unc-50 homolog isoform X1       166   1e-44    
emb|CDQ82972.1|  unnamed protein product                                167   2e-44    
ref|NP_001167379.1|  protein unc-50 homolog                             166   2e-44    
ref|XP_007348433.1|  UNC-50-like protein                                166   3e-44    
ref|XP_008424885.1|  PREDICTED: protein unc-50 homolog                  165   3e-44    
ref|XP_009552003.1|  hypothetical protein HETIRDRAFT_436750             165   3e-44    
emb|CDK26325.1|  unnamed protein product                                166   5e-44    
ref|XP_011426963.1|  PREDICTED: protein unc-50 homolog                  165   5e-44    
gb|KDQ08806.1|  hypothetical protein BOTBODRAFT_165591                  165   5e-44    
emb|CDQ94381.1|  unnamed protein product                                166   8e-44    
ref|XP_006712467.1|  PREDICTED: protein unc-50 homolog isoform X3       164   8e-44    
ref|NP_001040161.1|  unc-50-like protein                                164   9e-44    
gb|ELU08114.1|  hypothetical protein CAPTEDRAFT_148077                  164   1e-43    
gb|KIO18552.1|  hypothetical protein M407DRAFT_246444                   162   1e-43    
ref|XP_007565419.1|  PREDICTED: protein unc-50 homolog                  163   2e-43    
gb|KIK55005.1|  hypothetical protein GYMLUDRAFT_176255                  162   2e-43    
emb|CCX33783.1|  Similar to Protein GMH1 homolog; acc. no. P87155       163   2e-43    
ref|XP_006712466.1|  PREDICTED: protein unc-50 homolog isoform X1       164   2e-43    
ref|XP_007263761.1|  UNC-50-like protein                                163   2e-43    
ref|XP_011825009.1|  PREDICTED: protein unc-50 homolog isoform X1       162   3e-43    
ref|XP_010360424.1|  PREDICTED: protein unc-50 homolog isoform X2       162   3e-43    
ref|XP_007002538.1|  hypothetical protein TREMEDRAFT_42665              162   3e-43    
gb|KDR17270.1|  Unc-50-like protein                                     163   3e-43    
gb|KDQ59999.1|  hypothetical protein JAAARDRAFT_592665                  162   3e-43    
ref|XP_002425654.1|  conserved hypothetical protein                     162   5e-43    
ref|XP_005819408.1|  hypothetical protein GUITHDRAFT_121394             159   5e-43    
ref|XP_007109671.1|  PREDICTED: protein unc-50 homolog isoform X3       161   7e-43    
ref|XP_010350355.1|  PREDICTED: protein unc-50 homolog isoform X2       160   9e-43    
ref|XP_003028533.1|  hypothetical protein SCHCODRAFT_31421              160   9e-43    
ref|XP_001844230.1|  GMH1                                               162   9e-43    
gb|KDR68357.1|  hypothetical protein GALMADRAFT_1040817                 161   9e-43    
ref|XP_009837168.1|  hypothetical protein H257_11830                    168   1e-42    
ref|XP_007308896.1|  UNC-50-like protein                                161   1e-42    
gb|KFQ65675.1|  Protein unc-50                                          160   1e-42    
ref|XP_001664104.1|  AAEL013898-PA                                      161   1e-42    
gb|KDQ22505.1|  hypothetical protein PLEOSDRAFT_1068813                 160   1e-42    
ref|XP_006734278.1|  PREDICTED: protein unc-50 homolog isoform X3       160   1e-42    
ref|XP_005575107.1|  PREDICTED: protein unc-50 homolog isoform X2       159   2e-42    
ref|XP_012052012.1|  UNC-50 family protein                              161   2e-42    
ref|XP_008866062.1|  hypothetical protein H310_03819                    167   2e-42    
ref|XP_004474431.1|  PREDICTED: protein unc-50 homolog isoform 3        159   2e-42    
ref|XP_009018632.1|  hypothetical protein HELRODRAFT_100226             160   2e-42    
ref|XP_008477323.1|  PREDICTED: protein unc-50 homolog                  160   2e-42    
gb|KIY63159.1|  UNC-50 protein                                          160   3e-42    
gb|KIR49595.1|  UNC-50 family protein                                   160   3e-42    
ref|XP_006638943.1|  PREDICTED: protein unc-50 homolog                  160   3e-42    
gb|KIR89096.1|  UNC-50 family protein                                   160   4e-42    
ref|XP_001359807.1|  GA22025                                            160   4e-42    
emb|CEF67771.1|  Protein unc-50 homolog                                 160   5e-42    
gb|ACN94714.1|  GA22025                                                 160   5e-42    
ref|XP_007109669.1|  PREDICTED: protein unc-50 homolog isoform X1       160   6e-42    
ref|XP_005862265.1|  PREDICTED: protein unc-50 homolog isoform X1       157   6e-42    
gb|EPB66733.1|  UNC-50 family protein                                   161   7e-42    
gb|EJY85679.1|  hypothetical protein OXYTRI_16336                       159   7e-42    
ref|XP_003193893.1|  transport-related protein                          159   8e-42    
gb|KIR56936.1|  UNC-50 family protein                                   159   1e-41    
gb|KIK28273.1|  hypothetical protein PISMIDRAFT_91497                   158   1e-41    
gb|KIO09558.1|  hypothetical protein M404DRAFT_131326                   158   1e-41    
ref|XP_009488714.1|  PREDICTED: protein unc-50 homolog                  157   1e-41    
gb|ERE92693.1|  putative protein unc-50 like protein                    157   1e-41    
ref|XP_006773108.1|  PREDICTED: protein unc-50 homolog isoform X2       157   1e-41    
emb|CDO71142.1|  hypothetical protein BN946_scf184845.g12               158   1e-41    
gb|ESW97300.1|  Protein GMH1                                            160   1e-41    
ref|XP_567471.1|  transport-related protein                             159   1e-41    
gb|KIM73995.1|  hypothetical protein PILCRDRAFT_80534                   157   2e-41    
gb|EJT99298.1|  UNC-50-like protein                                     157   2e-41    
dbj|GAA97099.1|  hypothetical protein E5Q_03774                         167   2e-41    
ref|XP_002435165.1|  conserved hypothetical protein                     157   3e-41    
ref|XP_009280084.1|  PREDICTED: protein unc-50 homolog isoform X2       156   3e-41    
ref|XP_007868022.1|  UNC-50 protein                                     157   3e-41    
gb|KJA26840.1|  hypothetical protein HYPSUDRAFT_1032763                 157   4e-41    
gb|EJK64009.1|  hypothetical protein THAOC_15303                        158   4e-41    
dbj|BAM18657.1|  similar to CG9773                                      157   4e-41    
gb|KIR35966.1|  UNC-50 family protein                                   157   5e-41    
ref|XP_001999876.1|  GI22834                                            157   5e-41    
gb|KHJ42429.1|  UNC-50 family protein                                   157   8e-41    
gb|ETN60850.1|  GMH1                                                    156   1e-40    
ref|XP_003748488.1|  PREDICTED: protein unc-50 homolog A-like           155   1e-40    
gb|KGB75162.1|  hypothetical protein CNBG_1000                          156   1e-40    
gb|KFD46541.1|  hypothetical protein M513_12592                         157   1e-40    
ref|NP_499279.2|  Protein UNC-50                                        156   1e-40    
gb|KEP49339.1|  UNC-50 family protein                                   156   2e-40    
ref|XP_005037642.1|  PREDICTED: protein unc-50 homolog isoform X2       154   2e-40    
ref|XP_005190933.1|  PREDICTED: protein unc-50 homolog                  155   2e-40    
gb|KIJ63056.1|  hypothetical protein HYDPIDRAFT_113586                  155   2e-40    
ref|XP_002054685.1|  GJ24589                                            155   2e-40    
ref|NP_596353.1|  UNC-50 family protein                                 154   2e-40    
ref|XP_001954246.1|  GF16844                                            155   2e-40    
emb|CEL62791.1|  Protein unc-50 homolog OS=Homo sapiens GN=UNC50 ...    155   2e-40    
ref|XP_010574054.1|  PREDICTED: protein unc-50 homolog isoform X2       154   3e-40    
ref|XP_011211146.1|  PREDICTED: protein unc-50 homolog                  155   3e-40    
ref|XP_007411486.1|  hypothetical protein MELLADRAFT_36936              155   3e-40    
emb|CDW54205.1|  Protein unc-50                                         155   4e-40    
ref|XP_008203077.1|  PREDICTED: protein unc-50 homolog isoform X1       155   4e-40    
ref|XP_001607727.1|  PREDICTED: protein unc-50 homolog isoform X2       154   4e-40    
gb|KHN71992.1|  Protein unc-50                                          156   6e-40    
gb|KFD64074.1|  hypothetical protein M514_12592                         156   6e-40    
ref|XP_003110942.1|  CRE-UNC-50 protein                                 155   8e-40    
emb|CBY20817.1|  unnamed protein product                                153   1e-39    
gb|ADV92279.1|  unc-50 protein                                          154   2e-39    
ref|XP_009182994.1|  PREDICTED: protein unc-50 homolog                  152   2e-39    
emb|CAP21176.2|  Protein CBR-UNC-50                                     154   2e-39    
gb|EGT34681.1|  CBN-UNC-50 protein                                      153   3e-39    
gb|KEQ69377.1|  UNC-50 protein                                          151   3e-39    
ref|XP_006463711.1|  hypothetical protein AGABI2DRAFT_194460            151   4e-39    
ref|XP_006010679.1|  PREDICTED: protein unc-50 homolog isoform X3       150   4e-39    
ref|XP_007394249.1|  hypothetical protein PHACADRAFT_118067             150   4e-39    
gb|KIK81286.1|  hypothetical protein PAXRUDRAFT_832958                  151   5e-39    
ref|XP_002641312.1|  C. briggsae CBR-UNC-50 protein                     153   6e-39    
ref|XP_003704823.1|  PREDICTED: protein unc-50 homolog                  151   6e-39    
gb|EFX87144.1|  hypothetical protein DAPPUDRAFT_221851                  152   7e-39    
gb|ADD38426.1|  Protein unc-50 homolog                                  151   7e-39    
gb|ERG78881.1|  protein unc-50                                          154   8e-39    
gb|KIP11852.1|  hypothetical protein PHLGIDRAFT_62907                   150   8e-39    
gb|KIJ15121.1|  hypothetical protein PAXINDRAFT_115140                  150   8e-39    
ref|XP_011499403.1|  PREDICTED: protein unc-50 homolog                  150   1e-38    
gb|KJH49065.1|  UNC-50 family protein                                   151   1e-38    
ref|XP_011555226.1|  PREDICTED: protein unc-50 homolog                  150   1e-38    
ref|XP_003397597.1|  PREDICTED: protein unc-50 homolog                  150   1e-38    
ref|XP_002069978.1|  GK11280                                            150   2e-38    
dbj|GAM83200.1|  hypothetical protein ANO11243_011860                   150   2e-38    
gb|ESL06549.1|  hypothetical protein TRSC58_05775                       149   2e-38    
ref|XP_312002.3|  AGAP002901-PA                                         150   2e-38    
ref|XP_008552750.1|  PREDICTED: protein unc-50 homolog                  150   3e-38    
ref|XP_006010678.1|  PREDICTED: protein unc-50 homolog isoform X2       149   3e-38    
gb|EMF08935.1|  UNC-50 protein                                          149   3e-38    
ref|XP_001980934.1|  GG17433                                            149   4e-38    
ref|XP_003486254.1|  PREDICTED: protein unc-50 homolog                  149   4e-38    
ref|NP_649813.1|  CG9773                                                149   4e-38    
ref|XP_623081.1|  PREDICTED: protein unc-50 homolog                     149   5e-38    
gb|EME40296.1|  hypothetical protein DOTSEDRAFT_159076                  148   6e-38    
ref|XP_011185523.1|  PREDICTED: protein unc-50 homolog                  149   7e-38    
gb|KEQ67417.1|  UNC-50 protein                                          147   1e-37    
ref|NP_001156115.1|  protein unc-50 homolog                             147   1e-37    
gb|KEQ93605.1|  hypothetical protein AUEXF2481DRAFT_99411               147   1e-37    
gb|EKF31770.1|  hypothetical protein MOQ_004390                         147   1e-37    
ref|XP_004994150.1|  hypothetical protein PTSG_04832                    146   2e-37    
ref|XP_004519584.1|  PREDICTED: protein unc-50 homolog                  147   2e-37    
ref|XP_010943205.1|  PREDICTED: protein unc-50 homolog                  141   2e-37    
ref|XP_011345582.1|  PREDICTED: protein unc-50 homolog                  146   3e-37    
ref|XP_011264181.1|  PREDICTED: protein unc-50 homolog                  146   4e-37    
ref|XP_011166375.1|  PREDICTED: protein unc-50 homolog                  146   4e-37    
ref|XP_001989849.1|  GH19021                                            146   6e-37    
ref|XP_002174094.1|  UNC-50 family protein                              145   6e-37    
ref|XP_005948786.1|  PREDICTED: protein unc-50 homolog isoform X2       144   7e-37    
gb|KEQ82785.1|  UNC-50 family protein                                   146   8e-37    
ref|XP_009032750.1|  hypothetical protein AURANDRAFT_60518              154   8e-37    
ref|XP_007853030.1|  hypothetical protein Moror_1893                    145   9e-37    
gb|ESS71077.1|  hypothetical protein TCDM_00100                         144   1e-36    
emb|CBK21170.2|  unnamed protein product                                144   1e-36    
gb|ELV11548.1|  Protein unc-50 like protein                             145   1e-36    
gb|KIW00855.1|  hypothetical protein PV09_07613                         145   1e-36    
gb|EKG03198.1|  hypothetical protein TCSYLVIO_005765                    145   2e-36    
emb|CCA69448.1|  related to GMH1-Golgi membrane protein of unknow...    143   2e-36    
gb|EFO21537.2|  hypothetical protein LOAG_06952                         145   2e-36    
ref|XP_011631220.1|  PREDICTED: protein unc-50 homolog                  144   2e-36    
ref|XP_504552.1|  YALI0E29447p                                          143   3e-36    
ref|XP_821661.1|  hypothetical protein                                  143   3e-36    
gb|KGK37279.1|  hypothetical protein JL09_g3567                         144   4e-36    
dbj|BAO40253.1|  protein GMH1                                           142   8e-36    
ref|XP_011307647.1|  PREDICTED: protein unc-50 homolog                  142   9e-36    
ref|XP_009309648.1|  unc-50 related protein                             142   1e-35    
emb|CCD12196.1|  unnamed protein product                                141   1e-35    
ref|XP_001895364.1|  Hypothetical 28.6 kDa protein T07A5.2 in chr...    142   1e-35    
emb|CCD78201.1|  hypothetical protein Smp_029040                        142   2e-35    
ref|XP_007581212.1|  putative integral membrane protein                 142   2e-35    
ref|XP_002156660.1|  PREDICTED: protein unc-50 homolog                  141   2e-35    
ref|XP_001217554.1|  conserved hypothetical protein                     142   2e-35    
gb|EPY50698.1|  UNC-50 family protein                                   139   7e-35    



>ref|XP_009801486.1| PREDICTED: protein unc-50 homolog [Nicotiana sylvestris]
Length=251

 Score =   482 bits (1241),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 228/252 (90%), Positives = 241/252 (96%), Gaps = 1/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S KGRTSSH RPNSV PQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTS-KGRTSSHVRPNSVLPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLL  +TLAYC AYDHSAGH VFVVISVLLFHF++TGA L+
Sbjct  60    KQTKNQWARDDPAFIVICSLLLVVATLAYCVAYDHSAGHAVFVVISVLLFHFVLTGATLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTNNYLREEAPSSH VEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP+LV HG
Sbjct  120   TCCWFLTNNYLREEAPSSHAVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPVLVAHG  179

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFIL GFNPS
Sbjct  180   FIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILIGFNPS  239

Query  355   RYFMNIYFSRAL  320
             R+FMNIYFSRAL
Sbjct  240   RHFMNIYFSRAL  251



>ref|XP_009629275.1| PREDICTED: protein unc-50 homolog [Nicotiana tomentosiformis]
Length=251

 Score =   478 bits (1231),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 225/252 (89%), Positives = 240/252 (95%), Gaps = 1/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S KGRTSSH RPNSV PQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTS-KGRTSSHVRPNSVLPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLL  +TLA+C AYDHSAGH VFVVISVLLFHF++TGA L+
Sbjct  60    KQTKNQWARDDPAFIVICSLLLVVATLAFCVAYDHSAGHAVFVVISVLLFHFVLTGATLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTNNYLREEAPSSH VEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP+LV HG
Sbjct  120   TCCWFLTNNYLREEAPSSHAVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPVLVAHG  179

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFIL GFNPS
Sbjct  180   FIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILIGFNPS  239

Query  355   RYFMNIYFSRAL  320
             R+FMNIYFS+ L
Sbjct  240   RHFMNIYFSKVL  251



>ref|XP_006346362.1| PREDICTED: protein unc-50 homolog [Solanum tuberosum]
Length=253

 Score =   477 bits (1227),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 225/253 (89%), Positives = 240/253 (95%), Gaps = 1/253 (0%)
 Frame = -1

Query  1075  MLPTSSLK-GRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPT+S   GRTSSH RPNSV PQYLR+I+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1     MLPTTSKGLGRTSSHVRPNSVLPQYLRKIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAFIVIC+LLL  +TLAYCAAYDHSAGH VFVVISVLLFHF++TGA L
Sbjct  61    HKQTKNQWARDDPAFIVICTLLLVIATLAYCAAYDHSAGHAVFVVISVLLFHFILTGATL  120

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +TCCWFLTNNYLREEAPSSH VEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP+LV H
Sbjct  121   ATCCWFLTNNYLREEAPSSHAVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAH  180

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GFIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFIL GFNP
Sbjct  181   GFIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILIGFNP  240

Query  358   SRYFMNIYFSRAL  320
             SR+FMNIYFSR L
Sbjct  241   SRHFMNIYFSRVL  253



>ref|XP_004230735.1| PREDICTED: protein unc-50 homolog [Solanum lycopersicum]
Length=253

 Score =   475 bits (1223),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 224/253 (89%), Positives = 239/253 (94%), Gaps = 1/253 (0%)
 Frame = -1

Query  1075  MLPTSSLK-GRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPT+S   GRTSSH RPNSV PQYLR+I+KWQQMDIEYTFWQM HLCTSPKVVYQHTKY
Sbjct  1     MLPTTSKGLGRTSSHVRPNSVLPQYLRKIIKWQQMDIEYTFWQMFHLCTSPKVVYQHTKY  60

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAFIVIC+LLL  +TLAYCAAYDHSAGH VFVVISVLLFHF++TGA L
Sbjct  61    HKQTKNQWARDDPAFIVICTLLLVIATLAYCAAYDHSAGHAVFVVISVLLFHFILTGATL  120

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +TCCWFLTNNYLREEAPSSH VEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP+LV H
Sbjct  121   ATCCWFLTNNYLREEAPSSHAVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAH  180

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GFIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFIL GFNP
Sbjct  181   GFIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILIGFNP  240

Query  358   SRYFMNIYFSRAL  320
             SR+FMNIYFSR L
Sbjct  241   SRHFMNIYFSRVL  253



>ref|XP_011092536.1| PREDICTED: protein unc-50 homolog isoform X1 [Sesamum indicum]
Length=253

 Score =   459 bits (1182),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 216/251 (86%), Positives = 234/251 (93%), Gaps = 1/251 (0%)
 Frame = -1

Query  1075  MLPTSS-LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPTSS  K R   HARPNS+FP YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1     MLPTSSSAKVRPGPHARPNSLFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF+VICSLLL+ S +AYCAAYDHSAGH VFVVISVLLFHFL++GA+L
Sbjct  61    HKQTKNQWARDDPAFVVICSLLLSVSAMAYCAAYDHSAGHAVFVVISVLLFHFLLSGAIL  120

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +TCCWF TNNYLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP+LV H
Sbjct  121   ATCCWFFTNNYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAH  180

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GF+P+LLSNLLFM AASYYHYLN+LGYDVLPFLERTT FLYPI IV VLSPI IL+GFNP
Sbjct  181   GFVPVLLSNLLFMAAASYYHYLNYLGYDVLPFLERTTLFLYPISIVFVLSPILILSGFNP  240

Query  358   SRYFMNIYFSR  326
             SRYFMN+YFSR
Sbjct  241   SRYFMNMYFSR  251



>gb|KJB47362.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=252

 Score =   458 bits (1179),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 214/250 (86%), Positives = 233/250 (93%), Gaps = 0/250 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1     MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+TG  L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVLLFHFLLTGVFLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYF+SP+LV HG
Sbjct  121   TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFVSPLLVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG++IVLSPI IL+GFNPS
Sbjct  181   FIPELLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVIIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSR  326
             RY MN+YFS+
Sbjct  241   RYVMNMYFSQ  250



>ref|XP_007042528.1| UNC-50 family protein isoform 1 [Theobroma cacao]
 gb|EOX98359.1| UNC-50 family protein isoform 1 [Theobroma cacao]
Length=252

 Score =   457 bits (1177),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 233/252 (92%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S    +SS +RPN +FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1     MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+ G  L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVFVVISVLLFHFLLAGVFLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCW LTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSP+LV HG
Sbjct  121   TCCWSLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSPLLVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL GFNPS
Sbjct  181   FIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILGGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMNIYFS+ L
Sbjct  241   RYFMNIYFSQRL  252



>ref|XP_012075870.1| PREDICTED: protein unc-50 homolog [Jatropha curcas]
Length=252

 Score =   455 bits (1170),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 227/253 (90%), Positives = 242/253 (96%), Gaps = 2/253 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTS-SHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPTSS K RTS S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1     MLPTSS-KARTSFSSSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  59

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHSA H VFVV+SVLLFHFLVTGAVL
Sbjct  60    HKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSAAHAVFVVVSVLLFHFLVTGAVL  119

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +TCCWFLTN YL+EEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYVVHYFLSP+LV H
Sbjct  120   ATCCWFLTNAYLKEEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVVHYFLSPLLVAH  179

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GFIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNP
Sbjct  180   GFIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNP  239

Query  358   SRYFMNIYFSRAL  320
             SRYFMNIYFS+ L
Sbjct  240   SRYFMNIYFSQRL  252



>gb|EYU42697.1| hypothetical protein MIMGU_mgv1a012334mg [Erythranthe guttata]
Length=253

 Score =   455 bits (1171),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 211/253 (83%), Positives = 234/253 (92%), Gaps = 1/253 (0%)
 Frame = -1

Query  1075  MLPTSS-LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPTSS  K R+ SH RPNS  P YLRRIVKWQQMDIEYTFWQML+LCTSPKVVYQHTKY
Sbjct  1     MLPTSSSAKARSGSHTRPNSFLPHYLRRIVKWQQMDIEYTFWQMLNLCTSPKVVYQHTKY  60

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF+VICSLLL  ST+AYCAAYDH AGH +FVVISVLLFHFL+ GA+L
Sbjct  61    HKQTKNQWARDDPAFVVICSLLLIVSTIAYCAAYDHGAGHAIFVVISVLLFHFLLIGAIL  120

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +TCCWF TNNYLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP+LV H
Sbjct  121   ATCCWFFTNNYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAH  180

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GF+P+LLSNLLFM A SYYHYLN+LGYDVLPFLERTT FLYPIG+V+VLSPI IL+GF+P
Sbjct  181   GFVPVLLSNLLFMAAVSYYHYLNYLGYDVLPFLERTTLFLYPIGVVLVLSPILILSGFSP  240

Query  358   SRYFMNIYFSRAL  320
             SRYFMN+YFS++L
Sbjct  241   SRYFMNMYFSQSL  253



>emb|CDO97222.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   455 bits (1171),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 217/262 (83%), Positives = 236/262 (90%), Gaps = 13/262 (5%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S KGRTSS+ARPNS FP YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTS-KGRTSSNARPNSPFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLL  ST AYCAAYDHS GH V+VV+SVLLFH L+TGA+L+
Sbjct  60    KQTKNQWARDDPAFVVICSLLLVVSTSAYCAAYDHSVGHAVYVVMSVLLFHLLMTGAILA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEW------------LYAFDVHCNSFFPMFIMLYVV  572
             TCCWFLTNNYLREE P+SHVVEQRVEW            LYAFDVHCNSFFPMF++LYV+
Sbjct  120   TCCWFLTNNYLREEVPNSHVVEQRVEWQVLTFPLSLLAVLYAFDVHCNSFFPMFVLLYVI  179

Query  571   HYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
             HYFLSP+L+ HGFIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVL
Sbjct  180   HYFLSPLLIAHGFIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVL  239

Query  391   SPIFILTGFNPSRYFMNIYFSR  326
             SPI IL GFNPSRY MN+YFS+
Sbjct  240   SPILILIGFNPSRYVMNMYFSQ  261



>ref|XP_002282581.2| PREDICTED: protein unc-50 homolog [Vitis vinifera]
 ref|XP_010647895.1| PREDICTED: protein unc-50 homolog [Vitis vinifera]
 ref|XP_010647896.1| PREDICTED: protein unc-50 homolog [Vitis vinifera]
Length=251

 Score =   451 bits (1160),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 233/250 (93%), Gaps = 1/250 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGR+ S++RPN +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRSPSNSRPNPMFLQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLL  +T AYCAAYDHS+ H VFVVISVLLFHFL+TG  L+
Sbjct  60    KQTKNQWARDDPAFVVICSLLLVVATSAYCAAYDHSSAHAVFVVISVLLFHFLITGIFLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP+LV HG
Sbjct  120   TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAHG  179

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM+A SYYHYLNFLGYDVLPFLERTTFFLYPIG VI+LSPIFIL+GFNPS
Sbjct  180   FIPVLLSNLLFMVATSYYHYLNFLGYDVLPFLERTTFFLYPIGCVIILSPIFILSGFNPS  239

Query  355   RYFMNIYFSR  326
             RY MN+YFS+
Sbjct  240   RYIMNMYFSQ  249



>ref|XP_011001154.1| PREDICTED: protein unc-50 homolog [Populus euphratica]
Length=247

 Score =   451 bits (1160),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 232/250 (93%), Gaps = 5/250 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S +GR SS    +S FP YLRRI+KWQQMD+EYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTS-RGRASS----SSTFPHYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVYQHTKYH  55

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLL  + LAYCAAYDHSAGH VFVVISVL FHFL++GA L+
Sbjct  56    KQTKNQWARDDPAFVVICSLLLVVAALAYCAAYDHSAGHAVFVVISVLFFHFLISGAGLA  115

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSP+LV HG
Sbjct  116   TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSPLLVAHG  175

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+ LSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPS
Sbjct  176   FIPVFLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPS  235

Query  355   RYFMNIYFSR  326
             RYFMN+YFS+
Sbjct  236   RYFMNVYFSQ  245



>emb|CBI40262.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   445 bits (1144),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 212/257 (82%), Positives = 233/257 (91%), Gaps = 8/257 (3%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGR+ S++RPN +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRSPSNSRPNPMFLQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLL  +T AYCAAYDHS+ H VFVVISVLLFHFL+TG  L+
Sbjct  60    KQTKNQWARDDPAFVVICSLLLVVATSAYCAAYDHSSAHAVFVVISVLLFHFLITGIFLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEW-------LYAFDVHCNSFFPMFIMLYVVHYFLS  557
             TCCWFLTN YLREEAP+SHVVEQRVEW       LYAFDVHCNSFFPMF++LYV+HYFLS
Sbjct  120   TCCWFLTNAYLREEAPNSHVVEQRVEWQDSSASVLYAFDVHCNSFFPMFVLLYVIHYFLS  179

Query  556   PILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
             P+LV HGFIP+LLSNLLFM+A SYYHYLNFLGYDVLPFLERTTFFLYPIG VI+LSPIFI
Sbjct  180   PLLVAHGFIPVLLSNLLFMVATSYYHYLNFLGYDVLPFLERTTFFLYPIGCVIILSPIFI  239

Query  376   LTGFNPSRYFMNIYFSR  326
             L+GFNPSRY MN+YFS+
Sbjct  240   LSGFNPSRYIMNMYFSQ  256



>ref|XP_010691673.1| PREDICTED: protein unc-50 homolog [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   444 bits (1143),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 234/252 (93%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPTSS    +S+  +PN VFP YLRRI+KWQQMD+EYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTSSKGRSSSTSRQPNPVFPHYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICS LLA STLAYCAAYDHS GH ++VV+SVLLFHF++TGAVL+
Sbjct  61    KQTKNQWARDDPAFIVICSFLLAVSTLAYCAAYDHSTGHAIYVVLSVLLFHFIITGAVLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTNNYLREEAP+S+VVEQRVEWLYAFDVHCNSFFPMF++LYVVHYFLSP+L+ HG
Sbjct  121   TCCWFLTNNYLREEAPNSYVVEQRVEWLYAFDVHCNSFFPMFVLLYVVHYFLSPLLLAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM+A SYYHYLNFLGYDVLPFLE+TTFFLYPIGIV++LSPIFIL GFNPS
Sbjct  181   FIPVLLSNLLFMVAVSYYHYLNFLGYDVLPFLEKTTFFLYPIGIVLILSPIFILGGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RY MN+YFS  L
Sbjct  241   RYVMNMYFSTRL  252



>ref|XP_010271205.1| PREDICTED: protein unc-50 homolog isoform X1 [Nelumbo nucifera]
Length=248

 Score =   444 bits (1142),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 207/249 (83%), Positives = 229/249 (92%), Gaps = 1/249 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGRT S+ R N VFPQYLRRIVKW+QMDIEYTFWQM HLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRTHSNVRQNPVFPQYLRRIVKWEQMDIEYTFWQMFHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLL  +T AYCAAYDHS  H +F VISVL+FHFLVTG VL+
Sbjct  60    KQTKNQWARDDPAFVVICSLLLVVATSAYCAAYDHSMAHAIFTVISVLIFHFLVTGVVLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREEAP+SHVVEQRVEWLYAFDVHCNSFFP+FIMLYV+HYFLSP+LV HG
Sbjct  120   TCCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPLFIMLYVIHYFLSPLLVAHG  179

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNL+FM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG+V ++SP+ IL+GFNP+
Sbjct  180   FIPLLLSNLVFMVAISYYHYLNFLGYDVLPFLDKTTFFLYPIGLVFIISPLLILSGFNPT  239

Query  355   RYFMNIYFS  329
             RY MNIYFS
Sbjct  240   RYVMNIYFS  248



>ref|XP_006379181.1| UNC-50 family protein [Populus trichocarpa]
 gb|ERP56978.1| UNC-50 family protein [Populus trichocarpa]
Length=254

 Score =   442 bits (1137),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 204/230 (89%), Positives = 221/230 (96%), Gaps = 0/230 (0%)
 Frame = -1

Query  1015  FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSL  836
             FPQYLRRI+KWQQMD+EYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+VICSL
Sbjct  23    FPQYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFVVICSL  82

Query  835   LLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHV  656
             LL  + LAYCAAYDHSAGH VFVVISVL FHFL++GA L+TCCWFLTN YLREEAP+SHV
Sbjct  83    LLVVAALAYCAAYDHSAGHAVFVVISVLFFHFLISGAGLATCCWFLTNAYLREEAPNSHV  142

Query  655   VEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHY  476
             VEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSP+LV HGFIP+LLSNLLFM+AASYYHY
Sbjct  143   VEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSPLLVAHGFIPVLLSNLLFMVAASYYHY  202

Query  475   LNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSR  326
             LNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPSRYFMN+YFS+
Sbjct  203   LNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPSRYFMNVYFSQ  252



>ref|XP_006487004.1| PREDICTED: protein unc-50 homolog [Citrus sinensis]
Length=253

 Score =   441 bits (1133),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  1030  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  851
             R N +FPQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+
Sbjct  17    RTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFV  76

Query  850   VICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEA  671
             VICSLLL+ +T+AYCAAYDHSA H +FVVISVLLFHFL+TGA+L+T CWFLTN+YLRE++
Sbjct  77    VICSLLLSVATIAYCAAYDHSATHAIFVVISVLLFHFLITGAMLATFCWFLTNSYLREDS  136

Query  670   PSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAA  491
             P+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSP+L+ HGFIP+LLSNLLFM AA
Sbjct  137   PNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSPLLMVHGFIPVLLSNLLFMAAA  196

Query  490   SYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
             SYYHYLNFLGYDVLPFLERTTFFLYPIG+ IVLSPI IL+GFNPSRYFMN+YFSR L
Sbjct  197   SYYHYLNFLGYDVLPFLERTTFFLYPIGVCIVLSPILILSGFNPSRYFMNMYFSRRL  253



>ref|XP_004136958.1| PREDICTED: protein unc-50 homolog [Cucumis sativus]
 gb|KGN43880.1| hypothetical protein Csa_7G071690 [Cucumis sativus]
Length=252

 Score =   439 bits (1128),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N ++ QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTASRGRSSSSTSRANPMYLQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLLA +TLAYCAAYDHSA H  FVVISVLLFH L+TGA+L+
Sbjct  61    KQTKNQWARDDPAFIVICSLLLAVATLAYCAAYDHSAAHASFVVISVLLFHLLITGAILA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCW LTN YLREE P SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYF+SP+LV HG
Sbjct  121   TCCWLLTNAYLREETPGSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFISPLLVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFMI ASYYHY+NFLGYDVLPFLE+TTFFLYPIG+V VL+PIFIL GFNPS
Sbjct  181   FIPLLLSNLLFMIGASYYHYVNFLGYDVLPFLEKTTFFLYPIGVVFVLTPIFILIGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQNL  252



>gb|KEH44101.1| UNC-50 family protein [Medicago truncatula]
Length=257

 Score =   438 bits (1127),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 212/258 (82%), Positives = 234/258 (91%), Gaps = 7/258 (3%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  914
             MLPT S KGR+SS +      RPNS    YLRRI+KWQQMD+EYTFWQMLHLCTSPKVVY
Sbjct  1     MLPTVS-KGRSSSSSSSSSSSRPNSTLLPYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVY  59

Query  913   QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLV  734
             QHTKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS+GH +FVV SVLLFHFL+
Sbjct  60    QHTKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSSGHALFVVFSVLLFHFLL  119

Query  733   TGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSP  554
             TG  L+T CWFLTN+YLREEAP+S+VVEQRVEW+YAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  120   TGIFLATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSP  179

Query  553   ILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFIL  374
             +LV HGFIP LLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL
Sbjct  180   LLVAHGFIPELLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILIL  239

Query  373   TGFNPSRYFMNIYFSRAL  320
             +GFNPSRYFMNIYFSR +
Sbjct  240   SGFNPSRYFMNIYFSRQI  257



>ref|XP_010530733.1| PREDICTED: protein unc-50 homolog [Tarenaya hassleriana]
Length=252

 Score =   438 bits (1127),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 209/252 (83%), Positives = 231/252 (92%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S     SS +R N +F QY RRIVKWQQMDIEYTFWQM HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSQSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMFHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICS+LLA +T+AYCAAYDHS  H +FVV SVLLFHFL+TGA+++
Sbjct  61    KQTKNQWARDDPAFVVICSMLLAVATIAYCAAYDHSFSHALFVVFSVLLFHFLITGAIIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF++LYVVHYFLSP+L+THG
Sbjct  121   TCCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVVHYFLSPLLITHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FI +LLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+ FNPS
Sbjct  181   FISVLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSSFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMNIYFS+ L
Sbjct  241   RYFMNIYFSQIL  252



>gb|KJB11965.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
 gb|KJB11967.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=252

 Score =   437 bits (1124),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 229/252 (91%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S    + S +RPN++FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PK+VYQHTKYH
Sbjct  1     MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKIVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
              QTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H V VVI+V LFHFL+ G +L+
Sbjct  61    NQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVSVVITVSLFHFLLAGILLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLR+EAP++ VVEQRVEWLYAFD+HCNSFFPMF+MLYV+HYFLSP+LV HG
Sbjct  121   TCCWFLTNAYLRKEAPNTCVVEQRVEWLYAFDLHCNSFFPMFVMLYVIHYFLSPLLVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FI  LLSNLLFM+AASY+HYLNFLGYDVLPFL+RTTFFLYPIGIVI+LSPI IL+GFNPS
Sbjct  181   FISALLSNLLFMVAASYHHYLNFLGYDVLPFLKRTTFFLYPIGIVIILSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMNIY SR L
Sbjct  241   RYFMNIYCSRTL  252



>gb|AFK46272.1| unknown [Medicago truncatula]
Length=257

 Score =   437 bits (1123),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 211/258 (82%), Positives = 234/258 (91%), Gaps = 7/258 (3%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  914
             MLPT S KGR+SS +      RPNS    YLRRI+KWQQMD+EYTFWQMLHLCTSPKVVY
Sbjct  1     MLPTVS-KGRSSSSSSSSSSSRPNSTLLPYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVY  59

Query  913   QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLV  734
             QHTKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS+GH +FVV SVLLFHFL+
Sbjct  60    QHTKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSSGHALFVVFSVLLFHFLL  119

Query  733   TGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSP  554
             TG  L+T CWFLTN+YLREEAP+S+VV+QRVEW+YAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  120   TGIFLATFCWFLTNSYLREEAPNSYVVKQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSP  179

Query  553   ILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFIL  374
             +LV HGFIP LLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL
Sbjct  180   LLVAHGFIPELLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILIL  239

Query  373   TGFNPSRYFMNIYFSRAL  320
             +GFNPSRYFMNIYFSR +
Sbjct  240   SGFNPSRYFMNIYFSRQI  257



>gb|AFK38140.1| unknown [Lotus japonicus]
Length=252

 Score =   436 bits (1122),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 205/253 (81%), Positives = 231/253 (91%), Gaps = 2/253 (1%)
 Frame = -1

Query  1075  MLPTSSLKGR-TSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPT+S KGR +SS +RPNS    YLR+I+KWQQMDIEYTFWQM HLCT+PKVVYQHTKY
Sbjct  1     MLPTAS-KGRASSSTSRPNSTLLPYLRKIIKWQQMDIEYTFWQMFHLCTAPKVVYQHTKY  59

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS  H VFVV SVLLFHFL+TG  L
Sbjct  60    HKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSIAHAVFVVFSVLLFHFLLTGVFL  119

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +T CWFLTN+YLREEAP+S+VVEQRVEW+YAFDVHCNSFFPMF++LYV+HYFLSP+LV H
Sbjct  120   ATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAH  179

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GFIP LLSN+L M+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNP
Sbjct  180   GFIPTLLSNILVMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNP  239

Query  358   SRYFMNIYFSRAL  320
             SRYF+++YFSR +
Sbjct  240   SRYFLSVYFSRQI  252



>ref|XP_006422929.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 ref|XP_006422930.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36169.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36170.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|KDO59817.1| hypothetical protein CISIN_1g025409mg [Citrus sinensis]
Length=253

 Score =   436 bits (1121),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 225/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  1030  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  851
             R N +FPQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+
Sbjct  17    RTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFV  76

Query  850   VICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEA  671
             VICSLLL+ +T+AYCAAYDHSA H +FVVISVLLFHFL+TGA+L+T CWFLTN+YLRE++
Sbjct  77    VICSLLLSVATIAYCAAYDHSATHAIFVVISVLLFHFLITGAMLATFCWFLTNSYLREDS  136

Query  670   PSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAA  491
             P+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSP+L+ HGFIP+LLSNLLFM AA
Sbjct  137   PNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSPLLMVHGFIPVLLSNLLFMAAA  196

Query  490   SYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
             SYYHYLNFLGYDVLPFLERTTFFLYPIG+ IVLSPI IL+GFNPSRYFMN+YFS  L
Sbjct  197   SYYHYLNFLGYDVLPFLERTTFFLYPIGVCIVLSPILILSGFNPSRYFMNMYFSWRL  253



>ref|XP_008356380.1| PREDICTED: protein unc-50 homolog [Malus domestica]
Length=254

 Score =   436 bits (1121),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/250 (84%), Positives = 231/250 (92%), Gaps = 0/250 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRGRSSSSASRMNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHSA H VFVVISVLLFHFL  G +L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSAAHAVFVVISVLLFHFLFLGMLLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSPILV HG
Sbjct  121   TFCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPILVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNL+FM+A SYYHYLNFLGYDVLPFLERTTFFLYPI +VIVLSPI IL+GFNPS
Sbjct  181   FIPVLLSNLIFMVATSYYHYLNFLGYDVLPFLERTTFFLYPISVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSR  326
             RYFMN+YFS+
Sbjct  241   RYFMNMYFSQ  250



>ref|XP_008454998.1| PREDICTED: protein unc-50 homolog [Cucumis melo]
Length=252

 Score =   434 bits (1115),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N ++ QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTASRGRSSSSTSRTNPMYLQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHSA H  FVVISVL+FH L+TGA+L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSAAHASFVVISVLIFHLLITGAILA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCW LTN YLREE P SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYF+SP+LV HG
Sbjct  121   TCCWLLTNAYLREETPGSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFISPLLVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFMI ASYYHY+NFLGYDVLPFLE+TTFFLYPIG+V VL+PIFIL GFNPS
Sbjct  181   FIPLLLSNLLFMIGASYYHYVNFLGYDVLPFLEKTTFFLYPIGVVFVLTPIFILIGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQNL  252



>emb|CDY63605.1| BnaCnng42360D [Brassica napus]
Length=252

 Score =   433 bits (1114),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 209/252 (83%), Positives = 229/252 (91%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMDIEYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLL  +TLAYCA YDHS  H V VVISV L HFL+TGA+++
Sbjct  61    KQTKNQWARDDPAFIVICSLLLILATLAYCATYDHSGSHAVVVVISVFLTHFLITGALIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREEAP+SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP L+THG
Sbjct  121   TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPFLITHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+GFNPS
Sbjct  181   FIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             +YFMN+YFS+ L
Sbjct  241   KYFMNMYFSQRL  252



>ref|XP_007201388.1| hypothetical protein PRUPE_ppa010309mg [Prunus persica]
 gb|EMJ02587.1| hypothetical protein PRUPE_ppa010309mg [Prunus persica]
Length=254

 Score =   432 bits (1111),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 209/250 (84%), Positives = 230/250 (92%), Gaps = 0/250 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRGRSSSSTSRTNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLF FL  G +L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATMAYCAAYDHSAAHAVFVVISVLLFQFLFIGMLLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREEAP+SHVVEQRVEW+YAFDVHCNSFFPMF+MLYV+HYFLSPILV HG
Sbjct  121   TFCWFLTNSYLREEAPNSHVVEQRVEWMYAFDVHCNSFFPMFVMLYVIHYFLSPILVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM+A SYYHYLNFLGYDVLPFLERTTFFLYPI +VIVLSPI IL+GFNPS
Sbjct  181   FIPVLLSNLLFMVAISYYHYLNFLGYDVLPFLERTTFFLYPISVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSR  326
             RYFMN+YFS+
Sbjct  241   RYFMNMYFSQ  250



>ref|XP_008236376.1| PREDICTED: protein unc-50 homolog [Prunus mume]
Length=254

 Score =   431 bits (1109),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 210/250 (84%), Positives = 230/250 (92%), Gaps = 0/250 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRGRSSSSTSRTNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL  G +L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATMAYCAAYDHSAAHAVFVVISVLLFHFLFIGMLLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREEAP+SHVVEQRVEW+YAFDVHCNSFFPMF+MLYV+HYFLSPILV HG
Sbjct  121   TFCWFLTNSYLREEAPNSHVVEQRVEWMYAFDVHCNSFFPMFVMLYVIHYFLSPILVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM A SYYHYLNFLGYDVLPFLERTTFFLYPI +VIVLSPI IL+GFNPS
Sbjct  181   FIPVLLSNLLFMGATSYYHYLNFLGYDVLPFLERTTFFLYPISVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSR  326
             RYFMN+YFS+
Sbjct  241   RYFMNMYFSQ  250



>ref|XP_004496941.1| PREDICTED: protein unc-50 homolog [Cicer arietinum]
Length=256

 Score =   431 bits (1109),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  1030  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  851
             RPNS    YLRRI+KWQQMD+EYTFWQM HLCTSPKVVYQHTKYHKQTKNQWARDDPAF+
Sbjct  20    RPNSTLLPYLRRIIKWQQMDVEYTFWQMFHLCTSPKVVYQHTKYHKQTKNQWARDDPAFV  79

Query  850   VICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEA  671
             VICSLLLA +TLAYCAAYDHS GH + VV SVL+FHFL+TG  L+T CWFLTN+YLREEA
Sbjct  80    VICSLLLAVATLAYCAAYDHSTGHALLVVFSVLVFHFLLTGIFLATFCWFLTNSYLREEA  139

Query  670   PSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAA  491
             P+S+VVEQRVEW+YAFDVHCNSFFPMF++LYV+HYFLSP+LV HGFIPLLLSNLLFM+ A
Sbjct  140   PNSYVVEQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAHGFIPLLLSNLLFMVGA  199

Query  490   SYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
             SYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPSRYFMN+YFSR +
Sbjct  200   SYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPSRYFMNVYFSRQI  256



>ref|XP_010547978.1| PREDICTED: protein unc-50 homolog isoform X1 [Tarenaya hassleriana]
Length=252

 Score =   431 bits (1108),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 225/252 (89%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYC AYDHS  H +FVV SVLL HF   GA ++
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATIAYCVAYDHSVSHALFVVFSVLLLHFFTIGATVA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFPMF++LYVVHYFLSP+L+THG
Sbjct  121   TCCWFLTNSYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVVHYFLSPLLITHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FI  LLSNLL M+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+GFNPS
Sbjct  181   FISALLSNLLLMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMNIYFSR L
Sbjct  241   RYFMNIYFSRIL  252



>ref|XP_011467754.1| PREDICTED: protein unc-50 homolog [Fragaria vesca subsp. vesca]
Length=253

 Score =   431 bits (1107),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 220/235 (94%), Gaps = 0/235 (0%)
 Frame = -1

Query  1024  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  845
             N +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+VI
Sbjct  19    NPLFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFVVI  78

Query  844   CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS  665
             CSLLL  +TLAYCAAYDHSA H VFVVISVLLFHFL  G +L+T CWFLTN+YLREEAP+
Sbjct  79    CSLLLTVATLAYCAAYDHSAAHAVFVVISVLLFHFLFIGMLLATFCWFLTNSYLREEAPN  138

Query  664   SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASY  485
             SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSP+LV HGF+P+LLSNLLFM+A+SY
Sbjct  139   SHVVEQRVEWLYAFDVHCNSFFPMFVMLYVLHYFLSPLLVAHGFVPVLLSNLLFMVASSY  198

Query  484   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
             YHYLNFLGYDVLPFLERTTFFLYPI IVIVLSPI IL+GFNPSRYFMN+YFS  L
Sbjct  199   YHYLNFLGYDVLPFLERTTFFLYPISIVIVLSPILILSGFNPSRYFMNMYFSHWL  253



>ref|XP_010057258.1| PREDICTED: protein unc-50 homolog [Eucalyptus grandis]
 gb|KCW74300.1| hypothetical protein EUGRSUZ_E02959 [Eucalyptus grandis]
Length=252

 Score =   430 bits (1105),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 231/252 (92%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N++F QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTASKGRSSSSASRSNNMFSQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI +LLL  +  AYCAAYDHS  H V+V+ISVLLFHFLVTGA+LS
Sbjct  61    KQTKNQWARDDPAFVVISTLLLVVAVSAYCAAYDHSIAHAVYVIISVLLFHFLVTGALLS  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP+LV HG
Sbjct  121   TFCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM+AA YYHYLNFLGYDVLPFLERTTFFLYPIG V+VL PIF+L+GFNPS
Sbjct  181   FIPVLLSNLLFMVAACYYHYLNFLGYDVLPFLERTTFFLYPIGAVLVLCPIFMLSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQRL  252



>gb|KHN42364.1| Protein unc-50 like [Glycine soja]
Length=259

 Score =   429 bits (1103),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 209/260 (80%), Positives = 233/260 (90%), Gaps = 9/260 (3%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA-------RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  920
             MLPT+S KGR+SS +       RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKV
Sbjct  1     MLPTAS-KGRSSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKV  59

Query  919   VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHF  740
             VYQHTKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS  HT+ V+ SVLLFHF
Sbjct  60    VYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSTAHTLLVIFSVLLFHF  119

Query  739   LVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFL  560
             L+TG  L+T CWFLTN YLREEAP+S+VVEQRVEW+YAFDVHCNSFFP F++LYV+HYFL
Sbjct  120   LLTGVFLATFCWFLTNGYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPFFVLLYVIHYFL  179

Query  559   SPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIF  380
             SP+LV HGFIP+LLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI 
Sbjct  180   SPLLVAHGFIPVLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIL  239

Query  379   ILTGFNPSRYFMNIYFSRAL  320
             IL+GFNPSRYFMN+YFSR +
Sbjct  240   ILSGFNPSRYFMNMYFSRQI  259



>emb|CDY48219.1| BnaA07g03880D [Brassica napus]
Length=254

 Score =   428 bits (1100),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 217/235 (92%), Gaps = 0/235 (0%)
 Frame = -1

Query  1024  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  845
             N +F QY RRIVKWQQMDIEYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  20    NPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  79

Query  844   CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS  665
             CSLLL  STLAYCA YDHS  H V VVISV L HFL+TG +++TCCWFLTN+YLREEAP+
Sbjct  80    CSLLLILSTLAYCATYDHSGSHAVVVVISVFLTHFLITGGLIATCCWFLTNSYLREEAPN  139

Query  664   SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASY  485
             SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP+L+THGFIPLLLSNLLFM+ ASY
Sbjct  140   SHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPLLITHGFIPLLLSNLLFMVGASY  199

Query  484   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
             YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+GFNPS YFMN+YFS+ L
Sbjct  200   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSGFNPSNYFMNMYFSQRL  254



>ref|XP_007143055.1| hypothetical protein PHAVU_007G039900g [Phaseolus vulgaris]
 gb|ESW15049.1| hypothetical protein PHAVU_007G039900g [Phaseolus vulgaris]
Length=255

 Score =   427 bits (1098),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/256 (80%), Positives = 234/256 (91%), Gaps = 5/256 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA---RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             MLPT+S KGR+SS +   RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQH
Sbjct  1     MLPTAS-KGRSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQH  59

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
             TKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS+ H + V+ SVL FHF++TG
Sbjct  60    TKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSSAHALLVIFSVLFFHFILTG  119

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPIL  548
               L+T CWFLTN+YLREEAP+S+VVEQRVEW+YAFDVHCNSFFP+F++LYV+HYF+SP+L
Sbjct  120   VFLATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPLFVLLYVIHYFVSPLL  179

Query  547   VTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTG  368
             V HGFIP+LLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+G
Sbjct  180   VAHGFIPVLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSG  239

Query  367   FNPSRYFMNIYFSRAL  320
             FNPSRYFMN+YFSR +
Sbjct  240   FNPSRYFMNMYFSRQI  255



>ref|NP_001235443.1| uncharacterized protein LOC100500001 [Glycine max]
 gb|ACU14557.1| unknown [Glycine max]
Length=255

 Score =   427 bits (1098),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 206/256 (80%), Positives = 233/256 (91%), Gaps = 5/256 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA---RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             MLPT+S KGR+SS +   RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQH
Sbjct  1     MLPTAS-KGRSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQH  59

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
             TKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS  HT+ V+ SVL FHF++TG
Sbjct  60    TKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSTAHTLLVIFSVLFFHFILTG  119

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPIL  548
               L+T CWFLTN+YLREEAP+S+VVEQRVEW+YAFDVHCNSFFP+F++LYV+HYFLSP+L
Sbjct  120   VFLATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPLFVLLYVIHYFLSPLL  179

Query  547   VTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTG  368
             V HGFIP+LLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+G
Sbjct  180   VAHGFIPVLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSG  239

Query  367   FNPSRYFMNIYFSRAL  320
             FNPS YFMN+YFSR +
Sbjct  240   FNPSSYFMNMYFSRQI  255



>gb|KJB47366.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=249

 Score =   426 bits (1096),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 200/231 (87%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1     MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+TG  L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVLLFHFLLTGVFLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYF+SP+LV HG
Sbjct  121   TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFVSPLLVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI  383
             FIP LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG++IVLSPI
Sbjct  181   FIPELLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVIIVLSPI  231



>ref|XP_003555962.1| PREDICTED: protein unc-50 homolog [Glycine max]
Length=258

 Score =   427 bits (1097),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 208/259 (80%), Positives = 232/259 (90%), Gaps = 8/259 (3%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA------RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  917
             MLPT+S KGR+SS +      RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKVV
Sbjct  1     MLPTAS-KGRSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKVV  59

Query  916   YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
             YQHTKYHKQTKNQWARDDPAF+VIC LLLA +TLAYCAAYDHS  HT+ V+ SVLLFHFL
Sbjct  60    YQHTKYHKQTKNQWARDDPAFVVICCLLLAVATLAYCAAYDHSTAHTLLVIFSVLLFHFL  119

Query  736   VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLS  557
             +TG  L+T CWFLTN YLREEAP+S+VVEQRVEW+YAFDVHCNSFFP F++LYV+HYFLS
Sbjct  120   LTGVFLATFCWFLTNGYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPFFVLLYVIHYFLS  179

Query  556   PILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
             P+LV HGFIP+LLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI I
Sbjct  180   PLLVAHGFIPVLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILI  239

Query  376   LTGFNPSRYFMNIYFSRAL  320
             L+GFNPSRYFMN+YFSR +
Sbjct  240   LSGFNPSRYFMNMYFSRQI  258



>ref|XP_009102331.1| PREDICTED: protein unc-50 homolog [Brassica rapa]
Length=254

 Score =   425 bits (1093),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 217/235 (92%), Gaps = 0/235 (0%)
 Frame = -1

Query  1024  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  845
             N +F QY RRIVKWQQMDIEYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  20    NPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  79

Query  844   CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS  665
             CSLLL  STLAYCA YDHS  H V +VISV L HFL+TG +++TCCWFLTN+YLREEAP+
Sbjct  80    CSLLLILSTLAYCATYDHSGSHAVVLVISVFLTHFLITGGLIATCCWFLTNSYLREEAPN  139

Query  664   SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASY  485
             SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP+L+THGFI LLLSNLLFM+ ASY
Sbjct  140   SHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPLLITHGFIALLLSNLLFMVGASY  199

Query  484   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
             YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+GFNPS+YFMN+YFS+ L
Sbjct  200   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSGFNPSKYFMNMYFSQRL  254



>ref|XP_009335832.1| PREDICTED: protein unc-50 homolog [Pyrus x bretschneideri]
Length=254

 Score =   424 bits (1091),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 205/250 (82%), Positives = 230/250 (92%), Gaps = 0/250 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +  QYLRRI+KWQQMD+EYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRGRSSSSSSRTNPMPIQYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICS+LLA +TLAYCAAYDHSA H VFVVISVLLFHFL  G +L+
Sbjct  61    KQTKNQWARDDPAFVVICSVLLAVATLAYCAAYDHSAAHAVFVVISVLLFHFLFIGMLLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSPILV HG
Sbjct  121   TFCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPILVAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F+P+LLSNL+FM+A SYYHYLNFLGYDVLPFLERTTFFLYPI +VIVLSPI IL+GF+PS
Sbjct  181   FLPVLLSNLIFMVATSYYHYLNFLGYDVLPFLERTTFFLYPISVVIVLSPILILSGFSPS  240

Query  355   RYFMNIYFSR  326
             RYFMN+YFS+
Sbjct  241   RYFMNMYFSQ  250



>ref|XP_010518032.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score =   423 bits (1088),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 232/252 (92%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPLFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLLA +T+AYCA YDHS  H V VV+SVLL HFL+TGAV++
Sbjct  61    KQTKNQWARDDPAFIVICSLLLAVATVAYCATYDHSGSHAVVVVVSVLLSHFLITGAVIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREEAP+SHVVEQRVEWLY FDVHCNSFFPMF++LYV+HYFLSP+L+THG
Sbjct  121   TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVIHYFLSPLLITHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPS
Sbjct  181   FIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQRL  252



>ref|XP_010467286.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score =   423 bits (1088),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 232/252 (92%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLLA +T+AYCA YDHS  H V VV+SVLL HFL+TGAV++
Sbjct  61    KQTKNQWARDDPAFIVICSLLLAVATVAYCATYDHSGSHAVVVVVSVLLSHFLITGAVIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREEAP+SHVVEQRVEWLY FDVHCNSFFPMF++LYV+HYFLSP+L+THG
Sbjct  121   TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVIHYFLSPLLITHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPS
Sbjct  181   FIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQRL  252



>ref|XP_010488944.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score =   422 bits (1085),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 232/252 (92%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLLA +T+AYCA YDHS  H V VV+SVLL HFL+TGAV++
Sbjct  61    KQTKNQWARDDPAFIVICSLLLAVATVAYCATYDHSGSHAVVVVVSVLLSHFLITGAVIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREEAP+SHVVEQRVEWLY FDVHCNSFFPMF++LYV+HYFLSP+L+THG
Sbjct  121   TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVIHYFLSPLLITHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPS
Sbjct  181   FIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ +
Sbjct  241   RYFMNMYFSQRI  252



>ref|XP_006409583.1| hypothetical protein EUTSA_v10022824mg [Eutrema salsugineum]
 gb|ESQ51036.1| hypothetical protein EUTSA_v10022824mg [Eutrema salsugineum]
Length=252

 Score =   422 bits (1085),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 209/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLL  +TLAYCA YDHS  H VFVV+SV L HF +TGAV++
Sbjct  61    KQTKNQWARDDPAFIVICSLLLVVATLAYCATYDHSGSHAVFVVVSVFLSHFFITGAVIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREEAP+SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP+L+THG
Sbjct  121   TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPLLITHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+GFNPS
Sbjct  181   FIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQRL  252



>ref|XP_002885951.1| hypothetical protein ARALYDRAFT_899735 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62210.1| hypothetical protein ARALYDRAFT_899735 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   422 bits (1084),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 229/252 (91%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLL  +T+AYC  YDHS  H V VV+SVLL HFL+TGAV++
Sbjct  61    KQTKNQWARDDPAFIVICSLLLVVATVAYCVTYDHSGSHAVVVVVSVLLTHFLITGAVIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREE P+SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP+L+THG
Sbjct  121   TCCWFLTNSYLREETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPLLITHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPS
Sbjct  181   FIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQRL  252



>ref|XP_010928386.1| PREDICTED: protein unc-50 homolog isoform X1 [Elaeis guineensis]
Length=248

 Score =   420 bits (1080),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 195/249 (78%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGRT +  RP+ +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDP F+VI  L L  +T AYCAAY  S  H V  V+SV++FHFL+ G +L+
Sbjct  60    KQTKNQWARDDPGFVVILCLFLVVATSAYCAAYGESLAHAVSTVVSVVIFHFLIAGIILA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFP FIMLYV+ YF+SPILV HG
Sbjct  120   TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPTFIMLYVIQYFVSPILVAHG  179

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P+LLSNLLFM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG+VI+LSP+ IL+GFNP+
Sbjct  180   FFPVLLSNLLFMVAMSYYHYLNFLGYDVLPFLDKTTFFLYPIGLVIILSPLMILSGFNPT  239

Query  355   RYFMNIYFS  329
             RY MN+YFS
Sbjct  240   RYIMNLYFS  248



>emb|CDY52420.1| BnaCnng22410D [Brassica napus]
Length=252

 Score =   418 bits (1075),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = -1

Query  1024  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  845
             N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  18    NPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  77

Query  844   CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS  665
             CSLLL  +TLAYCA YDHS  H V VV+SV L HFL+TGAV++TCCWFLTN+YLREEAP+
Sbjct  78    CSLLLIVATLAYCATYDHSGSHAVVVVVSVFLTHFLITGAVIATCCWFLTNSYLREEAPN  137

Query  664   SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASY  485
             SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP+L+THGFI LLLSNLLFM+ ASY
Sbjct  138   SHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPLLITHGFIALLLSNLLFMVGASY  197

Query  484   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
             YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+GFNPSRYFMN+YFS+ L
Sbjct  198   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSGFNPSRYFMNMYFSQTL  252



>ref|XP_009123230.1| PREDICTED: protein unc-50 homolog [Brassica rapa]
 emb|CDY54469.1| BnaA09g52730D [Brassica napus]
Length=252

 Score =   418 bits (1074),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = -1

Query  1024  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  845
             N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  18    NPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  77

Query  844   CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS  665
             CSLLL  +TLAYCA YDHS  H V VV+SV L HFL+TGAV++TCCWFLTN+YLREEAP+
Sbjct  78    CSLLLIVATLAYCATYDHSGSHAVVVVVSVFLTHFLITGAVIATCCWFLTNSYLREEAPN  137

Query  664   SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASY  485
             SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP+L+THGFI LLLSNLLFM+ ASY
Sbjct  138   SHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPLLITHGFIALLLSNLLFMVGASY  197

Query  484   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
             YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+GFNPSRYFMN+YFS+ L
Sbjct  198   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSGFNPSRYFMNMYFSQRL  252



>ref|XP_006844040.1| PREDICTED: protein unc-50 homolog [Amborella trichopoda]
 gb|ERN05715.1| hypothetical protein AMTR_s00006p00238670 [Amborella trichopoda]
Length=248

 Score =   417 bits (1073),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S +GR  S  R NS+FP YLRR++KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTAS-RGRPPSTMRANSIFPHYLRRVIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVI SLLL  +T AYCAAYD +  H +F VISV+LFHF++ GA+L+
Sbjct  60    KQTKNQWARDDPAFIVILSLLLIVATSAYCAAYDKTITHAIFTVISVVLFHFIIIGAILA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLREE P+SH VEQRVEWLYAFDVHCNSFFP+F+ LYV+HYF+SP+LV HG
Sbjct  120   TCCWFLTNTYLREETPNSHAVEQRVEWLYAFDVHCNSFFPVFVALYVIHYFISPLLVAHG  179

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
              +P LLSNLLFM+AASYYHYLNFLGYDVLPFLE+TTFFLYPIG+VI+LS + +L+GFNP+
Sbjct  180   ILPALLSNLLFMVAASYYHYLNFLGYDVLPFLEKTTFFLYPIGVVIILSALLVLSGFNPT  239

Query  355   RYFMNIYFS  329
             RY ++ YF 
Sbjct  240   RYILSFYFG  248



>ref|XP_002298750.2| hypothetical protein POPTR_0001s30740g [Populus trichocarpa]
 gb|EEE83555.2| hypothetical protein POPTR_0001s30740g [Populus trichocarpa]
Length=254

 Score =   417 bits (1071),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 232/253 (92%), Gaps = 4/253 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNS---VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  905
             MLPT+S KGR SS +        FPQYLRRI+KWQQMDIEYTFWQML+LCTSPKVVYQHT
Sbjct  1     MLPTTS-KGRASSSSTSRVNSSTFPQYLRRIIKWQQMDIEYTFWQMLYLCTSPKVVYQHT  59

Query  904   KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGA  725
             K+HKQTKNQWARDDPAF+VI SLLLA + LAYCAAYDHSAGH VFVVISVLLFHFL+TGA
Sbjct  60    KFHKQTKNQWARDDPAFVVISSLLLAVAALAYCAAYDHSAGHAVFVVISVLLFHFLITGA  119

Query  724   VLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILV  545
              L+TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSPILV
Sbjct  120   GLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSPILV  179

Query  544   THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGF  365
              HGFIP+LLSNLLFM+AASYYHYLNFLGY VLPFLERTTFFLYPIG+VIVLSPI IL+GF
Sbjct  180   AHGFIPVLLSNLLFMVAASYYHYLNFLGYYVLPFLERTTFFLYPIGLVIVLSPILILSGF  239

Query  364   NPSRYFMNIYFSR  326
             NPSRY MN+YFS+
Sbjct  240   NPSRYLMNVYFSQ  252



>ref|XP_007042529.1| UNC-50 family protein isoform 2, partial [Theobroma cacao]
 gb|EOX98360.1| UNC-50 family protein isoform 2, partial [Theobroma cacao]
Length=231

 Score =   415 bits (1066),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/242 (82%), Positives = 213/242 (88%), Gaps = 11/242 (5%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S    +SS +RPN +FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1     MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+ G  L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVFVVISVLLFHFLLAGVFLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCW LTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLY            HG
Sbjct  121   TCCWSLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLY-----------AHG  169

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL GFNPS
Sbjct  170   FIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILGGFNPS  229

Query  355   RY  350
             RY
Sbjct  230   RY  231



>ref|XP_011030395.1| PREDICTED: protein unc-50 homolog [Populus euphratica]
Length=254

 Score =   413 bits (1061),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 211/253 (83%), Positives = 231/253 (91%), Gaps = 4/253 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNS---VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  905
             MLPT+S KGR SS +        FPQYLRRI+KWQQMDIEYTFWQML+LCTSPKVVYQHT
Sbjct  1     MLPTTS-KGRASSSSTSRVNSSTFPQYLRRIIKWQQMDIEYTFWQMLYLCTSPKVVYQHT  59

Query  904   KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGA  725
             K+HKQTKNQWARDDPAF+VI SLLLA + LAYCAAYDHSAGH VFVVI VLLFHFL+TGA
Sbjct  60    KFHKQTKNQWARDDPAFVVISSLLLAVAALAYCAAYDHSAGHAVFVVIYVLLFHFLITGA  119

Query  724   VLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILV  545
              L+TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSP+LV
Sbjct  120   GLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSPLLV  179

Query  544   THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGF  365
              HGFIP+LLSNLLFM+AASYYHYLNFLGY VLPFLERTTFFLYPIG++IVLSPI IL+GF
Sbjct  180   AHGFIPVLLSNLLFMVAASYYHYLNFLGYYVLPFLERTTFFLYPIGLIIVLSPILILSGF  239

Query  364   NPSRYFMNIYFSR  326
             NPSRY MN+YFS+
Sbjct  240   NPSRYLMNVYFSQ  252



>gb|AAM61449.1| unknown [Arabidopsis thaliana]
Length=252

 Score =   410 bits (1055),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 229/252 (91%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLL  +T+AYC  YDHS+ H V VV+SVLL HFL+TGAV++
Sbjct  61    KQTKNQWARDDPAFIVICSLLLVVATVAYCVTYDHSSSHAVVVVVSVLLTHFLITGAVIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREE P+SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP+L+ HG
Sbjct  121   TCCWFLTNSYLREETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPLLIAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPS
Sbjct  181   FIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQRL  252



>ref|NP_565370.1| UNC-50 family protein [Arabidopsis thaliana]
 gb|AAK55675.1|AF378872_1 At2g15240/F15A23.2 [Arabidopsis thaliana]
 gb|AAK96450.1| At2g15240/F15A23.2 [Arabidopsis thaliana]
 gb|AAD25568.2| expressed protein [Arabidopsis thaliana]
 gb|AEC06378.1| UNC-50 family protein [Arabidopsis thaliana]
Length=252

 Score =   409 bits (1050),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 228/252 (90%), Gaps = 0/252 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVICSLLL  +T+AYC  YDHS+ H V VV+SVL  HFL+TGAV++
Sbjct  61    KQTKNQWARDDPAFIVICSLLLVVATVAYCVTYDHSSSHAVVVVVSVLFTHFLITGAVIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN+YLREE P+SHVVEQRVEWLY FDVHCNSFFPMF++LYVVHYFLSP+L+ HG
Sbjct  121   TCCWFLTNSYLREETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSPLLIAHG  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPS
Sbjct  181   FIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPS  240

Query  355   RYFMNIYFSRAL  320
             RYFMN+YFS+ L
Sbjct  241   RYFMNMYFSQRL  252



>ref|XP_006296617.1| hypothetical protein CARUB_v10014338mg, partial [Capsella rubella]
 gb|EOA29515.1| hypothetical protein CARUB_v10014338mg, partial [Capsella rubella]
Length=282

 Score =   409 bits (1052),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 207/253 (82%), Positives = 232/253 (92%), Gaps = 0/253 (0%)
 Frame = -1

Query  1078  NMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
              MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKY
Sbjct  30    KMLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKY  89

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAFIVIC LLLA +T+AYCA YDHS+ H V VV+SVLL HFL+TGA++
Sbjct  90    HKQTKNQWARDDPAFIVICILLLAVATVAYCATYDHSSSHAVVVVVSVLLSHFLITGAII  149

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +TCCWFLTN+YLREEAP+SHVVEQRVEWLY FDVHCNSFFPMF++LYV+HYFLSPIL+TH
Sbjct  150   ATCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVIHYFLSPILITH  209

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GFIPLLLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNP
Sbjct  210   GFIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNP  269

Query  358   SRYFMNIYFSRAL  320
             SRYFMN+YFS+ L
Sbjct  270   SRYFMNMYFSQRL  282



>ref|XP_009396396.1| PREDICTED: protein unc-50 homolog [Musa acuminata subsp. malaccensis]
Length=248

 Score =   402 bits (1032),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 187/249 (75%), Positives = 213/249 (86%), Gaps = 1/249 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGR +S  RP   F QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRGTSAVRPAPGFSQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF VI  L L  +T AYCAAY  +  H+VF V+SV+ FHFL+ G +L+
Sbjct  60    KQTKNQWARDDPAFAVIFCLFLIVATSAYCAAYGVTWVHSVFTVVSVVAFHFLLAGTILA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN Y+REE PSSH VEQRVEWLYAFDVHCNSFFP F++LYV+ YF+SP+LV HG
Sbjct  120   TCCWFLTNTYMREETPSSHAVEQRVEWLYAFDVHCNSFFPAFVLLYVIQYFVSPLLVAHG  179

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P+L+SNLLFM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG+VI+LSP+ IL+GFNP+
Sbjct  180   FFPMLVSNLLFMVAISYYHYLNFLGYDVLPFLDKTTFFLYPIGLVIILSPLMILSGFNPT  239

Query  355   RYFMNIYFS  329
             RY M +YF 
Sbjct  240   RYMMRLYFG  248



>ref|XP_008799595.1| PREDICTED: protein unc-50 homolog isoform X2 [Phoenix dactylifera]
Length=248

 Score =   399 bits (1026),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGRT +  R + +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRTPAAVRTSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAAY  S  H V  V+SV++FHFL+ G +L+
Sbjct  60    KQTKNQWARDDPAFVVILCLFLVVATSAYCAAYGESLAHAVSAVVSVVVFHFLIAGIILA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMFIMLYV+ YF+SPILV HG
Sbjct  120   TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVIQYFVSPILVAHG  179

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P+LLSNLLFM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG+VI+LSP+ IL+GFNP+
Sbjct  180   FFPVLLSNLLFMVAISYYHYLNFLGYDVLPFLDKTTFFLYPIGLVIILSPLMILSGFNPT  239

Query  355   RYFMNIYFS  329
             RY MN+YFS
Sbjct  240   RYIMNLYFS  248



>gb|KHG13402.1| Protein unc-50 [Gossypium arboreum]
Length=241

 Score =   393 bits (1010),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 194/264 (73%), Positives = 213/264 (81%), Gaps = 35/264 (13%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV-------  917
             MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVV       
Sbjct  1     MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVSVVHMNY  60

Query  916   -----YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVL  752
                  YQHTKYHKQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVL
Sbjct  61    HGGCSYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVL  120

Query  751   LFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVV  572
             LFHFL+TG  L+TCCW                       LYAFDVHCNSFFPMF+MLYV+
Sbjct  121   LFHFLLTGVFLATCCW-----------------------LYAFDVHCNSFFPMFVMLYVI  157

Query  571   HYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
             HYF+SP+LV HGFIP LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG++IVL
Sbjct  158   HYFVSPLLVAHGFIPELLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVIIVL  217

Query  391   SPIFILTGFNPSRYFMNIYFSRAL  320
             SPI IL+GFNPSRYFMN+YFS+ +
Sbjct  218   SPILILSGFNPSRYFMNMYFSQRI  241



>ref|XP_004956281.1| PREDICTED: protein unc-50 homolog [Setaria italica]
Length=247

 Score =   390 bits (1002),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 212/249 (85%), Gaps = 2/249 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR ++ + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRGAARSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIVI  L L  +T AYCAAY  SA H    + SV+ FHFL  G VL+
Sbjct  60    KQTKNQWARDDPAFIVILILFLMFATSAYCAAYGESASHAALTITSVVFFHFLFAGIVLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP+LV HG
Sbjct  120   TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSPLLVAHG  178

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P LLSNLLF++A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ IL GFNP+
Sbjct  179   FFPALLSNLLFVVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMILIGFNPT  238

Query  355   RYFMNIYFS  329
             RYF+++YF 
Sbjct  239   RYFLSLYFG  247



>ref|XP_008651375.1| PREDICTED: uncharacterized protein LOC100280372 isoform X1 [Zea 
mays]
 gb|ACG33123.1| unc-50 [Zea mays]
 gb|ACR34211.1| unknown [Zea mays]
 tpg|DAA60645.1| TPA: Unc-50 [Zea mays]
Length=247

 Score =   390 bits (1002),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 211/249 (85%), Gaps = 2/249 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR +S + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+  HFL  G VL+
Sbjct  60    KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVFLHFLFAGIVLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFP F++LYVV YFLSP+LV HG
Sbjct  120   TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVVQYFLSPLLVAHG  178

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P LLSNLLF++A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ IL GFNP+
Sbjct  179   FFPALLSNLLFVVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMILIGFNPT  238

Query  355   RYFMNIYFS  329
             RYF+++YF 
Sbjct  239   RYFLSLYFG  247



>ref|XP_006660415.1| PREDICTED: protein unc-50 homolog [Oryza brachyantha]
Length=247

 Score =   390 bits (1001),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 212/249 (85%), Gaps = 2/249 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR ++ + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRAATRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+L HFL  G VL+
Sbjct  60    KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVLVHFLFAGIVLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP+LV HG
Sbjct  120   TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSPLLVAHG  178

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P LLSNLLF++A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ IL GFNP+
Sbjct  179   FFPALLSNLLFVVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMILIGFNPT  238

Query  355   RYFMNIYFS  329
             RYF+++YF 
Sbjct  239   RYFLSLYFG  247



>ref|XP_003576742.1| PREDICTED: protein unc-50 homolog [Brachypodium distachyon]
Length=247

 Score =   389 bits (1000),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 212/249 (85%), Gaps = 2/249 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR ++ + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRGAARSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAA+  SA H    + SV+  HFL  G VL+
Sbjct  60    KQTKNQWARDDPAFVVILILFLVFATSAYCAAFGESASHAALTITSVVFIHFLFAGLVLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP+L+ HG
Sbjct  120   TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSPLLIAHG  178

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P LLSNLLFM+A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ IL GFNP+
Sbjct  179   FFPALLSNLLFMVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMILIGFNPT  238

Query  355   RYFMNIYFS  329
             RYF+++YFS
Sbjct  239   RYFLSLYFS  247



>ref|XP_002462031.1| hypothetical protein SORBIDRAFT_02g013040 [Sorghum bicolor]
 gb|EER98552.1| hypothetical protein SORBIDRAFT_02g013040 [Sorghum bicolor]
Length=247

 Score =   387 bits (995),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 211/249 (85%), Gaps = 2/249 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR ++ + P  + P YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRGAARSAPPLLGP-YLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+  HFL  G VL+
Sbjct  60    KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVFLHFLFAGIVLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP+LV HG
Sbjct  120   TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSPLLVAHG  178

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P LLSNLLF++A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ IL GFNP+
Sbjct  179   FFPALLSNLLFVVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMILIGFNPT  238

Query  355   RYFMNIYFS  329
             RYF+++YF 
Sbjct  239   RYFLSLYFG  247



>ref|NP_001062566.1| Os09g0109500 [Oryza sativa Japonica Group]
 dbj|BAD17579.1| putative UNC50 [Oryza sativa Japonica Group]
 dbj|BAF24480.1| Os09g0109500 [Oryza sativa Japonica Group]
 dbj|BAG90439.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84080.1| hypothetical protein OsI_30369 [Oryza sativa Indica Group]
Length=247

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 211/248 (85%), Gaps = 2/248 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR ++ + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRGAARSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAAY  S  H    + SV+L HFL  G VL+
Sbjct  60    KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESPSHAALTITSVVLVHFLFAGIVLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CWFLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP+LV HG
Sbjct  120   TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSPLLVAHG  178

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P LLSNLLF++A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ IL GFNP+
Sbjct  179   FFPALLSNLLFVVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMILIGFNPT  238

Query  355   RYFMNIYF  332
             RYF+++YF
Sbjct  239   RYFLSLYF  246



>gb|KJB11966.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=224

 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/252 (72%), Positives = 204/252 (81%), Gaps = 28/252 (11%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S    + S +RPN++FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PK+VYQHTKYH
Sbjct  1     MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKIVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
              QTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H V VVI+V LFHFL+ G +L+
Sbjct  61    NQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVSVVITVSLFHFLLAGILLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCCWFLTN YLR+EAP++ VVEQRVEWLYAFD+HCNSFFPMF+MLY              
Sbjct  121   TCCWFLTNAYLRKEAPNTCVVEQRVEWLYAFDLHCNSFFPMFVMLY--------------  166

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
                           ASY+HYLNFLGYDVLPFL+RTTFFLYPIGIVI+LSPI IL+GFNPS
Sbjct  167   --------------ASYHHYLNFLGYDVLPFLKRTTFFLYPIGIVIILSPILILSGFNPS  212

Query  355   RYFMNIYFSRAL  320
             RYFMNIY SR L
Sbjct  213   RYFMNIYCSRTL  224



>gb|KHN06766.1| Protein unc-50 like [Glycine soja]
Length=210

 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  949  MLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVF  770
            MLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS  HT+ 
Sbjct  1    MLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSTAHTLL  60

Query  769  VVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMF  590
            V+ SVL FHF++TG  L+T CWFLTN+YLREEAP+S+VVEQRVEW+YAFDVHCNSFFP+F
Sbjct  61   VIFSVLFFHFILTGVFLATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPLF  120

Query  589  IMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPI  410
            ++LYV+HYFLSP+LV HGFIP+LLSNLLFM+ ASYYHYLNFLGYDVLPFLERTTFFLYPI
Sbjct  121  VLLYVIHYFLSPLLVAHGFIPVLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPI  180

Query  409  GIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
            GIVIVLSPI IL+GFNPS YFMN+YFSR +
Sbjct  181  GIVIVLSPILILSGFNPSSYFMNMYFSRQI  210



>gb|ACN35099.1| unknown [Zea mays]
 tpg|DAA60644.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=254

 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/256 (72%), Positives = 210/256 (82%), Gaps = 9/256 (4%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR +S + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+  HFL  G VL+
Sbjct  60    KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVFLHFLFAGIVLA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVE-------WLYAFDVHCNSFFPMFIMLYVVHYFLS  557
             T CWFLTN+YLREE P+SHVVEQRVE        LYAFDVHCNSFFP F++LYVV YFLS
Sbjct  120   TLCWFLTNSYLREE-PNSHVVEQRVECAHEILGRLYAFDVHCNSFFPAFVILYVVQYFLS  178

Query  556   PILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
             P+LV HGF P LLSNLLF++A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ I
Sbjct  179   PLLVAHGFFPALLSNLLFVVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMI  238

Query  376   LTGFNPSRYFMNIYFS  329
             L GFNP+RYF+++YF 
Sbjct  239   LIGFNPTRYFLSLYFG  254



>ref|XP_010271213.1| PREDICTED: protein unc-50 homolog isoform X2 [Nelumbo nucifera]
Length=216

 Score =   375 bits (962),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 202/249 (81%), Gaps = 33/249 (13%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGRT S+ R N VFPQYLRRIVKW+QMDIEYTFWQM HLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRTHSNVRQNPVFPQYLRRIVKWEQMDIEYTFWQMFHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLL  +T AYCAA                            
Sbjct  60    KQTKNQWARDDPAFVVICSLLLVVATSAYCAA----------------------------  91

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
                 FLTN+YLREEAP+SHVVEQRVEWLYAFDVHCNSFFP+FIMLYV+HYFLSP+LV HG
Sbjct  92    ----FLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPLFIMLYVIHYFLSPLLVAHG  147

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FIPLLLSNL+FM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG+V ++SP+ IL+GFNP+
Sbjct  148   FIPLLLSNLVFMVAISYYHYLNFLGYDVLPFLDKTTFFLYPIGLVFIISPLLILSGFNPT  207

Query  355   RYFMNIYFS  329
             RY MNIYFS
Sbjct  208   RYVMNIYFS  216



>gb|ABK21352.1| unknown [Picea sitchensis]
Length=249

 Score =   375 bits (964),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 185/250 (74%), Positives = 211/250 (84%), Gaps = 2/250 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S +GR  S  R + VFPQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-RGRPPSTFRHSPVFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICS LLA +  AYCAAYD S  H  F V+SV+L HFL+ G  L+
Sbjct  60    KQTKNQWARDDPAFVVICSFLLAVAASAYCAAYDVSVAHAGFTVLSVVLVHFLLIGTFLA  119

Query  715   TCCWFLTNNYLREEAPS-SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             TCCWFLTNNYLREE  S SHVVEQ VEWLYAFDVHCNSFFP+F+ LYV+ YF+SP+LV  
Sbjct  120   TCCWFLTNNYLREETSSNSHVVEQHVEWLYAFDVHCNSFFPLFVALYVIQYFVSPLLVAQ  179

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GF+P+LLSNLLFM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG +I+L P  +L GFNP
Sbjct  180   GFVPVLLSNLLFMVAFSYYHYLNFLGYDVLPFLDKTTFFLYPIGFIIILIPFLVLAGFNP  239

Query  358   SRYFMNIYFS  329
             +RY ++ Y+ 
Sbjct  240   TRYVLSFYYG  249



>ref|XP_010547979.1| PREDICTED: protein unc-50 homolog isoform X2 [Tarenaya hassleriana]
Length=229

 Score =   374 bits (959),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 203/252 (81%), Gaps = 23/252 (9%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +F QY RRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYC AYDHS  H +FVV SVLL HF   GA ++
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATIAYCVAYDHSVSHALFVVFSVLLLHFFTIGATVA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCC                       WLYAFDVHCNSFFPMF++LYVVHYFLSP+L+THG
Sbjct  121   TCC-----------------------WLYAFDVHCNSFFPMFVLLYVVHYFLSPLLITHG  157

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             FI  LLSNLL M+ ASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI IL+GFNPS
Sbjct  158   FISALLSNLLLMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPILILSGFNPS  217

Query  355   RYFMNIYFSRAL  320
             RYFMNIYFSR L
Sbjct  218   RYFMNIYFSRIL  229



>gb|EPS67574.1| hypothetical protein M569_07201, partial [Genlisea aurea]
Length=235

 Score =   373 bits (958),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 205/238 (86%), Gaps = 10/238 (4%)
 Frame = -1

Query  1075  MLPTSS-------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  917
             MLPTSS       LKGR    AR +  FP YLRRIVKW+QMDIEYTFWQMLHLCTSPKVV
Sbjct  1     MLPTSSSSSSSSSLKGRP---ARRSHFFPLYLRRIVKWRQMDIEYTFWQMLHLCTSPKVV  57

Query  916   YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
             YQHTKYHKQTKNQWARDDPAF+VI +LLL+ +TLAYCAAYDH++GH VF+V SV++FHFL
Sbjct  58    YQHTKYHKQTKNQWARDDPAFVVIFTLLLSATTLAYCAAYDHNSGHAVFLVFSVVIFHFL  117

Query  736   VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLS  557
               GA+++T CW  TNNYLR EA +SHVVEQRVEWLYAFDVHCNSFFP+F++LYV+HY +S
Sbjct  118   AAGAIIATFCWLFTNNYLRVEAVNSHVVEQRVEWLYAFDVHCNSFFPVFVLLYVIHYLVS  177

Query  556   PILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI  383
             P+L+ HGF+P+LLSNLLFM AA YYHYLNFLGYDVLPFLERTT FLYPIGIV VL PI
Sbjct  178   PLLLAHGFVPVLLSNLLFMAAAVYYHYLNFLGYDVLPFLERTTLFLYPIGIVFVLFPI  235



>ref|XP_001773436.1| predicted protein [Physcomitrella patens]
 gb|EDQ61809.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   374 bits (960),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 209/251 (83%), Gaps = 3/251 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA-RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPT + +GR SS   R NSV PQYLRRIVK+QQMD+EYTFWQM HLCTSPKVVYQ TKY
Sbjct  1     MLPTVN-RGRASSGGYRNNSVLPQYLRRIVKYQQMDMEYTFWQMRHLCTSPKVVYQQTKY  59

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF VIC +LLA +  ++CAAY HS    +F V SV++ HFL+ G  L
Sbjct  60    HKQTKNQWARDDPAFTVICGILLAVAVSSFCAAYGHSVAQAIFTVASVVILHFLLAGISL  119

Query  718   STCCWFLTNNYLREE-APSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVT  542
             +T CWFL+N+YLREE A  +HVVEQRVEWLYAFDVHCNS+FP+F++LYV+ YFLSP+L+ 
Sbjct  120   ATICWFLSNHYLREEIAAHTHVVEQRVEWLYAFDVHCNSYFPLFVILYVLQYFLSPLLLA  179

Query  541   HGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
             HGF+P LLSN+L+ +A SYYHYLNFLGYDVLPFLERT FFLYPIGI+++L P+ +L GFN
Sbjct  180   HGFVPTLLSNMLYFVALSYYHYLNFLGYDVLPFLERTIFFLYPIGILVILFPLSLLAGFN  239

Query  361   PSRYFMNIYFS  329
             P R+ MN+YF 
Sbjct  240   PCRFAMNLYFE  250



>gb|KJB47365.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=257

 Score =   372 bits (954),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 192/219 (88%), Gaps = 12/219 (5%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV-------  917
             MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVV       
Sbjct  1     MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVSIVHMNY  60

Query  916   -----YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVL  752
                  YQHTKYHKQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVL
Sbjct  61    YGGCSYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVL  120

Query  751   LFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVV  572
             LFHFL+TG  L+TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+
Sbjct  121   LFHFLLTGVFLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVI  180

Query  571   HYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYD  455
             HYF+SP+LV HGFIP LLSNLLFM+AASYYHYLNFLGYD
Sbjct  181   HYFVSPLLVAHGFIPELLSNLLFMVAASYYHYLNFLGYD  219



>gb|KJB47363.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=207

 Score =   366 bits (940),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  916  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
            YQHTKYHKQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL
Sbjct  9    YQHTKYHKQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVLLFHFL  68

Query  736  VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLS  557
            +TG  L+TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYF+S
Sbjct  69   LTGVFLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFVS  128

Query  556  PILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
            P+LV HGFIP LLSNLLFM+AASYYHYLNFLGYDVLPFLERTTFFLYPIG++IVLSPI I
Sbjct  129  PLLVAHGFIPELLSNLLFMVAASYYHYLNFLGYDVLPFLERTTFFLYPIGVIIVLSPILI  188

Query  376  LTGFNPSRYFMNIYFSR  326
            L+GFNPSRY MN+YFS+
Sbjct  189  LSGFNPSRYVMNMYFSQ  205



>ref|XP_010928388.1| PREDICTED: protein unc-50 homolog isoform X3 [Elaeis guineensis]
Length=216

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 196/249 (79%), Gaps = 33/249 (13%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGRT +  RP+ +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDP F+VI  L L  +T AYCAA                            
Sbjct  60    KQTKNQWARDDPGFVVILCLFLVVATSAYCAA----------------------------  91

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
                 FLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFP FIMLYV+ YF+SPILV HG
Sbjct  92    ----FLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPTFIMLYVIQYFVSPILVAHG  147

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P+LLSNLLFM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG+VI+LSP+ IL+GFNP+
Sbjct  148   FFPVLLSNLLFMVAMSYYHYLNFLGYDVLPFLDKTTFFLYPIGLVIILSPLMILSGFNPT  207

Query  355   RYFMNIYFS  329
             RY MN+YFS
Sbjct  208   RYIMNLYFS  216



>ref|XP_010928387.1| PREDICTED: protein unc-50 homolog isoform X2 [Elaeis guineensis]
Length=225

 Score =   362 bits (928),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 197/249 (79%), Gaps = 24/249 (10%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S KGRT +  RP+ +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTVS-KGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDP F+VI  L L  +T AYCAAY  S  H V  V+SV++FHFL+ G +L+
Sbjct  60    KQTKNQWARDDPGFVVILCLFLVVATSAYCAAYGESLAHAVSTVVSVVIFHFLIAGIILA  119

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             TCC                       WLYAFDVHCNSFFP FIMLYV+ YF+SPILV HG
Sbjct  120   TCC-----------------------WLYAFDVHCNSFFPTFIMLYVIQYFVSPILVAHG  156

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P+LLSNLLFM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG+VI+LSP+ IL+GFNP+
Sbjct  157   FFPVLLSNLLFMVAMSYYHYLNFLGYDVLPFLDKTTFFLYPIGLVIILSPLMILSGFNPT  216

Query  355   RYFMNIYFS  329
             RY MN+YFS
Sbjct  217   RYIMNLYFS  225



>ref|XP_011092537.1| PREDICTED: protein unc-50 homolog isoform X2 [Sesamum indicum]
Length=212

 Score =   361 bits (926),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/251 (72%), Positives = 194/251 (77%), Gaps = 42/251 (17%)
 Frame = -1

Query  1075  MLPTSS-LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPTSS  K R   HARPNS+FP YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1     MLPTSSSAKVRPGPHARPNSLFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF+VICSLLL+ S +AYCAAYDHSAGH VFVVISVLLFHFL++GA+L
Sbjct  61    HKQTKNQWARDDPAFVVICSLLLSVSAMAYCAAYDHSAGHAVFVVISVLLFHFLLSGAIL  120

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +TCCWF TNNYLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF++LYV            
Sbjct  121   ATCCWFFTNNYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYV------------  168

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
               +P L                           ERTT FLYPI IV VLSPI IL+GFNP
Sbjct  169   --LPFL---------------------------ERTTLFLYPISIVFVLSPILILSGFNP  199

Query  358   SRYFMNIYFSR  326
             SRYFMN+YFSR
Sbjct  200   SRYFMNMYFSR  210



>ref|XP_006422931.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36171.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
Length=254

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -1

Query  1030  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  851
             R N +FPQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+
Sbjct  17    RTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFV  76

Query  850   VICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEA  671
             VICSLLL+ +T+AYCAAYDHSA H +FVVISVLLFHFL+TGA+L+T CWFLTN+YLRE++
Sbjct  77    VICSLLLSVATIAYCAAYDHSATHAIFVVISVLLFHFLITGAMLATFCWFLTNSYLREDS  136

Query  670   PSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAA  491
             P+SHVVEQRVEWLYAFDVHCNSFFPMF+MLYV+HYFLSP+L+ HGFIP+LLSNLLFM AA
Sbjct  137   PNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSPLLMVHGFIPVLLSNLLFMAAA  196

Query  490   SYYHYLNFLGYD  455
             SYYHYLNFLGYD
Sbjct  197   SYYHYLNFLGYD  208



>ref|XP_001783677.1| predicted protein [Physcomitrella patens]
 gb|EDQ51507.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 207/251 (82%), Gaps = 3/251 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA-RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPT + +GR S+   R NSV PQYLRRIVK++QMD+EYTFWQMLHLCTSPKVVYQ TKY
Sbjct  1     MLPTVN-RGRASTGGYRNNSVLPQYLRRIVKYKQMDMEYTFWQMLHLCTSPKVVYQQTKY  59

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF+VICS LLA +  A+CAAY HS     F V+SV+  HF + G  L
Sbjct  60    HKQTKNQWARDDPAFVVICSFLLAVAATAFCAAYGHSVAQATFTVVSVVFMHFFLVGVSL  119

Query  718   STCCWFLTNNYLREE-APSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVT  542
             ++ CWFL+N+YLREE    +HVVEQRVEWLYAFDVHCN++FP++++LYV+ YFLSP+L+ 
Sbjct  120   ASICWFLSNHYLREEFTVHTHVVEQRVEWLYAFDVHCNAYFPLYVVLYVLQYFLSPLLLA  179

Query  541   HGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
             HGF+  LLSN L+ +A SYYHYLNFLGYDVLPFLERTTFFLYPIG++ +L PI +LTGFN
Sbjct  180   HGFVATLLSNTLYFVALSYYHYLNFLGYDVLPFLERTTFFLYPIGLLALLFPISLLTGFN  239

Query  361   PSRYFMNIYFS  329
             PSR+ + +YF 
Sbjct  240   PSRFALGLYFG  250



>tpg|DAA60647.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=215

 Score =   341 bits (874),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 193/249 (78%), Gaps = 34/249 (14%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR +S + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAA                            
Sbjct  60    KQTKNQWARDDPAFVVILILFLVFATSAYCAA----------------------------  91

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
                 FLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFP F++LYVV YFLSP+LV HG
Sbjct  92    ----FLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVVQYFLSPLLVAHG  146

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F P LLSNLLF++A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ IL GFNP+
Sbjct  147   FFPALLSNLLFVVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMILIGFNPT  206

Query  355   RYFMNIYFS  329
             RYF+++YF 
Sbjct  207   RYFLSLYFG  215



>gb|ABK24141.1| unknown [Picea sitchensis]
Length=217

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 186/217 (86%), Gaps = 1/217 (0%)
 Frame = -1

Query  976  MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY  797
            MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+VICS LLA +  AYCAAY
Sbjct  1    MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFVVICSFLLAVAASAYCAAY  60

Query  796  DHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS-SHVVEQRVEWLYAFD  620
            D S  H  F V+SV+L HFL+ G  L+TCCWFLTNNYLREE  S SHVVEQ VEWLYAFD
Sbjct  61   DVSVAHAGFTVLSVVLVHFLLIGTFLATCCWFLTNNYLREETSSNSHVVEQHVEWLYAFD  120

Query  619  VHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFL  440
            VHCNSFFP+F+ LYV+ YF+SP+LV  GF+P+LLSNLLFM+A SYYHYLNFLGYDVLPFL
Sbjct  121  VHCNSFFPLFVALYVIQYFVSPLLVAQGFVPVLLSNLLFMVAFSYYHYLNFLGYDVLPFL  180

Query  439  ERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
            ++TTFFLYPIG +I+L P  +L GFNP+RY ++ Y+ 
Sbjct  181  DKTTFFLYPIGFIIILIPFLVLAGFNPTRYVLSFYYG  217



>ref|XP_002963517.1| hypothetical protein SELMODRAFT_165762 [Selaginella moellendorffii]
 gb|EFJ35388.1| hypothetical protein SELMODRAFT_165762 [Selaginella moellendorffii]
Length=246

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 200/249 (80%), Gaps = 4/249 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++  GR   H +   + P YLRRIVKW+QMD+EYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1     MLPTTA--GRGLRHPQQQQL-PHYLRRIVKWRQMDVEYTFWQMLHLCTAPKVVYQHTKYH  57

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF VI S+ LA +  AYCAAY  S       V+ V+  HFL+TG  L+
Sbjct  58    KQTKNQWARDDPAFTVISSIFLALAASAYCAAYGSSFLQAGVTVVGVVWLHFLLTGISLA  117

Query  715   TCCWFLTNNYLREEAP-SSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             + CWFL N YLREEA   SHVVEQRVEWLYAFDVHCN++FP+FI+LYV+HYF SP+L+  
Sbjct  118   SICWFLCNRYLREEAAIHSHVVEQRVEWLYAFDVHCNAYFPLFIVLYVIHYFFSPLLILR  177

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GF+P LLSNL F+++ SYYHYL+FLGYDVLPFLERTTFFLYP+ +++VL P  +LTGFNP
Sbjct  178   GFVPTLLSNLFFLVSLSYYHYLSFLGYDVLPFLERTTFFLYPVAVLVVLFPCALLTGFNP  237

Query  358   SRYFMNIYF  332
             +R+ + +YF
Sbjct  238   TRFVLGLYF  246



>ref|XP_002981564.1| hypothetical protein SELMODRAFT_114708 [Selaginella moellendorffii]
 gb|EFJ17379.1| hypothetical protein SELMODRAFT_114708 [Selaginella moellendorffii]
Length=248

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 198/250 (79%), Gaps = 4/250 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSH-ARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPT++  GR   H  +     P YLRRIVKW+QMD+EYTFWQMLHLCT+PKVVYQHTKY
Sbjct  1     MLPTTA--GRGLRHPQQQQQQLPHYLRRIVKWRQMDVEYTFWQMLHLCTAPKVVYQHTKY  58

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF VI S+ LA +  AYCAAY  S       V+ V+  HFL+TG  L
Sbjct  59    HKQTKNQWARDDPAFTVISSIFLALAASAYCAAYGSSFLQAGVTVVGVVWLHFLLTGISL  118

Query  718   STCCWFLTNNYLREEAP-SSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVT  542
             ++ CWFL N YLREEA   SHVVEQRVEWLYAFDVHCN++FP+FI+LYV+HYF SP+L+ 
Sbjct  119   ASICWFLCNRYLREEAAIHSHVVEQRVEWLYAFDVHCNAYFPLFIVLYVIHYFFSPLLIL  178

Query  541   HGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
              GF+P LLSNL F+++ SYYHYLNFLGYDVLPFLERTTFFLYP+ +++VL P  +L GFN
Sbjct  179   RGFVPTLLSNLFFLVSLSYYHYLNFLGYDVLPFLERTTFFLYPVAVLVVLFPCALLAGFN  238

Query  361   PSRYFMNIYF  332
             P+R+ + +YF
Sbjct  239   PTRFVLGLYF  248



>ref|XP_010096286.1| hypothetical protein L484_027024 [Morus notabilis]
 gb|EXB63681.1| hypothetical protein L484_027024 [Morus notabilis]
Length=286

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 192/240 (80%), Gaps = 9/240 (4%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH----  908
             MLPT S    +SS +R N +F QYLRRI+K   + ++    +     T  K   Q     
Sbjct  1     MLPTVSKVRSSSSTSRSNPMFVQYLRRIIKLVLLCLDSVCDEFYVAVTIGKSGRQKLLPF  60

Query  907   ---TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
                 K   +TKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSAGH VFVVISVLLFHFL
Sbjct  61    ITMQKVTVETKNQWARDDPAFVVICSLLLAVATMAYCAAYDHSAGHAVFVVISVLLFHFL  120

Query  736   VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEW--LYAFDVHCNSFFPMFIMLYVVHYF  563
             + G +L+T CWF+TN+YLREEAP+SHVVEQRVEW  LYAFDVHCNSFFPMF+MLYV+HYF
Sbjct  121   IMGILLATFCWFITNSYLREEAPNSHVVEQRVEWQVLYAFDVHCNSFFPMFVMLYVIHYF  180

Query  562   LSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPI  383
             LSP+L+ HGFIP+LLSNLLFM+AASYYHYLNFLGYDVLPFLE+T FFLYPIG+VIVLSPI
Sbjct  181   LSPLLIAHGFIPVLLSNLLFMVAASYYHYLNFLGYDVLPFLEKTAFFLYPIGVVIVLSPI  240



>dbj|BAK01787.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   310 bits (793),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -1

Query  916  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
            YQHTKYHKQTKNQWARDDPAFIVI  L L  +T AYCAA+  SA H    +ISV+  HFL
Sbjct  11   YQHTKYHKQTKNQWARDDPAFIVILILFLVFATSAYCAAFGESAPHAALTIISVVFVHFL  70

Query  736  VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLS  557
              G VL+T CWFLTN+YLREE P+SHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLS
Sbjct  71   FAGLVLATLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLS  129

Query  556  PILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
            P+L+ HGF+P LLSNLLFM+A SYYHYLNFLGYDVLPFL+RTTFFLYPIG+VI+LSP+ I
Sbjct  130  PLLIAHGFLPALLSNLLFMVAISYYHYLNFLGYDVLPFLDRTTFFLYPIGLVIILSPLMI  189

Query  376  LTGFNPSRYFMNIYF  332
            L GFNP+RYF+++YF
Sbjct  190  LVGFNPTRYFLSLYF  204



>ref|XP_008799585.1| PREDICTED: protein unc-50 homolog isoform X1 [Phoenix dactylifera]
Length=310

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  916  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
            YQHTKYHKQTKNQWARDDPAF+VI  L L  +T AYCAAY  S  H V  V+SV++FHFL
Sbjct  115  YQHTKYHKQTKNQWARDDPAFVVILCLFLVVATSAYCAAYGESLAHAVSAVVSVVVFHFL  174

Query  736  VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLS  557
            + G +L+TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMFIMLYV+ YF+S
Sbjct  175  IAGIILATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVIQYFVS  234

Query  556  PILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
            PILV HGF P+LLSNLLFM+A SYYHYLNFLGYDVLPFL++TTFFLYPIG+VI+LSP+ I
Sbjct  235  PILVAHGFFPVLLSNLLFMVAISYYHYLNFLGYDVLPFLDKTTFFLYPIGLVIILSPLMI  294

Query  376  LTGFNPSRYFMNIYFS  329
            L+GFNP+RY MN+YFS
Sbjct  295  LSGFNPTRYIMNLYFS  310



>gb|KEH44100.1| UNC-50 family protein [Medicago truncatula]
Length=189

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  859  AFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLR  680
            A+ +  +LLLA +TLAYCAAYDHS+GH +FVV SVLLFHFL+TG  L+T CWFLTN+YLR
Sbjct  10   AYKISQTLLLAVATLAYCAAYDHSSGHALFVVFSVLLFHFLLTGIFLATFCWFLTNSYLR  69

Query  679  EEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFM  500
            EEAP+S+VVEQRVEW+YAFDVHCNSFFPMF++LYV+HYFLSP+LV HGFIP LLSNLLFM
Sbjct  70   EEAPNSYVVEQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSPLLVAHGFIPELLSNLLFM  129

Query  499  IAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
            + ASYYHYLNFLGYDVLPFLERTTFFLYPIG+VIVLSPI IL+GFNPSRYFMNIYFSR +
Sbjct  130  VGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILILSGFNPSRYFMNIYFSRQI  189



>gb|KJB47364.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=191

 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 153/178 (86%), Gaps = 12/178 (7%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV-------  917
             MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVV       
Sbjct  1     MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVSIVHMNY  60

Query  916   -----YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVL  752
                  YQHTKYHKQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVL
Sbjct  61    YGGCSYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVL  120

Query  751   LFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLY  578
             LFHFL+TG  L+TCCWFLTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFPMF+MLY
Sbjct  121   LFHFLLTGVFLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLY  178



>ref|XP_007042530.1| UNC-50 family protein isoform 3 [Theobroma cacao]
 gb|EOX98361.1| UNC-50 family protein isoform 3 [Theobroma cacao]
Length=200

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S    +SS +RPN +FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1     MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+ G  L+
Sbjct  61    KQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVFVVISVLLFHFLLAGVFLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVV  572
             TCCW LTN YLREEAP+SHVVEQRVEWLYAFDVHCNSFFP+  +  V 
Sbjct  121   TCCWSLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPINTLFSVT  168



>gb|KJB11964.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=184

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT S    + S +RPN++FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PK+VYQHTKYH
Sbjct  1     MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKIVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
              QTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H V VVI+V LFHFL+ G +L+
Sbjct  61    NQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVSVVITVSLFHFLLAGILLA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLY  578
             TCCWFLTN YLR+EAP++ VVEQRVEWLYAFD+HCNSFFPMF+MLY
Sbjct  121   TCCWFLTNAYLRKEAPNTCVVEQRVEWLYAFDLHCNSFFPMFVMLY  166



>ref|XP_002518676.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43601.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score =   273 bits (697),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 140/150 (93%), Gaps = 1/150 (1%)
 Frame = -1

Query  1075  MLPTSS-LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             MLPTSS ++  ++S +RP+ +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1     MLPTSSKIRTSSASTSRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
             HKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS GH VFVVISVLLFHFL+TG VL
Sbjct  61    HKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSTGHAVFVVISVLLFHFLITGVVL  120

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLY  629
             +TCCWF+TN YLREEAP+SHVVEQRVEW++
Sbjct  121   ATCCWFMTNAYLREEAPNSHVVEQRVEWIF  150



>ref|XP_005652231.1| UNC-50 [Coccomyxa subellipsoidea C-169]
 gb|EIE27687.1| UNC-50 [Coccomyxa subellipsoidea C-169]
Length=249

 Score =   275 bits (704),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 179/249 (72%), Gaps = 0/249 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++   R+S+  R  SV   YLRRI+K +QMD EYTFW ML LC SPK  Y+HT YH
Sbjct  1     MLPTTNHGSRSSNPQRRLSVLSTYLRRIIKPKQMDFEYTFWLMLQLCISPKTAYRHTSYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKN WARDDPA++VIC LL+  +  AYC A+  S  H++F V+S +   FL  G  ++
Sbjct  61    KQTKNHWARDDPAYVVICCLLVGAAACAYCVAFSSSVWHSLFTVMSAVFVDFLAIGVAIA  120

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T  WFL N  LR++   SH +EQ VEW+YAFDVHCNS+FP+F++LYV+ Y L P+L+ H 
Sbjct  121   TVGWFLANKCLRKKTLHSHAIEQHVEWMYAFDVHCNSYFPLFLLLYVLQYLLCPLLLWHS  180

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F   +LSNLL+M A SYYHYL+FLGY  LPFLE T  FL+P+  +I++ P  IL+GFNP+
Sbjct  181   FFSAVLSNLLYMAALSYYHYLSFLGYSALPFLEHTEVFLWPVAAIILIVPFTILSGFNPT  240

Query  355   RYFMNIYFS  329
             R+ +NIYF 
Sbjct  241   RFTLNIYFG  249



>gb|ADI46868.1| UNC50f [Volvox carteri f. nagariensis]
Length=250

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 166/225 (74%), Gaps = 0/225 (0%)
 Frame = -1

Query  1006  YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLA  827
             Y+RR+ K +Q DIEYTFW ML LC SPK  Y+HT YHKQTKNQWARDDPAF+V+C LL+A
Sbjct  25    YMRRLFKPRQWDIEYTFWLMLQLCLSPKTAYRHTAYHKQTKNQWARDDPAFMVVCCLLVA  84

Query  826   CSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQ  647
               +LAYC  +  S   + F+++S ++  +L+ G  L+T CW LTN +LR+     H VEQ
Sbjct  85    VGSLAYCVTFGSSLWGSAFIILSAVMIDYLMLGISLATFCWMLTNRFLRKSNLHHHQVEQ  144

Query  646   RVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNF  467
              VEWLYAFDVHCNSFFP F++LYV+ + LSP+L+    +   LSN L+++A   Y+Y+NF
Sbjct  145   YVEWLYAFDVHCNSFFPAFLLLYVMQFLLSPLLLWQSSVSSALSNALYVLALGVYNYMNF  204

Query  466   LGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYF  332
             LGY  LPFL+RT  FL+PIGIV++L P  +L+GFNPS++ + IYF
Sbjct  205   LGYSALPFLDRTEVFLWPIGIVLLLLPFSVLSGFNPSKFTLGIYF  249



>gb|ADI46908.1| UNC50m [Volvox carteri f. nagariensis]
Length=250

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 172/248 (69%), Gaps = 0/248 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             +LPTSS +  +    +  S    YLRR +K +Q D+EYTFW ML LC+SPK  Y+HT YH
Sbjct  2     LLPTSSHQTSSIRRVQIKSHMSAYLRRFLKPRQWDLEYTFWLMLQLCSSPKTAYRHTAYH  61

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDP F+V+C +L+A ++ AYC  +  S   ++ +V++ +L  F + G  L+
Sbjct  62    KQTKNQWARDDPGFVVVCCILVAVASSAYCVTFGESFWDSLVIVLTAVLVDFFMLGIALA  121

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CW +TN  LR+     H VEQ VEWLY+FDVHCNSFFP F++LYV+ + LSP L+   
Sbjct  122   TACWLITNRLLRKRNLHHHQVEQHVEWLYSFDVHCNSFFPFFLVLYVLQFLLSPALLWQS  181

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
              I   LSN L++IA   Y+Y+NFLGY  LPFL+RT  FL+PIG+ ++L P  +L+GFNPS
Sbjct  182   SISSALSNALYVIALGVYNYINFLGYSALPFLDRTEVFLWPIGVTLLLLPFAVLSGFNPS  241

Query  355   RYFMNIYF  332
             R+ + +YF
Sbjct  242   RFMLGMYF  249



>ref|XP_002503978.1| unc-50 family protein [Micromonas sp. RCC299]
 gb|ACO65236.1| unc-50 family protein [Micromonas sp. RCC299]
Length=249

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 170/238 (71%), Gaps = 0/238 (0%)
 Frame = -1

Query  1045  TSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARD  866
             +   A   S FP Y+RR++K++QMD+EYTFWQM  +CT+PKVVY+HT Y KQTKNQWARD
Sbjct  11    SQKGAYRGSGFPTYVRRLMKFRQMDLEYTFWQMYLMCTNPKVVYRHTMYRKQTKNQWARD  70

Query  865   DPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNY  686
             DPAF+V+ ++++   ++ YC  Y  S G   + V+  +L  FL  GA ++T  W++ N Y
Sbjct  71    DPAFVVLTAIMVFAVSILYCLFYSRSLGQAAYAVVRSVLVDFLGVGAGVATAYWYVANRY  130

Query  685   LREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLL  506
             +RE    SH VEQRVEW+YAFDVH N+FF +F+ LY     LSPIL+ +GF+P LLS  L
Sbjct  131   MREGVNHSHAVEQRVEWMYAFDVHVNAFFTLFVSLYCGQLVLSPILMMNGFLPRLLSGAL  190

Query  505   FMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYF  332
             + +A SYYHY  F GY+VLPFLE T   +YPI ++++++P+ IL GFNP+++ + IYF
Sbjct  191   YGVALSYYHYCVFCGYNVLPFLEHTALLVYPIALIMLVTPLAILVGFNPTKFVLGIYF  248



>ref|XP_001696427.1| UNC-50 family protein [Chlamydomonas reinhardtii]
 gb|EDP08404.1| UNC-50 family protein [Chlamydomonas reinhardtii]
Length=245

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 174/249 (70%), Gaps = 4/249 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLP ++  G+  +          YLRR +K +Q D+EYTFW ML L  SPK  Y+HT YH
Sbjct  1     MLPQATTAGKRGN----KGYLGTYLRRFLKPKQWDLEYTFWMMLQLVISPKTAYRHTAYH  56

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAFIV+C  L+  ++LAYC  +  +  HT+  V+S +L  FL+ G  ++
Sbjct  57    KQTKNQWARDDPAFIVVCCALVTVASLAYCVTFGDTLWHTLLTVLSAVLVDFLLIGVAMA  116

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG  536
             T CW +TN +LR+     H VEQ VEWLYAFDVHCNS+FP+F++LYV+ + LSP+L+   
Sbjct  117   TACWVITNRFLRKRNLHHHQVEQHVEWLYAFDVHCNSYFPLFLLLYVLQFLLSPVLLWRS  176

Query  535   FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPS  356
             F+   L+N L++IA  YYHY+NFLGY  LPFLERT  FL+PIG +++L P  +L+GFNPS
Sbjct  177   FLSSALANALYVIALGYYHYMNFLGYSALPFLERTEVFLWPIGAMLLLLPFAVLSGFNPS  236

Query  355   RYFMNIYFS  329
              + +++YF 
Sbjct  237   IFTLSVYFG  245



>ref|XP_003054963.1| unc-50 family protein [Micromonas pusilla CCMP1545]
 gb|EEH60215.1| unc-50 family protein [Micromonas pusilla CCMP1545]
Length=234

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 160/228 (70%), Gaps = 1/228 (0%)
 Frame = -1

Query  1012  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  833
             P YLRR +KW+QMD+EY  WQM  +CT+PKVVY+HT Y KQTKNQWARDDPA +V+ S+L
Sbjct  8     PPYLRRAMKWKQMDLEYAMWQMWLMCTNPKVVYRHTMYRKQTKNQWARDDPAVVVLTSIL  67

Query  832   LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVV  653
             +  ++  YC  +  S  H+V+VV S  L  ++  GA+++T  WF++N +LR     SH +
Sbjct  68    VFATSSLYCCFFSKSFKHSVYVVASAGLIDYVGLGALIATGYWFVSNRFLRTGVGHSHAI  127

Query  652   EQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYL  473
             EQRVEWLYAFDVHCN+FFP+F+ LY     LSP+L+  GFIP +LS  L+ +A  YY Y 
Sbjct  128   EQRVEWLYAFDVHCNAFFPLFLQLYAAQLVLSPVLLAGGFIPRMLSCALYAVALGYYQYC  187

Query  472   NFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
              F+G++ LPFLE    FLYPI  V  L+P+  L GFNP+++ + IYF 
Sbjct  188   TFIGFNALPFLE-AMLFLYPIAGVAFLAPMMCLFGFNPTKFVLGIYFG  234



>gb|KIZ03662.1| putative Protein unc-50 like protein [Monoraphidium neglectum]
Length=212

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 157/216 (73%), Gaps = 4/216 (2%)
 Frame = -1

Query  976  MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY  797
            MD EYTFW ML LC SPK  Y+HT Y KQTKNQWARDDPAF+V+C LLLA ++ AYC   
Sbjct  1    MDFEYTFWLMLQLCISPKTAYRHTSYQKQTKNQWARDDPAFVVVCCLLLAGASAAYCV--  58

Query  796  DHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDV  617
              +  H++  ++S ++  FL+ G  +S+  WF++N +LR+     H VEQ VEWLY+FDV
Sbjct  59   --TLWHSLLSILSAVVVDFLLIGLAISSASWFISNRFLRKRNLPHHQVEQHVEWLYSFDV  116

Query  616  HCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLE  437
            HCNS+FP+F++LYV  + LSP+L+   + P  L+ +L+  A S+YHYLNFLGY  LPFLE
Sbjct  117  HCNSYFPLFLLLYVFQFLLSPLLLWRAWAPAALACVLYAAAFSHYHYLNFLGYSALPFLE  176

Query  436  RTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
            RT  FL+PIG++ V  P+ +L GFNP+R+ ++IYFS
Sbjct  177  RTEVFLWPIGLICVALPLAVLFGFNPTRFVLSIYFS  212



>ref|XP_005716895.1| unnamed protein product [Chondrus crispus]
 emb|CDF37076.1| unnamed protein product [Chondrus crispus]
Length=253

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 157/248 (63%), Gaps = 0/248 (0%)
 Frame = -1

Query  1072  LPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHK  893
             LP    K   +S    +   P+Y+RR  ++ QMD++YT WQML+LC +P  VY+ TKYHK
Sbjct  6     LPLYGAKSGATSLGGSSVQMPEYVRRFFQYPQMDMDYTLWQMLYLCVAPSRVYRTTKYHK  65

Query  892   QTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLST  713
             QTKNQWARDDPAFI I    +A S+L Y  A+  S G     ++  ++  F + G + +T
Sbjct  66    QTKNQWARDDPAFIAIMVYFMAISSLGYAIAFHKSVGGFFKAILYAIVVDFGLVGVLAAT  125

Query  712   CCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGF  533
               W+L N YL  E   SH  EQ+VEWLYAFDVHCNSFFP FI+LYV  YFL  + +  GF
Sbjct  126   LGWYLANQYLLIENAGSHTTEQKVEWLYAFDVHCNSFFPFFILLYVFQYFLMMVFMKDGF  185

Query  532   IPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSR  353
             +  LL+N  + +A SYY Y+ FLGYDVLPFL+ TT FLYPI  V V      L  FN SR
Sbjct  186   VCTLLANATYALAFSYYLYVTFLGYDVLPFLQHTTVFLYPIVGVAVAFLATCLLKFNISR  245

Query  352   YFMNIYFS  329
             + M+ YF 
Sbjct  246   FVMSSYFG  253



>ref|XP_008360793.1| PREDICTED: protein unc-50 homolog [Malus domestica]
Length=141

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = -1

Query  718  STC-CWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVT  542
            S C C FLTN+YLREEAP+SHVVEQ VEWLYAFDVHCNSFFPMF++LYV+HYFLSPILV 
Sbjct  6    SQCSCRFLTNSYLREEAPNSHVVEQHVEWLYAFDVHCNSFFPMFVLLYVIHYFLSPILVA  65

Query  541  HGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
            HGF+P+LLSNL+FM+A SYYHYLNFLGYDVLPFLERTTFFLYPI +VIVLSPI IL+GF+
Sbjct  66   HGFLPVLLSNLIFMVATSYYHYLNFLGYDVLPFLERTTFFLYPISVVIVLSPILILSGFS  125

Query  361  PSRYFMNIYFSR  326
            PSRYFMN+YFS+
Sbjct  126  PSRYFMNMYFSQ  137



>dbj|GAM19513.1| hypothetical protein SAMD00019534_026880, partial [Acytostelium 
subglobosum LB1]
Length=252

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 165/247 (67%), Gaps = 7/247 (3%)
 Frame = -1

Query  1048  RTSSHARPNSV-----FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTK  884
             RTSS    +SV      P+Y RRI+ + QMDIEYTFW M +LC +P  VY++T +HKQTK
Sbjct  7     RTSSSLNSDSVRFKRFVPEYFRRIMHYPQMDIEYTFWIMFYLCFNPARVYRNTSWHKQTK  66

Query  883   NQWARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             NQWARDDPAF+VI    ++ ++++Y  A+ + S  H +  +   + F F+  G V +T  
Sbjct  67    NQWARDDPAFVVIVVFFMSIASMSYAIAFHYLSVVHIIKTMFWAVFFDFITVGLVTATAG  126

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIP  527
             WFL+N +LRE +   H V+Q+VEWLYAFD+HCNSFFP+FI+LYV+H+FL P L++   I 
Sbjct  127   WFLSNRFLRESS-HHHSVDQKVEWLYAFDIHCNSFFPLFIILYVIHFFLLPFLMSTKLIA  185

Query  526   LLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYF  347
               +SN +F ++  YY+Y+ FLGY+ LPFL  T+ FLYP+ +V  +  + I+   N +  F
Sbjct  186   TFISNSMFFLSIVYYYYITFLGYNALPFLHNTSVFLYPVILVFTIYVLAIVFNINFTVLF  245

Query  346   MNIYFSR  326
             M+ YF  
Sbjct  246   MSFYFGN  252



>ref|XP_005848175.1| hypothetical protein CHLNCDRAFT_22928 [Chlorella variabilis]
 gb|EFN56073.1| hypothetical protein CHLNCDRAFT_22928 [Chlorella variabilis]
Length=255

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 169/252 (67%), Gaps = 3/252 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQ---YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  905
             MLPTSS     SS  R +S +     Y RR+ K  QMD +YT W ML LC SPK  Y+HT
Sbjct  1     MLPTSSPPPGHSSKQRRHSRYSLLWLYFRRLFKPTQMDFQYTLWTMLQLCISPKTAYRHT  60

Query  904   KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGA  725
              YHKQTKN WARDDPAF+VIC  L+A + LAYC A+ HS G ++  ++S +   FL  GA
Sbjct  61    SYHKQTKNHWARDDPAFVVICCTLVALAALAYCLAFSHSVGRSLLTIVSAVAVDFLAVGA  120

Query  724   VLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILV  545
              ++T  W L+N +LR +   SH VEQ VEW+YAFDVHCN+FFPMF++LYV+   L P+L+
Sbjct  121   AIATAGWALSNRFLRRQNQHSHAVEQSVEWMYAFDVHCNAFFPMFLLLYVLQLVLCPVLL  180

Query  544   THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGF  365
              H F+  +LS +L+ + +++Y Y+ FLGY  LPFLERT  FLYPI  ++V  P+ +L G 
Sbjct  181   MHTFVATVLSAVLYAVGSAFYVYITFLGYSALPFLERTEVFLYPIAGIVVALPLALLLGI  240

Query  364   NPSRYFMNIYFS  329
             NP++  +  YF 
Sbjct  241   NPTKLVLKWYFD  252



>gb|EMS49427.1| hypothetical protein TRIUR3_32733 [Triticum urartu]
Length=252

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/250 (51%), Positives = 151/250 (60%), Gaps = 45/250 (18%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQ-------------------MDIEYTFW  953
             MLPT++ KGR ++ + P  +F  YLRRIVK                       D+ Y F 
Sbjct  1     MLPTTASKGRGAARSAP-PLFGPYLRRIVKVGAGLLLGIHIHSSGSLRHAYGADLAYGFA  59

Query  952   QMLHLCTSPKVVYQHTKYHK------------------------QTKNQWARDDPAFIVI  845
             +      +       TK                           +TKNQWARDDPAFIVI
Sbjct  60    RPRGASAAAICGPGATKTSNLVRVSYVAEMRVCPRFLISIFLFTETKNQWARDDPAFIVI  119

Query  844   CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS  665
               L L  +T AYCAA+  SA H    +ISV+  HFL  G VL+T CWFLTN+YLREE P+
Sbjct  120   LILFLVFATSAYCAAFGESAPHAALTIISVVFVHFLFAGLVLATLCWFLTNSYLREE-PN  178

Query  664   SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASY  485
             SHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP+L+ HGF+P LLSNLLFM+A SY
Sbjct  179   SHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSPLLIAHGFLPALLSNLLFMVAISY  238

Query  484   YHYLNFLGYD  455
             YHYLNFLGYD
Sbjct  239   YHYLNFLGYD  248



>ref|XP_629704.1| UNC-50 family protein [Dictyostelium discoideum AX4]
 sp|Q54DD7.1|UNC50_DICDI RecName: Full=Protein unc-50 homolog [Dictyostelium discoideum]
 gb|EAL61284.1| UNC-50 family protein [Dictyostelium discoideum AX4]
Length=261

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 162/246 (66%), Gaps = 2/246 (1%)
 Frame = -1

Query  1054  KGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQW  875
              G  SS +R   + P+Y RRI  + QMDIEYTFW M +LC +P  VY+ T +HKQTKNQW
Sbjct  17    DGTASSASRYRRLIPEYFRRIFHYPQMDIEYTFWIMFYLCFNPSRVYRVTSWHKQTKNQW  76

Query  874   ARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLLFHFLVTGAVLSTCCWFL  698
             ARDDPAF VI    +A ++++Y   +   S  + + V+   +   F+  G +++T  W++
Sbjct  77    ARDDPAFAVILVFFMAIASMSYAITFHFLSFLNVIKVMFWAVFVDFITVGLLIATIGWWV  136

Query  697   TNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLL  518
             TN +LR     +H V+Q VEWLYAFD+HCNSFFP+FI+LYVV +FL PIL+++     +L
Sbjct  137   TNKFLRVSV-HNHSVDQSVEWLYAFDIHCNSFFPLFIILYVVQFFLLPILLSNSLFAAIL  195

Query  517   SNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNI  338
             SN L++I  SYY+Y+ FLGY+ LPFL+ T  FLYPIGI+  L  + ++ G N +   +N 
Sbjct  196   SNTLYIIGFSYYYYVTFLGYNALPFLQHTVVFLYPIGILFALYIVSVVMGKNLTVSIINF  255

Query  337   YFSRAL  320
             YF   L
Sbjct  256   YFGFQL  261



>ref|XP_003294507.1| hypothetical protein DICPUDRAFT_159511 [Dictyostelium purpureum]
 gb|EGC28968.1| hypothetical protein DICPUDRAFT_159511 [Dictyostelium purpureum]
Length=255

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 161/256 (63%), Gaps = 8/256 (3%)
 Frame = -1

Query  1075  MLPTS------SLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  914
             MLP S      S   R  S +R   + P+Y RRI  + QMDIEYTFW M +LC  P  VY
Sbjct  1     MLPISYTNINNSRITRDGSSSRYRRLIPEYFRRIFHYPQMDIEYTFWIMFYLCFGPSRVY  60

Query  913   QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLLFHFL  737
             + T +HKQTKNQWARDDPAF VI    +A ++L+Y   + + S  H +  +   +   F+
Sbjct  61    KVTSWHKQTKNQWARDDPAFAVILVFFMAIASLSYAITFHYLSFYHIIKTMFWAVFVDFI  120

Query  736   VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLS  557
               G V++T  W++TN +LR  A  +H V+Q VEWLYAFD+HCNSFFP+FI LYV  +F  
Sbjct  121   SLGLVIATLGWWITNKFLRVSA-HNHSVDQNVEWLYAFDIHCNSFFPLFIFLYVFQFFFL  179

Query  556   PILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
             PIL+++    ++ SN L+    SYY+Y+ FLGY  LPFL+ T FFLYPIG+ +    +FI
Sbjct  180   PILLSNSLFAIIFSNTLYFAGFSYYYYITFLGYSALPFLQHTKFFLYPIGLFLPCYILFI  239

Query  376   LTGFNPSRYFMNIYFS  329
             + G NP+   +  YF+
Sbjct  240   VMGKNPTLSVLGFYFN  255



>ref|XP_003082233.1| putative UNC50 (ISS) [Ostreococcus tauri]
 emb|CAL57179.1| UNC-50 [Ostreococcus tauri]
Length=272

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 165/269 (61%), Gaps = 20/269 (7%)
 Frame = -1

Query  1075  MLPTSSLKG-------RTSSHARPNSVF----------PQYLRRIVKWQQMDIEYTFWQM  947
             MLPT+S          R +S+A    V+            YLRR  +W+QMD+EY+ WQ 
Sbjct  1     MLPTTSSDAAESRGSHRRASYAERYRVYVAAAAKSAQTGHYLRRAFRWRQMDVEYSLWQA  60

Query  946   LHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY-DHSAGHTVF  770
               +C +PK VY+HT Y KQTKN WARDDP F+V+  + +  + + +CAAY D     +  
Sbjct  61    AAMCVNPKAVYRHTTYRKQTKNHWARDDPTFVVLSCVAVGLAAIGWCAAYGDGGTSGSAR  120

Query  769   VVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS--SHVVEQRVEWLYAFDVHCNSFFP  596
             VV   ++  +L  GAVL+T  W L N +LR + P   SH VEQRVEWLYAFDVHCN+F P
Sbjct  121   VVARCVIGDYLGVGAVLATVSWHLANTHLRTKLPGGHSHAVEQRVEWLYAFDVHCNAFVP  180

Query  595   MFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLY  416
              +++LYVV   LSP+L   G +   LS  L+ +A  Y++Y  F+GY+ LPFLE T FFLY
Sbjct  181   TYVLLYVVQLTLSPLLRAEGRLASALSCALYAVALVYHNYCAFIGYNALPFLENTEFFLY  240

Query  415   PIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
             P    ++ +PI  L  FNP+R+ ++IYF+
Sbjct  241   PAAAALIAAPIAALIAFNPTRFVLSIYFA  269



>ref|XP_001420594.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98887.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=249

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 155/238 (65%), Gaps = 3/238 (1%)
 Frame = -1

Query  1033  ARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF  854
             AR N+    Y RR  +W+QMD+EY+ WQ   +C +PK VY+HT Y KQTKNQWARDDP F
Sbjct  6     ARRNASAGHYFRRAFRWRQMDVEYSLWQAASMCVNPKAVYRHTTYRKQTKNQWARDDPTF  65

Query  853   IVICSLLLACSTLAYCAAYDHS-AGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLRE  677
             +V+  + +  + + YCA Y    A  T  +     +  +L  G VL+T  W+L N YLR 
Sbjct  66    VVMSCVFVTVAAIGYCAMYGGGGASATARIAARCAVGDYLGLGCVLATVSWYLANTYLRT  125

Query  676   E--APSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLF  503
             +     SH VEQRVEW+YAFDVHCN+F P +++LYV+   LSP+L   G++    S +++
Sbjct  126   KHMGGHSHAVEQRVEWMYAFDVHCNAFAPTYVVLYVLQLLLSPLLRRSGYLASACSCVMY  185

Query  502   MIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
              IA +Y++Y  F+GY+ LPFLERT FFLYP  +V+VL+P   L  FNP+R+ + +YF 
Sbjct  186   AIALAYHNYCVFVGYNALPFLERTEFFLYPAALVLVLAPFAALVAFNPTRFVLWLYFG  243



>gb|EXX54778.1| Gmh1p [Rhizophagus irregularis DAOM 197198w]
Length=316

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 161/257 (63%), Gaps = 10/257 (4%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA-----RP---NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  920
             +LPT+S +    S       RP   ++  P +LRR+ ++ QMD E+  WQML+LC +P+ 
Sbjct  3     ILPTTSPRSTFPSDTHHKRRRPTYWSASIPIFLRRLFRFPQMDFEFALWQMLYLCIAPRR  62

Query  919   VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHF  740
             VY++  YHKQTKNQWARDDPAF+VI S  L  S +A+   Y H     + +++ ++   F
Sbjct  63    VYRNIYYHKQTKNQWARDDPAFVVILSFFLGVSAIAWGLVYGHGFIGILKMILFMVFIDF  122

Query  739   LVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFL  560
             +V G V+ST CW   N +L     + H VEQ VEW YAFDVHCNSFFP+F++LYV  +FL
Sbjct  123   VVVGMVISTICWAFANRFLTHRH-TLHAVEQTVEWAYAFDVHCNSFFPLFLILYVAQFFL  181

Query  559   SPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIF  380
               +LV   +I L L N ++++A  YY Y+ FLGY+ LPFL  T  FLYP+ + +++  I 
Sbjct  182   MRVLVKDIWICLFLGNTMYLVAIGYYCYITFLGYNALPFLLHTEMFLYPVVMFLIIYFI-  240

Query  379   ILTGFNPSRYFMNIYFS  329
              L GF+ S   + +YF 
Sbjct  241   SLFGFHISANVLRLYFE  257



>ref|XP_004354055.1| hypothetical protein ACA1_165790 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR24358.1| hypothetical protein ACA1_165790 [Acanthamoeba castellanii str. 
Neff]
Length=232

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/250 (46%), Positives = 154/250 (62%), Gaps = 19/250 (8%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLP+ +    T+      S  P+YLRRI+ + QMDIEYTF             Y+ T + 
Sbjct  1     MLPSYT----TNRFNGSRSYIPEYLRRIIHYPQMDIEYTF------------CYRTTSWR  44

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF-HFLVTGAVL  719
             KQTKNQWARDDPAFI I  L +A + +AY  A++     T+  ++    F  FL  G   
Sbjct  45    KQTKNQWARDDPAFIAILVLFMAVAAIAYSVAFNAWNPVTLLRIMFWAAFIEFLGLGLAT  104

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTH  539
             +T  WF+ N YLR +  S H V+Q+VEWLYAFDVHCNSFFP+F++LYV+ +FL P+++  
Sbjct  105   ATLGWFVANKYLRVQ--SLHAVDQKVEWLYAFDVHCNSFFPLFVVLYVLQFFLLPLILGT  162

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNP  359
             GF   +++N ++  A SYY Y+ FLGY+VLPFL  T  FLYPIG V +   + +L  FN 
Sbjct  163   GFFSTVIANSMYAFAFSYYFYVTFLGYNVLPFLHHTVLFLYPIGAVGLFYVLSLLFRFNC  222

Query  358   SRYFMNIYFS  329
             S + MN YF 
Sbjct  223   SVFVMNYYFG  232



>ref|XP_006676512.1| hypothetical protein BATDEDRAFT_9454 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82888.1| hypothetical protein BATDEDRAFT_9454 [Batrachochytrium dendrobatidis 
JAM81]
Length=272

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 145/232 (63%), Gaps = 3/232 (1%)
 Frame = -1

Query  1024  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  845
              S F  Y RR+    QMD E   WQM +L  SP+ VY++  Y+KQTKN WARDDPAF ++
Sbjct  44    GSTFGTYFRRMTSLPQMDFELALWQMAYLVISPRRVYRNVYYNKQTKNHWARDDPAFHIL  103

Query  844   CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPS  665
              +L +  + + Y  AY  S   T+ ++   LL  FL TG +++T  WF TN ++ ++   
Sbjct  104   IALCMCVAAIVYGIAYSESVLGTLHLIAYTLLIEFLGTGLMIATTAWFFTNQFMLQQ--Q  161

Query  664   SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASY  485
              H VEQ VEW+Y+FDVHCN+F P F++ YVV +F   I++  G I  L SN ++ +A +Y
Sbjct  162   VHAVEQSVEWMYSFDVHCNAFVPFFLITYVVQFFFLRIVLADGLICRLFSNTIYFVALNY  221

Query  484   YHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
             Y Y+ FLGY+ LPFL+ T  FLYPIG+ ++L  I + T FN S+    +YF 
Sbjct  222   YWYITFLGYNALPFLKNTIVFLYPIGLTMLLFVISLFT-FNISKAIFALYFE  272



>gb|ESA04707.1| hypothetical protein GLOINDRAFT_38971 [Rhizophagus irregularis 
DAOM 181602]
Length=215

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 140/217 (65%), Gaps = 2/217 (1%)
 Frame = -1

Query  976  MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY  797
            MD E+  WQML+LC +P+ VY++  YHKQTKNQWARDDPAF+VI S  L  S +A+   Y
Sbjct  1    MDFEFALWQMLYLCIAPRRVYRNIYYHKQTKNQWARDDPAFVVILSFFLGVSAIAWGLVY  60

Query  796  DHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDV  617
             H     + +++ ++   F+V G V+ST CW   N +L     + H VEQ VEW YAFDV
Sbjct  61   GHGFIGILKMILFMVFIDFVVVGMVISTICWAFANRFLTHR-HTLHAVEQTVEWAYAFDV  119

Query  616  HCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLE  437
            HCNSFFP+F++LYV  +FL  +LV   +I L L N ++++A  YY Y+ FLGY+ LPFL 
Sbjct  120  HCNSFFPLFLILYVAQFFLMRVLVKDIWICLFLGNTMYLVAIGYYCYITFLGYNALPFLL  179

Query  436  RTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSR  326
             T  FLYP+ + +++  I  L GF+ S   + +YF  
Sbjct  180  HTEMFLYPVVMFLIIYFI-SLFGFHISANVLRLYFGE  215



>ref|XP_007511940.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66028.1| predicted protein [Bathycoccus prasinos]
Length=279

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 147/237 (62%), Gaps = 13/237 (5%)
 Frame = -1

Query  1003  LRRIVKWQQMDIEYTFWQMLHLCT-SPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLA  827
             L+RI+K + +D EY  WQM  L T  PK +Y+H +Y KQTKNQWARDDP F V+  + +A
Sbjct  39    LKRIIKPKLLDFEYALWQMRLLLTHGPKKIYRHCEYRKQTKNQWARDDPTFCVLSCIFVA  98

Query  826   CSTLAYCAAYD-HSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYL---------RE  677
                + YC  Y+       ++V+ S + F ++  G  ++T  WFL N ++         + 
Sbjct  99    LCAIGYCFMYETRGIVRGLWVITSAVCFDYIGCGCAIATAYWFLANRFMTTRTRRGGSKN  158

Query  676   EAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMI  497
                SS      VEWL+AFDVHCNSF P+F+ LY+    LSP+L   GFI  LLSN+L+ +
Sbjct  159   SDGSSMSSNNNVEWLFAFDVHCNSFVPLFVALYLGQLILSPLLSQRGFICALLSNILYGL  218

Query  496   AASYYHYLNFLGYDVLPFLERTTFFLYP-IGIVIVLSPIFILTGFNPSRYFMNIYFS  329
             + SYYHY  F+G++ LPFLERT F LYP +G+V++  P+  +  FNP+R+ ++ YF 
Sbjct  219   SLSYYHYCQFVGFNSLPFLERTEFLLYPVVGLVLLAIPLSAMQ-FNPTRWVLSWYFG  274



>emb|CDH59652.1| unc-50-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH55428.1| unc-50-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=258

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 149/230 (65%), Gaps = 6/230 (3%)
 Frame = -1

Query  1012  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  833
             P  LRR+ ++ QMD E+  WQM +L  +P+ VY++  YHKQTKNQWARDDPAF+V+ + L
Sbjct  31    PIILRRLFRFPQMDFEFALWQMAYLLIAPRRVYRNIYYHKQTKNQWARDDPAFLVLLASL  90

Query  832   LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVV  653
             L  S +A+  AY       +  ++ ++L  FL+ G++ +T  WF++N +L  +   +H V
Sbjct  91    LCVSAVAWGLAYGLGMVGILRAMLFMVLVDFLLVGSLAATFTWFVSNRFLIMDT-MAHAV  149

Query  652   EQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYL  473
             EQ+VEW YAFDVHCNSFFP+F++ YV+ +F  P+L    ++ L   N ++  AA +Y Y 
Sbjct  150   EQKVEWAYAFDVHCNSFFPVFLITYVLQFFFMPVLKHDNWVSLFFGNTIYFCAAVWYIYG  209

Query  472   NFLGYDVLPFLERTTFFLYP--IGIVIVLSPIFILTGFNPSRYFMNIYFS  329
              FLG++ LPFL  T  FLYP  IG ++ ++ +F   GFN S+  + +YF 
Sbjct  210   TFLGFNALPFLAHTELFLYPILIGTILYVASLF---GFNVSQNILTLYFG  256



>ref|XP_008338222.1| PREDICTED: protein unc-50 homolog [Malus domestica]
Length=124

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT+S    +SS +R N +  QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1     MLPTTSRGRSSSSSSRTNPMPIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VICS+LLA +TLAYCAAYDHSA H VFVVISVL FHFL  G +L+
Sbjct  61    KQTKNQWARDDPAFVVICSVLLAVATLAYCAAYDHSAAHAVFVVISVLFFHFLFIGMLLA  120

Query  715   TCCW  704
             T CW
Sbjct  121   TFCW  124



>ref|XP_008612241.1| hypothetical protein SDRG_08150 [Saprolegnia diclina VS20]
 gb|EQC34379.1| hypothetical protein SDRG_08150 [Saprolegnia diclina VS20]
Length=287

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 146/231 (63%), Gaps = 8/231 (3%)
 Frame = -1

Query  1081  GNMLPTSSLKGRTSS---HARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  911
             G+  PT   +G + +       +S  P+Y  R+V ++QMD+E T++QM+ LC +P  VY+
Sbjct  24    GSAFPTRPARGASGTLPLFRNCSSAVPEYFARMVDYRQMDLEATYYQMVTLCIAPSKVYK  83

Query  910   HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVT  731
                Y KQTKN+WARDDPAF VI  L L  ++LA+  A++ ++    F++I  ++  +LV 
Sbjct  84    SAYYRKQTKNRWARDDPAFAVIQVLFLFVASLAWTVAFEKTSSLG-FLLICDVIVEWLVL  142

Query  730   GAVLSTCCWFLTNNYLREEAPS----SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYF  563
             G +LST  W++ N +LR   P     +  VEQ VEW YAFD+HCN FF +F++++VV + 
Sbjct  143   GVLLSTASWWVANTFLRLSPPGIASDTFFVEQSVEWQYAFDIHCNGFFVLFLLVHVVQFL  202

Query  562   LSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPI  410
             L P+LV   F+ LL++N L+ +A   Y Y+ FLGY  LPFL  T  FLYP+
Sbjct  203   LVPLLVADTFVSLLMANTLYALACGSYFYITFLGYMALPFLHNTERFLYPV  253



>gb|ETL47305.1| hypothetical protein L916_02928 [Phytophthora parasitica]
 gb|ETP23865.1| hypothetical protein F441_03060 [Phytophthora parasitica CJ01A1]
Length=291

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 148/241 (61%), Gaps = 13/241 (5%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA--------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  920
             ML +  L  R    A        R  S FP+Y  R++ ++QMD++ TF+QM+ LC  P  
Sbjct  23    MLSSDPLGSRQKKKAKRAGTDVFRSCSAFPEYFARVLDYRQMDLDATFYQMVTLCVQPAK  82

Query  919   VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFH  743
             VY+   Y KQTKN+WARDDPAF VI    L  +T+A+  A+   SA     ++   ++  
Sbjct  83    VYKSAYYRKQTKNRWARDDPAFAVIQFAFLLVATVAWAIAFRVDSAAKYASLLFHAVVIE  142

Query  742   FLVTGAVLSTCCWFLTNNYLREE----APSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYV  575
             +L  G V+ST CW++ N++LR+        +  VEQRVEW +AFD+HCNSFF +F+ LYV
Sbjct  143   WLGCGLVISTLCWWIANHHLRQRNNLGVGDALYVEQRVEWQFAFDIHCNSFFILFLFLYV  202

Query  574   VHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIV  395
             + + L+P+LV++ F+ LL+ NLL+ +   +Y Y+ FLGY  LPFL RT   L P+ +++ 
Sbjct  203   LQFLLAPLLVSNSFVMLLVGNLLYSLGWGFYTYITFLGYMALPFLHRTEQLLLPVIVILA  262

Query  394   L  392
             L
Sbjct  263   L  263



>dbj|GAN10508.1| UNC-50-like protein [Mucor ambiguus]
Length=264

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 149/234 (64%), Gaps = 0/234 (0%)
 Frame = -1

Query  1030  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  851
             + +S  P  + R+V++ QMD E+  WQM +L  +P+ VY++  YHKQTKNQWARDDPAF+
Sbjct  29    KRSSPMPLIITRLVRFTQMDFEFALWQMAYLLLAPRRVYRNIYYHKQTKNQWARDDPAFL  88

Query  850   VICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEA  671
             V+ + LL  S +A+   +       V  ++ ++L  F++ G++++T  WF TN +L +  
Sbjct  89    VLLASLLCVSAIAWGLVFGLGFLGVVKAMLLMVLVDFVLVGSIVATLLWFFTNRFLNQSN  148

Query  670   PSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAA  491
               +   +Q+VEW YAFD+HCNSFFP+F++LY++ +    +L+ H +  L++SN +++I+ 
Sbjct  149   AITQTHDQKVEWAYAFDIHCNSFFPLFLILYIIQFCFLNLLIRHNWASLVISNAIYLISI  208

Query  490   SYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
              +Y Y  FLG++VLPFL  T   LYPI   +VL  +  + G N S   + +YF 
Sbjct  209   VWYCYGTFLGFNVLPFLVHTELLLYPIFGFLVLFIVLCVLGINLSENVVGLYFG  262



>gb|KFH64319.1| hypothetical protein MVEG_10144 [Mortierella verticillata NRRL 
6337]
Length=305

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 145/228 (64%), Gaps = 2/228 (1%)
 Frame = -1

Query  1012  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  833
             P +LRR+ ++  MD ++  WQM++LC SP++VY++  YHKQTKNQWARDDPAF+VI S +
Sbjct  80    PLFLRRLFRFPHMDFQFALWQMVYLCISPRIVYRNIHYHKQTKNQWARDDPAFMVILSGV  139

Query  832   LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVV  653
             L CS +A+   Y H     + +++ ++   F+V G V++T CW + N +L     S +  
Sbjct  140   LCCSAIAWGLVYGHGMMGILRMMLYMVFVDFVVIGVVVATICWTIANRFLARA--SVYST  197

Query  652   EQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYL  473
             EQ VEW YAFD+HCN+F P+  +LY++      +LV   +I  LL N L+MIA  YY Y+
Sbjct  198   EQSVEWQYAFDIHCNAFMPVIALLYIIQMVFMKVLVKDFWICSLLGNTLYMIAIVYYCYI  257

Query  472   NFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
              FLGY+ LPFL     FLYPI I +VL  + ++ G N S   + +YF 
Sbjct  258   TFLGYNALPFLRHPEMFLYPITIFVVLYVLALILGINVSAKVLAMYFG  305



>emb|CDX98085.1| BnaA06g08360D [Brassica napus]
Length=124

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -1

Query  1027  PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIV  848
              N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIV
Sbjct  17    ANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIV  76

Query  847   ICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCW  704
             ICSLLL  +TLAYCA YDHS  H V VVISV L HFL+TG +++TCCW
Sbjct  77    ICSLLLIVATLAYCATYDHSGSHAVVVVISVFLTHFLITGGLIATCCW  124



>gb|EPB86813.1| hypothetical protein HMPREF1544_06429 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=231

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 148/228 (65%), Gaps = 0/228 (0%)
 Frame = -1

Query  1012  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  833
             P  L R+V++ QMD E+  WQM +L  +P+ VY++  YHKQTKNQWARDDPAF+V+ + L
Sbjct  2     PLILTRLVRFTQMDFEFALWQMAYLLIAPRRVYRNIYYHKQTKNQWARDDPAFLVLLASL  61

Query  832   LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVV  653
             L+ S +A+   +       V  ++ ++L  F++ G++++TC WF TN +L +    +   
Sbjct  62    LSVSAIAWGLVFGLGFLGVVKAMLLMVLVDFVLVGSIVATCLWFFTNRFLNQSNAITQTN  121

Query  652   EQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYL  473
             +Q+VEW YAFDVHCNSFFP+F++LY+V +F   +L+ H +  L++SN +++I+  +Y Y 
Sbjct  122   DQKVEWAYAFDVHCNSFFPLFLILYIVQFFFLNLLIRHNWASLIISNSIYLISIVWYCYG  181

Query  472   NFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFS  329
              FLG++VLPFL  T   LYPI   +VL  +  + G N S   +  YF 
Sbjct  182   TFLGFNVLPFLVHTELLLYPIFGFLVLFIVLCVLGINLSENVVGFYFG  229



>ref|XP_008916126.1| hypothetical protein PPTG_19429 [Phytophthora parasitica INRA-310]
 gb|ETI48585.1| hypothetical protein F443_07402 [Phytophthora parasitica P1569]
 gb|ETK93917.1| hypothetical protein L915_02952 [Phytophthora parasitica]
 gb|ETM00411.1| hypothetical protein L917_02854 [Phytophthora parasitica]
 gb|ETM53612.1| hypothetical protein L914_02917 [Phytophthora parasitica]
 gb|ETM98584.1| hypothetical protein PPTG_19429 [Phytophthora parasitica INRA-310]
 gb|ETO82760.1| hypothetical protein F444_03127 [Phytophthora parasitica P1976]
 gb|ETP51864.1| hypothetical protein F442_03047 [Phytophthora parasitica P10297]
Length=291

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 147/241 (61%), Gaps = 13/241 (5%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA--------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  920
             ML +  L  R    A        R  S FP+Y  R++ ++QMD++ TF+QM+ LC  P  
Sbjct  23    MLSSDPLGSRQKKKAKRAGTDVFRSCSAFPEYFARVLDYRQMDLDATFYQMVTLCVQPAK  82

Query  919   VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFH  743
             VY+   Y KQTKN+WARDDPAF VI    L  +T+A+  A+   SA     ++   ++  
Sbjct  83    VYKSAYYRKQTKNRWARDDPAFAVIQFAFLLVATVAWAIAFRVDSAAKYASLLFHAVVIE  142

Query  742   FLVTGAVLSTCCWFLTNNYLREE----APSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYV  575
             +L  G V+ST CW++ N++LR+        +  VEQRVEW +AFD+HCNSFF +F+ LYV
Sbjct  143   WLGCGLVISTLCWWIANHHLRQRNNLGVGDALYVEQRVEWQFAFDIHCNSFFILFLFLYV  202

Query  574   VHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIV  395
             + + L+P+L ++ F+ LL+ NLL+ +   +Y Y+ FLGY  LPFL RT   L P+ +++ 
Sbjct  203   LQFLLAPLLASNSFVMLLVGNLLYSLGWGFYTYITFLGYMALPFLHRTEQLLLPVIVILA  262

Query  394   L  392
             L
Sbjct  263   L  263



>emb|CDR40017.1| CYFA0S04e01750g1_1 [Cyberlindnera fabianii]
Length=302

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 150/251 (60%), Gaps = 6/251 (2%)
 Frame = -1

Query  1066  TSSLKGRTS--SHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHK  893
             +S   GR+S  + +RP+   P  ++R  K   +D E   W++ +L  SPK VY+   YHK
Sbjct  53    SSRFPGRSSRFTASRPHFKIPILIKRFFKPPTLDFETAMWEIFYLIVSPKRVYKSLYYHK  112

Query  892   QTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLST  713
             QTKN+WARDDP+F+++ SL L  S +A+  AY       + +++ ++L  F +TG ++ST
Sbjct  113   QTKNRWARDDPSFVILLSLFLTLSAVAWGIAYSPGVTSILKLILYMVLVDFFLTGVIIST  172

Query  712   CCWFLTNNYLREEAPSSH---VVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVT  542
              CW L N + + +A       V E  +EW Y FDVHCNSF  +++ LY+V + L P+L  
Sbjct  173   ICWVLVNKFFKSKAAHDSIGAVSENDLEWAYCFDVHCNSFLVIWVALYMVQFILLPLLTM  232

Query  541   HGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
             + +I L L N L+ ++ SYY  + F GY+ LPFLE T   L+PIG++ V   +  L GFN
Sbjct  233   NNWIGLFLGNTLYFVSLSYYFVITFYGYNALPFLEHTQLILFPIGVLAVFY-VISLFGFN  291

Query  361   PSRYFMNIYFS  329
              ++   N YF+
Sbjct  292   VAKTMTNTYFT  302



>gb|ACU18710.1| unknown [Glycine max]
Length=131

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 108/128 (84%), Gaps = 8/128 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA------RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  917
             MLPT+S KGR+SS +      RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKVV
Sbjct  1     MLPTAS-KGRSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKVV  59

Query  916   YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
             YQHTKYHKQTKNQWARDDPAF+VIC LLLA +TLAYCAAYDHS  HT+ V+ SVLLFHFL
Sbjct  60    YQHTKYHKQTKNQWARDDPAFVVICYLLLAVATLAYCAAYDHSTAHTLLVIFSVLLFHFL  119

Query  736   VTGAVLST  713
             +TG  L+T
Sbjct  120   LTGVFLAT  127



>emb|CDS07641.1| hypothetical protein LRAMOSA01590 [Absidia idahoensis var. thermophila]
Length=216

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 140/218 (64%), Gaps = 6/218 (3%)
 Frame = -1

Query  976  MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY  797
            MD E+  WQM +L  +P+ VY++  YHKQTKNQWARDDPAF+V+ + LL  S +A+  AY
Sbjct  1    MDFEFALWQMAYLLIAPRRVYRNIYYHKQTKNQWARDDPAFLVLLASLLCVSAVAWGLAY  60

Query  796  DHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDV  617
                   +  ++ ++L  FL+ G++ +T  WF++N  L  +   +H VEQ+VEW YAFDV
Sbjct  61   GLGMVGILRAMLFMVLVDFLLVGSLAATFTWFVSNRLLIMDT-MAHAVEQKVEWAYAFDV  119

Query  616  HCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLE  437
            HCNSFFP+F++ YV+ +F  P+L    +I L   N L+  AA +Y Y  FLG++ LPFL 
Sbjct  120  HCNSFFPVFLITYVLQFFFMPVLKHDNWISLFFGNTLYFCAAVWYIYGTFLGFNALPFLA  179

Query  436  RTTFFLYP--IGIVIVLSPIFILTGFNPSRYFMNIYFS  329
             T  FLYP  IG ++ ++ +F   GFN S+  + +YF 
Sbjct  180  HTELFLYPILIGTILYIASLF---GFNVSQNILTLYFG  214



>ref|XP_002899351.1| transmembrane protein, putative [Phytophthora infestans T30-4]
 gb|EEY62320.1| transmembrane protein, putative [Phytophthora infestans T30-4]
Length=291

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = -1

Query  1030  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  851
             R  S FP+Y  R++ ++QMD++ TF+QM+ LC  P  VY+   Y KQTKN+WARDDPAF 
Sbjct  46    RSCSAFPEYFARVLDYRQMDLDATFYQMVTLCVQPAKVYKSAYYRKQTKNRWARDDPAFA  105

Query  850   VICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREE  674
             VI    L  +TLA+  A+   SA     ++   ++  +L  G V+ST CW+  N++LR+ 
Sbjct  106   VIQFAFLLVATLAWAIAFRVDSAAKYASLLFHAVVVEWLGFGLVISTLCWWTANHHLRQR  165

Query  673   APSSH------VVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSN  512
               +SH       VEQRVEW +AFD+HCNSFF +F+ LYV+ + L+P+L ++ F+ LL+ N
Sbjct  166   --NSHGVGDALYVEQRVEWQFAFDIHCNSFFILFLFLYVLQFLLTPLLASNSFVVLLVGN  223

Query  511   LLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
             LL+ +   +Y Y+ FLGY  LPFL RT   L P+ +++ L
Sbjct  224   LLYSLGWGFYTYITFLGYMALPFLHRTEQLLLPLIVILAL  263



>ref|XP_009537820.1| hypothetical protein PHYSODRAFT_565867 [Phytophthora sojae]
 gb|EGZ07056.1| hypothetical protein PHYSODRAFT_565867 [Phytophthora sojae]
Length=295

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 138/213 (65%), Gaps = 21/213 (10%)
 Frame = -1

Query  1030  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  851
             R  S FP+Y  R+V ++QMD++ TF+QM+ LC  P  VY+   Y KQTKN+WARDDPAF 
Sbjct  50    RSCSAFPEYFARVVDYRQMDLDATFYQMVTLCVQPAKVYKSAYYRKQTKNRWARDDPAFA  109

Query  850   VICSLLLACSTLAYCAAY--DHSAGHTVFVVISVLLFHFLVT-----GAVLSTCCWFLTN  692
             VI    L  +T+A+  A+  D +A +      + LLFH +V      G V+ST CW++ N
Sbjct  110   VIQFAFLLVATVAWAIAFRVDSAAKY------ASLLFHAVVVEWIGFGLVISTLCWWIAN  163

Query  691   NYLREEAPSSH------VVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFI  530
             ++LR+   +SH       VEQRVEW +AFD+HCNSFF MF+ LYV+ + L+P+L +H F+
Sbjct  164   HHLRQR--NSHGMGDALYVEQRVEWQFAFDIHCNSFFIMFLFLYVLQFLLAPMLASHSFV  221

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERT  431
              LL  NLL+ +   +Y Y+ FLGY  LPFL RT
Sbjct  222   SLLFGNLLYSLGWGFYMYITFLGYMALPFLHRT  254



>ref|XP_011401270.1| Unc-50-like protein [Auxenochlorella protothecoides]
 gb|KFM28256.1| Unc-50-like protein [Auxenochlorella protothecoides]
Length=211

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 130/207 (63%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  MLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVF  770
            ML L  SPK  Y+HT YH+QTK+ WARDDPAF+V+ + ++A  T AYC A+    G ++ 
Sbjct  1    MLQLLISPKTAYRHTSYHRQTKDHWARDDPAFVVLLAGIIALITAAYCIAFGPGLGGSLL  60

Query  769  VVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMF  590
            ++++ ++  FL+ GA++S   W L   +L   +   H +EQR+E +YAFDVHCNS  P  
Sbjct  61   IILAAVIRDFLIVGALISLGGWLLATRFLYSPSGQEHAIEQRMELMYAFDVHCNSLLPWL  120

Query  589  IMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPI  410
            +++ V+   LSP+LV+  ++   +S  L++  AS Y Y+ FLGY VLP L  T   L P+
Sbjct  121  LIVNVLQLVLSPLLVSQSYLAAAVSCTLYVAGASSYLYITFLGYSVLPGLNHTVLLLLPV  180

Query  409  GIVIVLSPIFILTGFNPSRYFMNIYFS  329
            G + V  P+ IL  FNP+R  + +Y+ 
Sbjct  181  GAMAVALPLAILGRFNPTRTALWLYYG  207



>gb|EPB86721.1| hypothetical protein HMPREF1544_06507 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=257

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 151/246 (61%), Gaps = 3/246 (1%)
 Frame = -1

Query  1069  PTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQ  890
             P+SS      S  RP    P  LRR+ ++ QMD E+  WQM +L  +P+ VY++  YHKQ
Sbjct  15    PSSSASYYNQS-GRPRKGSPALLRRLFRFPQMDFEFALWQMGYLLIAPRRVYRNIYYHKQ  73

Query  889   TKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTC  710
             TKN+W+RDDPAFIV+ +  L  S +A+   Y       +  ++S+L   FL+ GA+++T 
Sbjct  74    TKNRWSRDDPAFIVLLATFLTLSAIAWGFTYHLGTYGIIKTILSMLCIDFLLFGAIIATF  133

Query  709   CWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFI  530
              W++ N +L +   +++ V Q+VEW YAFDVHCN+F P++++LYV+  F  P+++   +I
Sbjct  134   TWYICNKFLIQNI-NTYAVAQQVEWAYAFDVHCNAFIPVYLILYVIQLFFLPLILKENWI  192

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRY  350
              + + N ++ +A  +Y    FLG++ LPFL  T  FLYPI + I L  +  L GFN   Y
Sbjct  193   SMFIGNFMYCVALIWYMVGVFLGFNALPFLVHTELFLYPIALWIALF-VASLFGFNIPHY  251

Query  349   FMNIYF  332
              ++ YF
Sbjct  252   VLSHYF  257



>gb|EMS24311.1| UNC-50-like protein [Rhodosporidium toruloides NP11]
 emb|CDR41879.1| RHTO0S06e07404g1_1 [Rhodosporidium toruloides]
Length=256

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/256 (39%), Positives = 147/256 (57%), Gaps = 13/256 (5%)
 Frame = -1

Query  1075  MLPTSSL--KGRTSSHARPNSVFPQ--------YLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPTS     G+ +      + FP+        +LR++ +W Q+D E   WQM +LC +P
Sbjct  1     MLPTSRAPRNGQGAQFTSAGNGFPRIGNGGMKTWLRKLSRWPQLDFELAVWQMCYLCIAP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLL  749
             + VY++  YHKQTKN WARDDPA +++ +L L  S + +   Y H     TV  V S + 
Sbjct  61    RRVYRNVYYHKQTKNTWARDDPAMLLLITLCLFVSAILWSVLYAHYGIVDTVKTVFSFIF  120

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
              HF   G ++ST  W L+N +L   A   H  +Q+VEWLYAFD+H NSFFP+F+ LYV  
Sbjct  121   LHFFGLGLLISTSLWALSNRFL-THATHVHATDQKVEWLYAFDIHANSFFPLFLQLYVAQ  179

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
               L+P++    ++ L + N L++ A + Y Y+ +LGY+ LPFL R+   L+P+ I     
Sbjct  180   LLLAPVVTRSNWVCLWVGNTLYLAAFTQYAYVTYLGYNALPFLIRSELLLFPVAIFAAFY  239

Query  388   PIFILTGFNPSRYFMN  341
              I  L GFN S + + 
Sbjct  240   -IVSLLGFNVSYFVLK  254



>ref|XP_002112386.1| hypothetical protein TRIADDRAFT_24802 [Trichoplax adhaerens]
 gb|EDV24496.1| hypothetical protein TRIADDRAFT_24802 [Trichoplax adhaerens]
Length=241

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 143/231 (62%), Gaps = 3/231 (1%)
 Frame = -1

Query  1009  QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLL  830
             QY +R++K+++MD E+  WQML+LC SP+ VY++  Y  QTK+QWARDDPAF+V+ ++ L
Sbjct  13    QYFQRLIKFREMDFEFAMWQMLYLCVSPRKVYRNFHYRHQTKHQWARDDPAFLVLLAMAL  72

Query  829   ACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVE  650
               S++ +      +    V  +  V+    +  G  + T  WF+TN YL+E+   SH  E
Sbjct  73    CISSIGFAIVLKLNVLAFVKFLFWVIFIDCIGVGLAIGTLLWFITNKYLKEK--QSHGSE  130

Query  649   QRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHG-FIPLLLSNLLFMIAASYYHYL  473
             Q VEWLY+FDVH N+FFP+ I+L+VV     P+++    FI  L+ N L++IA  YY+Y+
Sbjct  131   QSVEWLYSFDVHLNAFFPLLIVLHVVQMIFMPVIIDQPYFISCLIGNSLWLIALIYYNYV  190

Query  472   NFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRYFMNIYFSRAL  320
              FLGY  LPFL+ T   LYP+   I++    ++ G+N  +  M  Y  R L
Sbjct  191   TFLGYSALPFLKNTVVILYPVLAFILIYIFSLIFGWNIGKSVMTFYRYRIL  241



>ref|XP_007197375.1| PREDICTED: protein unc-50 homolog [Balaenoptera acutorostrata 
scammoni]
Length=259

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/261 (38%), Positives = 156/261 (60%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     H     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDH----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              + +  G+N +R   + Y  R
Sbjct  237   GLSLALGWNFTRTLCSFYKYR  257



>gb|KDO25449.1| hypothetical protein SPRG_09392 [Saprolegnia parasitica CBS 223.65]
Length=380

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 141/229 (62%), Gaps = 8/229 (3%)
 Frame = -1

Query  1081  GNMLPTSSLKGRTSS---HARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  911
             G   PT   +G + +       +S  P+Y  R+V ++QMD+E T++QM+ LC +P  VY+
Sbjct  117   GAAFPTRPARGASGTLPLFRNCSSAVPEYFARMVDYRQMDLEATYYQMVTLCIAPSKVYK  176

Query  910   HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVT  731
                Y KQTKN+WARDDPAF VI  L L  ++LA+  A++ ++    F++I  ++  +LV 
Sbjct  177   SAYYRKQTKNRWARDDPAFAVIQVLFLFVASLAWTVAFEKTSSLG-FLLICDVIVEWLVL  235

Query  730   GAVLSTCCWFLTNNYLREEAPS----SHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYF  563
             G +LST  W+  N +LR   P     +  VEQ VEW YAFD+HCN FF +F++++VV + 
Sbjct  236   GVLLSTASWWCANTFLRLSPPGIASDTFFVEQSVEWQYAFDIHCNGFFVLFLLIHVVQFL  295

Query  562   LSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLY  416
             L P+LV   F+ L ++N L+ +A   Y Y+ FLGY  LPFL  T  FLY
Sbjct  296   LVPLLVADTFVSLFIANTLYALACGSYFYITFLGYMALPFLHNTERFLY  344



>ref|NP_001146770.1| uncharacterized protein LOC100280372 [Zea mays]
 gb|ACL54712.1| unknown [Zea mays]
 tpg|DAA60646.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=123

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             MLPT++ KGR +S + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1     MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+  HFL  G VL+
Sbjct  60    KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVFLHFLFAGIVLA  119

Query  715   TCCW  704
             T CW
Sbjct  120   TLCW  123



>emb|CDS07387.1| hypothetical protein LRAMOSA01336 [Absidia idahoensis var. thermophila]
Length=259

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 153/260 (59%), Gaps = 12/260 (5%)
 Frame = -1

Query  1078  NMLPTSSLKGRTS---------SHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             ++LPT++   R +          + R  S  P  ++R+V W QMD +   WQM +L  +P
Sbjct  2     SLLPTTNTFTRNTPPSWSSQPHKYGRSFSSRPLIIQRLVHWTQMDFDVAIWQMAYLLIAP  61

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             K VY++  YHKQTKNQWARDDPAF V+ + L+A S  A+   Y     + ++    ++L 
Sbjct  62    KRVYRNVYYHKQTKNQWARDDPAFFVLLTGLMAISGAAWAVVYGKGWWNVLYTSAFMVLV  121

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHY  566
              FL+ G++++T  W++TN +L+     S+ V+Q VEW YAFDVHCN++ P F++LY++ +
Sbjct  122   DFLLIGSLVATVTWWITNRFLKFNR-MSYAVDQNVEWAYAFDVHCNAYIPFFLILYILQF  180

Query  565   FLSPIL-VTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             F  P+L     +I L + N ++  A  +Y Y  F+G+  LPFL  T  F+YP  +V  L 
Sbjct  181   FFLPLLRANSNWIALFVGNTMYFCAIVWYMYGIFIGFKALPFLVHTEIFVYPSLLVFALY  240

Query  388   PIFILTGFNPSRYFMNIYFS  329
              I  L G+N S++ +  YF 
Sbjct  241   -IASLFGYNISQHVLGFYFG  259



>ref|XP_008844068.1| PREDICTED: protein unc-50 homolog [Nannospalax galili]
 ref|XP_008844069.1| PREDICTED: protein unc-50 homolog [Nannospalax galili]
Length=259

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 149/242 (62%), Gaps = 5/242 (2%)
 Frame = -1

Query  1084  TGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  905
             + +ML    L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++ 
Sbjct  8     SSSMLGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNF  67

Query  904   KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGA  725
              Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G 
Sbjct  68    HYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGL  127

Query  724   VLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPIL  548
             ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ ++
Sbjct  128   LISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVI  183

Query  547   VTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTG  368
             +T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G
Sbjct  184   LTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYALSLALG  243

Query  367   FN  362
             +N
Sbjct  244   WN  245



>ref|XP_007501158.1| PREDICTED: protein unc-50 homolog isoform X2 [Monodelphis domestica]
Length=259

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 150/249 (60%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R   +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSMNSRIQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINYVIMTDTFIGYFVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>gb|EFA81996.1| UNC-50 family protein [Polysphondylium pallidum PN500]
Length=211

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 127/181 (70%), Gaps = 5/181 (3%)
 Frame = -1

Query  1081  GNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTK  902
             G    ++SL G +  + R   + P+Y RRI  + QMDIEYTFW M +LC +P  VY++T 
Sbjct  4     GVTRTSTSLHGDSVRYKR---IVPEYFRRIFHYPQMDIEYTFWIMFYLCFNPARVYRNTS  60

Query  901   YHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLLFHFLVTGA  725
             +HKQTKNQWARDDPAF+VI    ++ ++++Y  A+ + S  H +  +   + F F+  G 
Sbjct  61    WHKQTKNQWARDDPAFVVILVFFMSIASMSYAIAFHYLSILHIIKTMFWAVFFDFITVGL  120

Query  724   VLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILV  545
             V++T  W+++N++LRE A   H V+Q+VEWLYAFD+HCNSFFP+FI+LYV+H+FL P+ +
Sbjct  121   VVATAGWWISNHFLRESA-HHHSVDQKVEWLYAFDIHCNSFFPLFIILYVIHFFLLPVFM  179

Query  544   T  542
             +
Sbjct  180   S  180



>ref|NP_620274.1| protein unc-50 homolog [Rattus norvegicus]
 ref|XP_006244798.1| PREDICTED: protein unc-50 homolog isoform X1 [Rattus norvegicus]
 ref|XP_006244799.1| PREDICTED: protein unc-50 homolog isoform X1 [Rattus norvegicus]
 sp|O55227.1|UNC50_RAT RecName: Full=Protein unc-50 homolog; AltName: Full=Uncoordinated-like 
protein [Rattus norvegicus]
 gb|AAB93932.1| unc-50 related protein [Rattus norvegicus]
 gb|AAK08985.1| UNC50 [Rattus norvegicus]
 gb|AAH61976.1| Unc-50 homolog (C. elegans) [Rattus norvegicus]
 gb|EDL99237.1| unc-50 homolog (C. elegans), isoform CRA_a [Rattus norvegicus]
 gb|EDL99238.1| unc-50 homolog (C. elegans), isoform CRA_a [Rattus norvegicus]
 gb|EDL99239.1| unc-50 homolog (C. elegans), isoform CRA_a [Rattus norvegicus]
Length=259

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/240 (39%), Positives = 148/240 (62%), Gaps = 5/240 (2%)
 Frame = -1

Query  1078  NMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             +M    +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y
Sbjct  10    SMYGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHY  69

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
              KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++
Sbjct  70    RKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLI  129

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVT  542
             ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T
Sbjct  130   STLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILT  185

Query  541   HGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
               FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +IVL  + +  G+N
Sbjct  186   DTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVVLLYPFAPLIVLYGLSLALGWN  245



>ref|XP_008978360.1| PREDICTED: protein unc-50 homolog isoform X2 [Callithrix jacchus]
Length=266

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/253 (37%), Positives = 153/253 (60%), Gaps = 15/253 (6%)
 Frame = -1

Query  1087  STGNMLPTSSLKG----------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHL  938
              +G MLP++SL            R ++     +   +YLRR+ +++QMD E+  WQML+L
Sbjct  4     GSGKMLPSTSLNSSVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYL  63

Query  937   CTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVIS  758
              TSP+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ 
Sbjct  64    FTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLW  123

Query  757   VLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLY  578
             V+    +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+
Sbjct  124   VVFIDCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILH  179

Query  577   VVH-YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIV  401
              +  +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +
Sbjct  180   FIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPL  239

Query  400   IVLSPIFILTGFN  362
             I+L  + +  G+N
Sbjct  240   ILLYGLSLALGWN  252



>ref|XP_005359995.1| PREDICTED: protein unc-50 homolog [Microtus ochrogaster]
Length=259

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 149/242 (62%), Gaps = 5/242 (2%)
 Frame = -1

Query  1084  TGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  905
             + +M     L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++ 
Sbjct  8     SSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNF  67

Query  904   KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGA  725
              Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G 
Sbjct  68    HYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGL  127

Query  724   VLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPIL  548
             ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ ++
Sbjct  128   LISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVI  183

Query  547   VTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTG  368
             +T  FI  L+ N L++IA  YY Y+ FLGY  LPFL++T   LYP   ++VL  + +  G
Sbjct  184   LTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKKTVILLYPFAPLVVLYGLSLALG  243

Query  367   FN  362
             +N
Sbjct  244   WN  245



>ref|XP_006177666.1| PREDICTED: protein unc-50 homolog [Camelus ferus]
 ref|XP_010957354.1| PREDICTED: protein unc-50 homolog [Camelus bactrianus]
 ref|XP_010990981.1| PREDICTED: protein unc-50 homolog [Camelus dromedarius]
Length=259

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/248 (38%), Positives = 151/248 (61%), Gaps = 5/248 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14    NGALSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74    KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +     +     VEW YAFDVH N+F+P+ I+L+ +  +F++ +++T  FI
Sbjct  134   WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLIILHFIQLFFINHVILTDTFI  189

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRY  350
               L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+N +R 
Sbjct  190   GYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTRA  249

Query  349   FMNIYFSR  326
               + Y  R
Sbjct  250   LCSFYKYR  257



>ref|XP_009664646.1| PREDICTED: protein unc-50 homolog [Struthio camelus australis]
 gb|KFV76637.1| Protein unc-50 [Struthio camelus australis]
Length=259

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R   +   NS             +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRNQGNGALNSRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLAFGWNFTKMLCSFYKYR  257



>ref|XP_006203938.1| PREDICTED: protein unc-50 homolog [Vicugna pacos]
Length=259

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/248 (38%), Positives = 151/248 (61%), Gaps = 5/248 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14    NGALSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74    KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T  FI
Sbjct  134   WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFI  189

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSRY  350
               L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+N +R 
Sbjct  190   GYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTRA  249

Query  349   FMNIYFSR  326
               + Y  R
Sbjct  250   LCSFYKYR  257



>ref|XP_004369383.1| PREDICTED: protein unc-50 homolog [Trichechus manatus latirostris]
Length=259

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 147/240 (61%), Gaps = 5/240 (2%)
 Frame = -1

Query  1078  NMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  899
             +M    +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y
Sbjct  10    HMQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHY  69

Query  898   HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVL  719
              KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++
Sbjct  70    RKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCIGVGLLI  129

Query  718   STCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVT  542
             ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T
Sbjct  130   STLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINYVILT  185

Query  541   HGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
               FI   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   VI+L  + +  G+N
Sbjct  186   DTFIGYFVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPVILLYGLSLALGWN  245



>ref|XP_005339664.1| PREDICTED: protein unc-50 homolog isoform X1 [Ictidomys tridecemlineatus]
 ref|XP_005339665.1| PREDICTED: protein unc-50 homolog isoform X2 [Ictidomys tridecemlineatus]
Length=259

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 156/261 (60%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +        +  VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSR----DCDVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              + +  G+N +R   + Y  R
Sbjct  237   GLSLALGWNFTRALCSFYKYR  257



>emb|CAB45714.1| hypothetical protein [Homo sapiens]
 gb|AAK08987.1| UNC50 [Homo sapiens]
 emb|CAG38495.1| UNC50 [Homo sapiens]
Length=259

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 153/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L 
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+++  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHLIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_003794391.1| PREDICTED: protein unc-50 homolog [Otolemur garnettii]
Length=259

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSMNSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ I++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHIILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_005400780.1| PREDICTED: protein unc-50 homolog isoform X1 [Chinchilla lanigera]
Length=261

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 151/250 (60%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  2     KMLPSTSVNSSVHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  61

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  STL +    D     T+ +++ V+ 
Sbjct  62    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTLGFGFVLDMGFFETIKLLLWVVF  121

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  122   IDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  177

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L
Sbjct  178   LFFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILL  237

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  238   FGLSLALGWN  247



>ref|XP_005075445.1| PREDICTED: protein unc-50 homolog [Mesocricetus auratus]
Length=259

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 153/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPT----SSLKG------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP+    SSL+G      R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVSSSLQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   ++VL 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLVVLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_006980507.1| PREDICTED: protein unc-50 homolog [Peromyscus maniculatus bairdii]
Length=259

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVGSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCIGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   ++VL 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKSTVILLYPFAPLVVLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_005400781.1| PREDICTED: protein unc-50 homolog isoform X2 [Chinchilla lanigera]
Length=259

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSVHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  STL +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTLGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLF  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_002611641.1| hypothetical protein BRAFLDRAFT_63694 [Branchiostoma floridae]
 gb|EEN67651.1| hypothetical protein BRAFLDRAFT_63694 [Branchiostoma floridae]
Length=243

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 149/246 (61%), Gaps = 11/246 (4%)
 Frame = -1

Query  1057  LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQ  878
             L+ R ++ A+      +YLRRI+K++QMD E+  WQML+LC +P+ VY++  Y KQTK+Q
Sbjct  2     LEARHTAGAKRY----KYLRRILKFRQMDFEFALWQMLYLCVAPQRVYRNFHYRKQTKDQ  57

Query  877   WARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCCWFL  698
             WARDDPAF+V+ S  L  S+L +      S    + +++ V+    +  G +++T  WF+
Sbjct  58    WARDDPAFLVLLSFWLCASSLGFAIVLQLSIMGMIKLLLWVIFVDCIGVGLMVATLLWFV  117

Query  697   TNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFIPLL  521
              N YL+ +       +Q VEW YAFDVH N+FFP+ I+L+V+  +F+ P++    F+  L
Sbjct  118   ANKYLQTQKS-----DQEVEWGYAFDVHLNAFFPLLIILHVIQLFFIHPLIDKEWFMSRL  172

Query  520   LSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFIL-TGFNPSRYFM  344
               N L++IA  YY Y+ FLGY  LPFL  T   LYP  ++I+   I  L  G+N ++  M
Sbjct  173   FGNTLWLIALGYYLYITFLGYSSLPFLRHTVVLLYPAMLIILTFYIVSLPVGWNFTQGLM  232

Query  343   NIYFSR  326
               Y  R
Sbjct  233   WFYRYR  238



>ref|XP_009055533.1| hypothetical protein LOTGIDRAFT_153387 [Lottia gigantea]
 gb|ESO93914.1| hypothetical protein LOTGIDRAFT_153387 [Lottia gigantea]
Length=251

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 147/251 (59%), Gaps = 8/251 (3%)
 Frame = -1

Query  1060  SLKGRTSSH-AR--PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQ  890
             S  G +S H AR    S   +Y +R++K++QMD EY FWQM++L  SP+ VY++ +Y K 
Sbjct  5     SQNGSSSKHDARLTATSKRQKYFKRLLKFKQMDFEYAFWQMIYLFVSPQKVYRNFQYRKH  64

Query  889   TKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTC  710
             TK+QWARDDPAF+V+ S  L  S++ +           V  +I V+    +  G V++T 
Sbjct  65    TKDQWARDDPAFLVLLSFWLVVSSIGFAVVLRLHFFAFVKFIIWVIFVDCIGVGIVIATI  124

Query  709   CWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGF  533
              W +TN Y+    P      Q VEW YAFDVH N+FFP+ ++L++   +FL+  +   GF
Sbjct  125   LWLITNRYMISAPPRG----QDVEWGYAFDVHLNAFFPLLMILHLFQLFFLNHFIAIDGF  180

Query  532   IPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFNPSR  353
              P L  N L++IA  YY Y+ FLGY  LPFL+ T   LYPI  ++++  + ++  +N SR
Sbjct  181   FPRLFGNSLWLIALGYYIYITFLGYSALPFLKNTRTLLYPITALLLVYTLSLILNWNFSR  240

Query  352   YFMNIYFSRAL  320
                N Y  R L
Sbjct  241   GLSNFYSFRVL  251



>ref|XP_006166648.1| PREDICTED: protein unc-50 homolog [Tupaia chinensis]
Length=259

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSMGSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_002811726.1| PREDICTED: protein unc-50 homolog [Pongo abelii]
 ref|XP_002811727.1| PREDICTED: protein unc-50 homolog [Pongo abelii]
 ref|XP_003279280.1| PREDICTED: protein unc-50 homolog isoform 1 [Nomascus leucogenys]
Length=259

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 152/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L 
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_004669848.1| PREDICTED: protein unc-50 homolog [Jaculus jaculus]
Length=259

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +        +  VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSR----DSDVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|NP_054763.2| protein unc-50 homolog [Homo sapiens]
 ref|XP_001158336.1| PREDICTED: protein unc-50 homolog [Pan troglodytes]
 ref|XP_004031523.1| PREDICTED: protein unc-50 homolog isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004031524.1| PREDICTED: protein unc-50 homolog isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_008977043.1| PREDICTED: protein unc-50 homolog [Pan paniscus]
 ref|XP_008977048.1| PREDICTED: protein unc-50 homolog [Pan paniscus]
 ref|XP_009441222.1| PREDICTED: protein unc-50 homolog [Pan troglodytes]
 sp|Q53HI1.2|UNC50_HUMAN RecName: Full=Protein unc-50 homolog; AltName: Full=Periodontal 
ligament-specific protein 22; Short=PDLs22; AltName: Full=Protein 
GMH1 homolog; Short=hGMH1; AltName: Full=Uncoordinated-like 
protein [Homo sapiens]
 gb|AAD27771.1|AF077038_1 unc-50 related protein homolog [Homo sapiens]
 gb|AAH17019.1| UNC50 protein [Homo sapiens]
 gb|AAH25992.1| Unc-50 homolog (C. elegans) [Homo sapiens]
 gb|AAH91481.1| UNC50 protein [Homo sapiens]
 gb|EAX01900.1| unc-50 homolog (C. elegans), isoform CRA_a [Homo sapiens]
 gb|EAX01901.1| unc-50 homolog (C. elegans), isoform CRA_a [Homo sapiens]
 gb|EAX01902.1| unc-50 homolog (C. elegans), isoform CRA_a [Homo sapiens]
 gb|ADQ31836.1| unc-50 homolog (C. elegans) [synthetic construct]
 gb|AIC51084.1| UNC50, partial [synthetic construct]
Length=259

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 152/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L 
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>gb|KFP47788.1| Protein unc-50 [Cathartes aura]
Length=259

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++IVL 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIVLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_006870815.1| PREDICTED: protein unc-50 homolog [Chrysochloris asiatica]
Length=259

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 149/249 (60%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP+ S+  R   +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSISVNSRVQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAGWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +        +  VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSR----DSDVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYCIGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_004315896.1| PREDICTED: protein unc-50 homolog isoform 1 [Tursiops truncatus]
Length=273

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 151/250 (60%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  14    KMLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  73

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+ 
Sbjct  74    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVF  133

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  134   IDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  189

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L
Sbjct  190   LFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILL  249

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  250   YGLSLALGWN  259



>ref|XP_004315897.1| PREDICTED: protein unc-50 homolog isoform 2 [Tursiops truncatus]
Length=259

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>gb|EDL14524.1| unc-50 homolog (C. elegans), isoform CRA_b, partial [Mus musculus]
Length=268

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 151/250 (60%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSSL----------KGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++SL            R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  9     KMLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  68

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+ 
Sbjct  69    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVF  128

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  129   IDCVGVGLLISTLMWFVSNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  184

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   ++VL
Sbjct  185   LFFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLMVL  244

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  245   YGLSLALGWN  254



>ref|XP_004594279.1| PREDICTED: protein unc-50 homolog [Ochotona princeps]
Length=259

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 150/246 (61%), Gaps = 11/246 (4%)
 Frame = -1

Query  1078  NMLPTSSLKG------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  917
             N L T+S  G      R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ V
Sbjct  4     NTLVTASAHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRV  63

Query  916   YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
             Y++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +
Sbjct  64    YRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFLETIKLLLWVVFIDCV  123

Query  736   VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFL  560
               G +++T  WF++N YL +        E  VEW YAFDVH N+F+P+ ++L+ +  +F+
Sbjct  124   GVGLLIATLMWFISNKYLVKRQSR----EYDVEWGYAFDVHLNAFYPLLVILHFIQLFFI  179

Query  559   SPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIF  380
             + +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + 
Sbjct  180   NHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKSTVVLLYPFAPLILLYALS  239

Query  379   ILTGFN  362
             I  G+N
Sbjct  240   IALGWN  245



>ref|XP_003124957.1| PREDICTED: protein unc-50 homolog isoform 2 [Sus scrofa]
 ref|XP_003124956.1| PREDICTED: protein unc-50 homolog isoform 1 [Sus scrofa]
Length=259

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 149/243 (61%), Gaps = 9/243 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             S GN     +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  11    SQGN----GALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  66

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67    FHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPI  551
              ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +
Sbjct  127   LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHV  182

Query  550   LVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILT  371
             ++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  
Sbjct  183   ILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLAL  242

Query  370   GFN  362
             G+N
Sbjct  243   GWN  245



>ref|XP_007109670.1| PREDICTED: protein unc-50 homolog isoform X2 [Physeter catodon]
Length=259

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTVGFGFVLDMGFLETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_003765692.1| PREDICTED: protein unc-50 homolog [Sarcophilus harrisii]
Length=358

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/253 (38%), Positives = 151/253 (60%), Gaps = 15/253 (6%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHL  938
              +  MLPT+S+  R   +   NS             +YLRR+ +++QMD E+  WQML+L
Sbjct  96    GSRKMLPTTSMNSRLQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYL  155

Query  937   CTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVIS  758
              TSP+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ 
Sbjct  156   FTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLW  215

Query  757   VLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLY  578
             V+    +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+
Sbjct  216   VVFIDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILH  271

Query  577   VVH-YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIV  401
              +  +F++ +++T  FI   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +
Sbjct  272   FIQLFFINYVIMTDTFIGYFVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPL  331

Query  400   IVLSPIFILTGFN  362
             I+L  + +  G+N
Sbjct  332   ILLYGLSLALGWN  344



>ref|XP_004277814.1| PREDICTED: protein unc-50 homolog isoform 2 [Orcinus orca]
Length=259

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVVLLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_004615859.1| PREDICTED: protein unc-50 homolog [Sorex araneus]
Length=259

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/236 (39%), Positives = 146/236 (62%), Gaps = 5/236 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               +L  R ++     +   +YLRR+ + +QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14    NGALSSRDAARHTAGAKRSKYLRRLFRLRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74    KDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCIGVGLLISTLM  133

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +        E  VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T  FI
Sbjct  134   WFVSNKYLVKRQSR----ECDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFI  189

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
               L+ N L+++A  YY Y+ FLGY  LPFL++T   LYP   +I+L  + +  G+N
Sbjct  190   GYLVGNTLWLVAVGYYIYVTFLGYSALPFLKKTVTLLYPFAPLILLYGLSLALGWN  245



>ref|NP_080399.1| protein unc-50 homolog [Mus musculus]
 ref|XP_006496283.1| PREDICTED: protein unc-50 homolog isoform X1 [Mus musculus]
 ref|XP_006496284.1| PREDICTED: protein unc-50 homolog isoform X1 [Mus musculus]
 ref|XP_006496285.1| PREDICTED: protein unc-50 homolog isoform X1 [Mus musculus]
 ref|XP_006496286.1| PREDICTED: protein unc-50 homolog isoform X1 [Mus musculus]
 sp|Q9CQ61.1|UNC50_MOUSE RecName: Full=Protein unc-50 homolog; AltName: Full=Periodontal 
ligament-specific protein 22; Short=PDLs22 [Mus musculus]
 dbj|BAB22683.1| unnamed protein product [Mus musculus]
 dbj|BAB23302.1| unnamed protein product [Mus musculus]
 gb|AAH19484.1| Unc-50 homolog (C. elegans) [Mus musculus]
 gb|AAK08986.1| UNC50 [Mus musculus]
 dbj|BAE22715.1| unnamed protein product [Mus musculus]
 dbj|BAE21338.1| unnamed protein product [Mus musculus]
 gb|EDL14523.1| unc-50 homolog (C. elegans), isoform CRA_a [Mus musculus]
Length=259

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSSL----------KGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++SL            R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFVSNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   ++VL 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLMVLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_004277813.1| PREDICTED: protein unc-50 homolog isoform 1 [Orcinus orca]
Length=273

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 151/250 (60%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  14    KMLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  73

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+ 
Sbjct  74    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVF  133

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  134   IDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  189

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L
Sbjct  190   LFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVVLLYPFAPLILL  249

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  250   YGLSLALGWN  259



>gb|KFZ63733.1| Protein unc-50 [Podiceps cristatus]
Length=258

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDLGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++IVL 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIVLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_007615954.1| PREDICTED: protein unc-50 homolog isoform X3 [Cricetulus griseus]
 gb|ERE92692.1| putative protein unc-50 like protein [Cricetulus griseus]
Length=259

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 147/242 (61%), Gaps = 5/242 (2%)
 Frame = -1

Query  1084  TGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  905
             + +M     L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++ 
Sbjct  8     SSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNF  67

Query  904   KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGA  725
              Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G 
Sbjct  68    HYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGL  127

Query  724   VLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPIL  548
             ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ ++
Sbjct  128   LISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVI  183

Query  547   VTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTG  368
             +T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   + VL  + +  G
Sbjct  184   LTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLAVLYGLSLALG  243

Query  367   FN  362
             +N
Sbjct  244   WN  245



>dbj|GAN07871.1| UNC-50-like protein [Mucor ambiguus]
Length=276

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 153/265 (58%), Gaps = 21/265 (8%)
 Frame = -1

Query  1069  PTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQ  890
             P+SS     +   R     P  LRR+ ++ QMD E+  WQM +L  +P+ VY++  YHKQ
Sbjct  14    PSSSSASYYNQSGRSRKGSPALLRRLFRFPQMDFEFAVWQMGYLLIAPRRVYRNIYYHKQ  73

Query  889   TKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTC  710
             TKN+W+RDDPAFIVI +  L  S + +   Y       +  ++S+L   FL+ GA++ST 
Sbjct  74    TKNRWSRDDPAFIVILAAFLTLSGIVWGFTYHLGTYGIIKTILSMLCIDFLLFGAMISTF  133

Query  709   CWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFI  530
              W+++N +L + A +++ V Q+VEW YAFDVHCN+F P++++LYV+  F  P+++   +I
Sbjct  134   TWYISNKFLIQNA-NTYAVAQQVEWAYAFDVHCNAFIPVYLILYVIQLFFLPLILKENWI  192

Query  529   PLLLSNLLFMIAASYYH---YLNFLGYDV----------------LPFLERTTFFLYPIG  407
              + + N ++ +A  +Y    +L F G DV                LPFL  T  FLYPI 
Sbjct  193   SMFIGNFMYCVALIWYMVGVFLGFNGKDVPAASWVSKLTLKHIVALPFLVHTELFLYPIA  252

Query  406   IVIVLSPIFILTGFNPSRYFMNIYF  332
             + I L  +  L GFN  +Y ++ YF
Sbjct  253   LWIALF-VASLFGFNIPQYVLSHYF  276



>ref|XP_006879434.1| PREDICTED: protein unc-50 homolog [Elephantulus edwardii]
Length=259

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/236 (39%), Positives = 145/236 (61%), Gaps = 5/236 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14    NGTLNPRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74    KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCIGVGLLISTLM  133

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ ++VT  FI
Sbjct  134   WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVIVTDTFI  189

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
                + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+N
Sbjct  190   GYFIGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWN  245



>ref|XP_003413641.1| PREDICTED: protein unc-50 homolog [Loxodonta africana]
Length=259

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/243 (39%), Positives = 150/243 (62%), Gaps = 9/243 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             + GN +  S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  11    AQGNGVLNSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  66

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67    FHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPI  551
              ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +
Sbjct  127   LLISTLMWFISNKYLVKRRSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHV  182

Query  550   LVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILT  371
             ++T+ FI   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   VI+L  + +  
Sbjct  183   ILTNTFIGYFIGNTLWLIAIGYYIYVTFLGYSALPFLKNTVILLYPFAPVILLYGLSLAL  242

Query  370   GFN  362
             G+N
Sbjct  243   GWN  245



>ref|XP_005212372.1| PREDICTED: protein unc-50 homolog isoform X3 [Bos taurus]
 ref|XP_005909902.1| PREDICTED: protein unc-50 homolog isoform X2 [Bos mutus]
 ref|XP_010827920.1| PREDICTED: protein unc-50 homolog isoform X2 [Bison bison bison]
 sp|Q3ZBG6.1|UNC50_BOVIN RecName: Full=Protein unc-50 homolog [Bos taurus]
 gb|AAI03306.1| Unc-50 homolog (C. elegans) [Bos taurus]
Length=259

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 151/243 (62%), Gaps = 9/243 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  11    AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  66

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67    FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPI  551
              ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +
Sbjct  127   LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHV  182

Query  550   LVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILT  371
             ++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  
Sbjct  183   ILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLAL  242

Query  370   GFN  362
             G+N
Sbjct  243   GWN  245



>ref|XP_005977165.1| PREDICTED: protein unc-50 homolog [Pantholops hodgsonii]
Length=259

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 151/243 (62%), Gaps = 9/243 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  11    AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  66

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67    FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPI  551
              ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +
Sbjct  127   LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHV  182

Query  550   LVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILT  371
             ++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  
Sbjct  183   ILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLAL  242

Query  370   GFN  362
             G+N
Sbjct  243   GWN  245



>ref|XP_005263970.1| PREDICTED: protein unc-50 homolog isoform X2 [Homo sapiens]
Length=276

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 152/250 (61%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  17    KMLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  76

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L
Sbjct  77    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVL  136

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  137   IDCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  192

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L
Sbjct  193   LFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILL  252

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  253   YGLSLALGWN  262



>gb|ELR46035.1| Protein unc-50-like protein, partial [Bos mutus]
Length=264

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 151/243 (62%), Gaps = 9/243 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  16    AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  71

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  72    FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  131

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPI  551
              ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +
Sbjct  132   LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHV  187

Query  550   LVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILT  371
             ++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  
Sbjct  188   ILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLAL  247

Query  370   GFN  362
             G+N
Sbjct  248   GWN  250



>ref|XP_854439.1| PREDICTED: protein unc-50 homolog isoform X2 [Canis lupus familiaris]
 ref|XP_005626096.1| PREDICTED: protein unc-50 homolog isoform X1 [Canis lupus familiaris]
Length=263

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>emb|CDH60549.1| unc-50-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=259

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 152/259 (59%), Gaps = 11/259 (4%)
 Frame = -1

Query  1078  NMLPTSSLKGR--------TSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  923
             ++LPT++   R        +  + R  S  P  ++R++ W QMD +   WQM +L  +PK
Sbjct  3     SLLPTTNTFTRNNPSWNPHSQKYGRSFSSRPLIVQRLLHWTQMDFDVALWQMAYLLIAPK  62

Query  922   VVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFH  743
              VY++  YHKQTKNQWARDDPAF V+ + LLA S  A+   +       ++    ++L  
Sbjct  63    RVYRNVYYHKQTKNQWARDDPAFFVLLTGLLAISGTAWAVVFGKGWWGILYTSAFMVLID  122

Query  742   FLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYF  563
             FL+ G++++T  W++TN +L+     S+ V+Q VEW YAFDVHCN++ P F++LY++ +F
Sbjct  123   FLLVGSLVATFTWWITNRFLKFNR-MSYAVDQNVEWAYAFDVHCNAYIPFFLILYILQFF  181

Query  562   LSPIL-VTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSP  386
               P+L  +  +I L + N ++  A  +Y Y  F+G+  LPFL  T  F+YP  +V  L  
Sbjct  182   FLPLLRASSNWIALFVGNTMYFCAIVWYMYGVFIGFKALPFLVHTEIFVYPTLLVFALY-  240

Query  385   IFILTGFNPSRYFMNIYFS  329
             I  L G+N  ++ +  YF 
Sbjct  241   IASLFGYNICQHVLGFYFG  259



>ref|XP_010641529.1| PREDICTED: protein unc-50 homolog [Fukomys damarensis]
 gb|KFO25167.1| Protein unc-50 like protein [Fukomys damarensis]
Length=259

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSSLKG----------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++SL            R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSLNSSVHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLTLGWN  245



>ref|XP_001363404.2| PREDICTED: protein unc-50 homolog isoform X1 [Monodelphis domestica]
Length=358

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/253 (38%), Positives = 151/253 (60%), Gaps = 15/253 (6%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHL  938
              +  MLPT+S+  R   +   NS             +YLRR+ +++QMD E+  WQML+L
Sbjct  96    GSRKMLPTTSMNSRIQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYL  155

Query  937   CTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVIS  758
              TSP+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ 
Sbjct  156   FTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLW  215

Query  757   VLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLY  578
             V+    +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+
Sbjct  216   VVFIDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILH  271

Query  577   VVH-YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIV  401
              +  +F++ +++T  FI   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +
Sbjct  272   FIQLFFINYVIMTDTFIGYFVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPL  331

Query  400   IVLSPIFILTGFN  362
             I+L  + +  G+N
Sbjct  332   ILLYGLSLALGWN  344



>ref|XP_003471703.1| PREDICTED: protein unc-50 homolog isoform X1 [Cavia porcellus]
 ref|XP_005004494.1| PREDICTED: protein unc-50 homolog isoform X2 [Cavia porcellus]
Length=259

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 150/249 (60%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSMHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF+ N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFIANKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_003218830.1| PREDICTED: protein unc-50 homolog [Anolis carolinensis]
 ref|XP_003218831.1| PREDICTED: protein unc-50 homolog [Anolis carolinensis]
 ref|XP_008105286.1| PREDICTED: protein unc-50 homolog [Anolis carolinensis]
Length=259

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 151/252 (60%), Gaps = 15/252 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+SL  R   +   NS             +YLRR+  ++ MD E+  WQML+L TSP
Sbjct  1     MLPTTSLNSRDHGNESLNSREAARHTAGAKRYKYLRRLFHFRHMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             ++VY++ +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +      + G T+ +++ V+  
Sbjct  61    QMVYRNFQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLGLAFGETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLTKHQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F+  +++   FI   + N  ++IA SYY Y+ FLGY  LPFL+ T   LYP  + I+L 
Sbjct  177   FFIHYVIMLDSFIGYFIGNTFWLIAISYYIYVTFLGYSALPFLKNTVVLLYPFALHILLY  236

Query  388   PIFILTGFNPSR  353
              + +  G+N ++
Sbjct  237   VVSLAMGWNFTK  248



>ref|XP_002710038.1| PREDICTED: protein unc-50 homolog [Oryctolagus cuniculus]
 ref|XP_008251784.1| PREDICTED: protein unc-50 homolog [Oryctolagus cuniculus]
Length=259

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVHASAHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKSTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_009321854.1| PREDICTED: protein unc-50 homolog [Pygoscelis adeliae]
 gb|KFW61216.1| Protein unc-50 [Pygoscelis adeliae]
Length=259

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCASTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCIGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYVYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_009694201.1| PREDICTED: protein unc-50 homolog [Cariama cristata]
 gb|KFP55291.1| Protein unc-50 [Cariama cristata]
Length=259

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 156/261 (60%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +   +S             +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSSRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   +   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVVGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAVLLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_007383729.1| UNC-50-like protein [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN09032.1| UNC-50-like protein [Punctularia strigosozonata HHB-11173 SS5]
Length=262

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 147/259 (57%), Gaps = 11/259 (4%)
 Frame = -1

Query  1078  NMLPTSSLKGRTSSHARP----------NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
             ++LP +S  G  + HA P           S  P   +R+ + Q MD E   WQ+ +LC +
Sbjct  2     SILPVNSHPGSVNGHASPLQSHAPAWTAKSRVPLIFKRLTRIQSMDFELAAWQLTYLCIA  61

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             PK VY++  +HKQTKN WARDDPA +V+ S  LA + +A+   +    G  + +   ++L
Sbjct  62    PKRVYKNVYFHKQTKNTWARDDPAIMVLISACLAVAGIAWGIVWYSGIGAGIELASVMIL  121

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
               +L+ GA+++T  W ++N  L      S   + RVEW YAFDVH N+FFPMF+ LYV  
Sbjct  122   RDYLLVGAIMATILWAISNRLLLSPPSHSTPADSRVEWAYAFDVHTNAFFPMFLTLYVAQ  181

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
              FL P+++   ++ L + N L++IA + Y Y  + G   LPFL RT   L P+ + +  S
Sbjct  182   LFLVPVILRDRWVCLWVGNTLYLIAFTQYIYGVYSGLKALPFLIRTEILLSPL-LPLFAS  240

Query  388   PIFILTGFNPSRYFMNIYF  332
              I  L GF+ +++ +N YF
Sbjct  241   YIVSLVGFSVAKHVLNNYF  259



>ref|XP_004006198.1| PREDICTED: protein unc-50 homolog [Ovis aries]
 ref|XP_012029191.1| PREDICTED: protein unc-50 homolog [Ovis aries]
 ref|XP_012017321.1| PREDICTED: protein unc-50 homolog [Ovis aries musimon]
 ref|XP_012017322.1| PREDICTED: protein unc-50 homolog [Ovis aries musimon]
Length=259

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVTSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_009865405.1| PREDICTED: protein unc-50 homolog [Apaloderma vittatum]
Length=259

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 156/261 (60%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+ S+              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSLSNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_005228739.1| PREDICTED: protein unc-50 homolog [Falco peregrinus]
 ref|XP_005444796.1| PREDICTED: protein unc-50 homolog [Falco cherrug]
Length=259

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+SL  R+  +              +   +YLRR++ ++QMD E+  WQML+L  SP
Sbjct  1     MLPTTSLNSRSQGNGVLSPRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFVSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_008064240.1| PREDICTED: protein unc-50 homolog [Tarsius syrichta]
 ref|XP_008064241.1| PREDICTED: protein unc-50 homolog [Tarsius syrichta]
Length=259

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSAQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|NP_001014921.1| protein unc-50 homolog [Bos taurus]
 ref|XP_005909901.1| PREDICTED: protein unc-50 homolog isoform X1 [Bos mutus]
 ref|XP_010827919.1| PREDICTED: protein unc-50 homolog isoform X1 [Bison bison bison]
 gb|AAX09048.1| unc-50 homolog [Bos taurus]
 tpg|DAA24916.1| TPA: protein unc-50 homolog [Bos taurus]
Length=260

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/244 (39%), Positives = 152/244 (62%), Gaps = 10/244 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  11    AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  66

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67    FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSP-  554
              ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++P 
Sbjct  127   LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINPD  182

Query  553   ILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFIL  374
             +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + + 
Sbjct  183   VILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLA  242

Query  373   TGFN  362
              G+N
Sbjct  243   LGWN  246



>ref|XP_007957650.1| PREDICTED: protein unc-50 homolog [Orycteropus afer afer]
Length=259

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 145/236 (61%), Gaps = 5/236 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14    NGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74    KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T  FI
Sbjct  134   WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINYVILTDTFI  189

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
                + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+N
Sbjct  190   GYFIGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWN  245



>ref|XP_008978361.1| PREDICTED: protein unc-50 homolog isoform X3 [Callithrix jacchus]
Length=265

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 151/250 (60%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSSLKG----------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++SL            R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  6     KMLPSTSLNSSVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  65

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+ 
Sbjct  66    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVF  125

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  126   IDCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  181

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L
Sbjct  182   LFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILL  241

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  242   YGLSLALGWN  251



>ref|XP_004686209.1| PREDICTED: protein unc-50 homolog [Condylura cristata]
Length=256

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 150/246 (61%), Gaps = 12/246 (5%)
 Frame = -1

Query  1075  MLPTSSL-------KGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  917
             MLP++SL         R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ V
Sbjct  1     MLPSTSLGHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRV  60

Query  916   YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
             Y++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +
Sbjct  61    YRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCV  120

Query  736   VTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFL  560
               G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F+
Sbjct  121   GVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFI  176

Query  559   SPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIF  380
             + +++T  FI  LL N L+++A  YY Y+ FLGY  LP L+ T   LYP   +I+L  + 
Sbjct  177   NHVILTDTFIGYLLGNTLWLVAIGYYIYVTFLGYSALPVLKNTVILLYPFAPLILLYGLS  236

Query  379   ILTGFN  362
             +  G+N
Sbjct  237   LALGWN  242



>ref|XP_003983960.1| PREDICTED: protein unc-50 homolog [Felis catus]
 ref|XP_006930113.1| PREDICTED: protein unc-50 homolog [Felis catus]
 ref|XP_007097870.1| PREDICTED: protein unc-50 homolog [Panthera tigris altaica]
Length=259

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSPVQGNGVLNTRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_011811937.1| PREDICTED: protein unc-50 homolog isoform X1 [Colobus angolensis 
palliatus]
Length=259

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNASVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_010725972.1| PREDICTED: protein unc-50 homolog [Meleagris gallopavo]
Length=259

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR++  +QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVGARSQGNGALSPRDAARHTAGAKRHKYLRRLLHVRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++ +  I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++IVL 
Sbjct  177   FFINYVIIPNSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIVLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_005686328.1| PREDICTED: protein unc-50 homolog isoform X1 [Capra hircus]
 ref|XP_005686329.1| PREDICTED: protein unc-50 homolog isoform X2 [Capra hircus]
 ref|XP_005686330.1| PREDICTED: protein unc-50 homolog isoform X3 [Capra hircus]
 ref|XP_005686331.1| PREDICTED: protein unc-50 homolog isoform X4 [Capra hircus]
 ref|XP_005686332.1| PREDICTED: protein unc-50 homolog isoform X5 [Capra hircus]
 ref|XP_005686333.1| PREDICTED: protein unc-50 homolog isoform X6 [Capra hircus]
Length=259

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVTSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFVSNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_002757453.1| PREDICTED: protein unc-50 homolog isoform X1 [Callithrix jacchus]
 ref|XP_003941342.1| PREDICTED: protein unc-50 homolog isoform X1 [Saimiri boliviensis 
boliviensis]
 ref|XP_008978359.1| PREDICTED: protein unc-50 homolog isoform X1 [Callithrix jacchus]
 ref|XP_008978362.1| PREDICTED: protein unc-50 homolog isoform X1 [Callithrix jacchus]
 ref|XP_010350356.1| PREDICTED: protein unc-50 homolog isoform X1 [Saimiri boliviensis 
boliviensis]
Length=259

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSSLKG----------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++SL            R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSLNSSVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_009470844.1| PREDICTED: protein unc-50 homolog [Nipponia nippon]
 ref|XP_009816620.1| PREDICTED: protein unc-50 homolog [Gavia stellata]
 ref|XP_009881397.1| PREDICTED: protein unc-50 homolog [Charadrius vociferus]
 ref|XP_009923831.1| PREDICTED: protein unc-50 homolog [Haliaeetus albicilla]
 ref|XP_009945923.1| PREDICTED: protein unc-50 homolog [Leptosomus discolor]
 ref|XP_010192222.1| PREDICTED: protein unc-50 homolog [Mesitornis unicolor]
 ref|XP_010574053.1| PREDICTED: protein unc-50 homolog isoform X1 [Haliaeetus leucocephalus]
 ref|XP_011581940.1| PREDICTED: protein unc-50 homolog [Aquila chrysaetos canadensis]
 gb|KFP97038.1| Protein unc-50 [Haliaeetus albicilla]
 gb|KFQ07685.1| Protein unc-50 [Leptosomus discolor]
 gb|KFQ28727.1| Protein unc-50 [Mesitornis unicolor]
 gb|KFR05639.1| Protein unc-50 [Nipponia nippon]
 gb|KFV45406.1| Protein unc-50 [Gavia stellata]
 gb|KGL91756.1| Protein unc-50 [Charadrius vociferus]
Length=259

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_001493222.2| PREDICTED: protein unc-50 homolog [Equus caballus]
 ref|XP_008530514.1| PREDICTED: protein unc-50 homolog isoform X1 [Equus przewalskii]
Length=259

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSPAHGNGALSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|NP_001182377.1| unc-50 homolog [Macaca mulatta]
 ref|XP_005575106.1| PREDICTED: protein unc-50 homolog isoform X1 [Macaca fascicularis]
 ref|XP_008006302.1| PREDICTED: protein unc-50 homolog [Chlorocebus sabaeus]
 ref|XP_011825010.1| PREDICTED: protein unc-50 homolog isoform X2 [Mandrillus leucophaeus]
 ref|XP_011753657.1| PREDICTED: protein unc-50 homolog [Macaca nemestrina]
 gb|EHH22353.1| hypothetical protein EGK_05597 [Macaca mulatta]
Length=259

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_011911048.1| PREDICTED: protein unc-50 homolog [Cercocebus atys]
Length=259

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_010163802.1| PREDICTED: protein unc-50 homolog [Caprimulgus carolinensis]
 gb|KFZ46648.1| Protein unc-50 [Caprimulgus carolinensis]
Length=259

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     TV +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETVKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              + +  G+N ++   + Y  R
Sbjct  237   LVSLACGWNFTKMLCSFYKYR  257



>ref|XP_005502640.1| PREDICTED: protein unc-50 homolog [Columba livia]
 gb|EMC84526.1| Protein unc-50 like protein [Columba livia]
Length=259

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVSSRSQGNGVLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_007466942.1| PREDICTED: protein unc-50 homolog [Lipotes vexillifer]
Length=259

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD ++  WQML+L TSP
Sbjct  1     MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFDFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_011811938.1| PREDICTED: protein unc-50 homolog isoform X2 [Colobus angolensis 
palliatus]
Length=267

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 151/250 (60%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  8     KMLPSTSVNASVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  67

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+ 
Sbjct  68    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVF  127

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  128   IDCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  183

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L
Sbjct  184   LFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILL  243

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  244   YGLSLALGWN  253



>ref|XP_004474429.1| PREDICTED: protein unc-50 homolog isoform 1 [Dasypus novemcinctus]
 ref|XP_004474430.1| PREDICTED: protein unc-50 homolog isoform 2 [Dasypus novemcinctus]
Length=259

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 158/261 (61%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSMNSQVQGNGALSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N +L +  P S   +  VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKHLVK--PQSR--DYDVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              + +  G+N ++   + Y  R
Sbjct  237   GLSLALGWNFTQMLCSFYKYR  257



>ref|XP_002920011.1| PREDICTED: protein unc-50 homolog [Ailuropoda melanoleuca]
Length=259

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 146/239 (61%), Gaps = 5/239 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             M    +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y 
Sbjct  11    MQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR  70

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++S
Sbjct  71    KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLIS  130

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTH  539
             T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T 
Sbjct  131   TLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTD  186

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
              FI   + N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +++L  + +  G+N
Sbjct  187   TFIGYFVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLVLLYGLSLALGWN  245



>ref|XP_010727867.1| PREDICTED: protein unc-50 homolog [Larimichthys crocea]
Length=254

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 149/238 (63%), Gaps = 13/238 (5%)
 Frame = -1

Query  1075  MLPTSS---LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  905
             MLPT+S   L  R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++ 
Sbjct  1     MLPTTSNGSLGARDAARHTAGAKRYKYLRRLLHFRQMDFEFAIWQMLYLFTSPQRVYRNF  60

Query  904   KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGA  725
              Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G 
Sbjct  61    HYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLDMGVVETLKLLLWVVFVDCIGVGL  120

Query  724   VLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPIL  548
             ++ST  WF++N YL      +H     VEW YAFDVH N+F+P+ ++L+ +  +F++ I+
Sbjct  121   LISTLMWFISNKYLLNHTSRNH----DVEWGYAFDVHLNAFYPLLVILHFLQLFFINHIV  176

Query  547   VTHG--FIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYP---IGIVIVLS  389
             V +   F+   + N L++IA  YY Y+ FLGY+ LPFL+ T   LYP   +G+V VLS
Sbjct  177   VINSDWFLGYFVGNTLWLIAIGYYLYITFLGYNALPFLKNTVVLLYPFALLGLVYVLS  234



>ref|XP_007521910.1| PREDICTED: protein unc-50 homolog [Erinaceus europaeus]
Length=259

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVSSLVQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFVSNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_010310695.1| PREDICTED: protein unc-50 homolog [Balearica regulorum gibbericeps]
 gb|KFO07831.1| Protein unc-50 [Balearica regulorum gibbericeps]
Length=259

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFVSNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_010135874.1| PREDICTED: protein unc-50 homolog [Buceros rhinoceros silvestris]
 gb|KFO90613.1| Protein unc-50 [Buceros rhinoceros silvestris]
Length=259

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGVLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   +   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVVGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>gb|EHH55775.1| hypothetical protein EGM_05043 [Macaca fascicularis]
Length=259

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_005706263.1| UNC-50 family protein isoform 2 [Galdieria sulphuraria]
 gb|EME29743.1| UNC-50 family protein isoform 2 [Galdieria sulphuraria]
Length=226

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 131/215 (61%), Gaps = 7/215 (3%)
 Frame = -1

Query  1009  QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLL  830
             +Y RR+ +  ++D EY FWQ+LHLC SP  VY++TKYHKQTKNQWARDDPAF++I   L+
Sbjct  5     EYSRRVFRLGELDFEYAFWQVLHLCLSPSRVYRNTKYHKQTKNQWARDDPAFLLILIYLI  64

Query  829   ACSTLAYCAAYD-HSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSS--H  659
                 LAY   +         ++V  V LF  +  G +++   WF  N +LR    S    
Sbjct  65    VLIDLAYLVCFQIRGISLLGYIVKDVTLF--ICIGCLVTLVFWFFCNRFLRMSGMSVLFQ  122

Query  658   VVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYH  479
              VE RVEWLYAFDVHCNSF    ++ YV  YFL P++   G + L  SN ++  +  YY 
Sbjct  123   AVESRVEWLYAFDVHCNSFLLFALINYVARYFLLPVIYDKGSVSLFFSNFIYFASVCYYI  182

Query  478   YLNFLGYDVLPFLERTTFFLYPI--GIVIVLSPIF  380
             Y+ FLGYD+LPFL RT + LY +    V++LS  F
Sbjct  183   YITFLGYDILPFLRRTHYLLYLVLPSAVLLLSLCF  217



>ref|XP_006059966.1| PREDICTED: protein unc-50 homolog [Bubalus bubalis]
Length=259

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +++L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKHTVILLYPFAPLVLLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_004633238.1| PREDICTED: protein unc-50 homolog [Octodon degus]
Length=289

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 150/241 (62%), Gaps = 9/241 (4%)
 Frame = -1

Query  1081  GNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTK  902
             GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++  
Sbjct  43    GNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFH  98

Query  901   YHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAV  722
             Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G +
Sbjct  99    YRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLL  158

Query  721   LSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILV  545
             +ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++
Sbjct  159   ISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVIL  214

Query  544   THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGF  365
             T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+
Sbjct  215   TDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGW  274

Query  364   N  362
             N
Sbjct  275   N  275



>ref|XP_010360423.1| PREDICTED: protein unc-50 homolog isoform X1 [Rhinopithecus roxellana]
Length=259

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFLETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_005706262.1| UNC-50 family protein isoform 1 [Galdieria sulphuraria]
 gb|EME29742.1| UNC-50 family protein isoform 1 [Galdieria sulphuraria]
Length=221

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 131/213 (62%), Gaps = 8/213 (4%)
 Frame = -1

Query  1009  QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLL  830
             +Y RR+ +  ++D EY FWQ+LHLC SP  VY++TKYHKQTKNQWARDDPAF++I   L+
Sbjct  5     EYSRRVFRLGELDFEYAFWQVLHLCLSPSRVYRNTKYHKQTKNQWARDDPAFLLILIYLI  64

Query  829   ACSTLAYCAAYD-HSAGHTVFVVISVLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVV  653
                 LAY   +         ++V  V LF  +  G +++   WF  N +LR    S   V
Sbjct  65    VLIDLAYLVCFQIRGISLLGYIVKDVTLF--ICIGCLVTLVFWFFCNRFLRM---SGMAV  119

Query  652   EQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPILVTHGFIPLLLSNLLFMIAASYYHYL  473
             E RVEWLYAFDVHCNSF    ++ YV  YFL P++   G + L  SN ++  +  YY Y+
Sbjct  120   ESRVEWLYAFDVHCNSFLLFALINYVARYFLLPVIYDKGSVSLFFSNFIYFASVCYYIYI  179

Query  472   NFLGYDVLPFLERTTFFLYPI--GIVIVLSPIF  380
              FLGYD+LPFL RT + LY +    V++LS  F
Sbjct  180   TFLGYDILPFLRRTHYLLYLVLPSAVLLLSLCF  212



>ref|XP_007244197.1| PREDICTED: protein unc-50 homolog [Astyanax mexicanus]
Length=301

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/258 (38%), Positives = 155/258 (60%), Gaps = 17/258 (7%)
 Frame = -1

Query  1087  STGNMLPTS----------SLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHL  938
              +GNMLPT+          SL  R ++    ++   +YLRR++ ++QMD E+  WQML+L
Sbjct  37    DSGNMLPTTTYSPQNQGNGSLNSRDAARHTASAKRYKYLRRLLHFKQMDFEFAMWQMLYL  96

Query  937   CTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVIS  758
              TSP+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ 
Sbjct  97    FTSPQRVYRNFHYRKQTKDQWARDDPAFLVMLSIWLCVSTVGFGLVLDMGFVETLKLLLW  156

Query  757   VLLFHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLY  578
             V+    +  G ++ST  W +TN YL +     +     VEW YAFDVH N+F+P+ ++L+
Sbjct  157   VVFIDCIGVGLLISTLMWIITNKYLMKHRSKDY----DVEWGYAFDVHLNAFYPLLVILH  212

Query  577   VVH-YFLSPILV--THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIG  407
              +   F++ I+V  + GFI   + N L++I+  YY Y+ FLGY  LPFL+ T   LYP  
Sbjct  213   FLQLLFINHIVVINSDGFIGCFVGNTLWLISIGYYIYITFLGYSALPFLKNTVILLYPFA  272

Query  406   IVIVLSPIFILTGFNPSR  353
             ++ +L  + I  G+N ++
Sbjct  273   LLGLLYVLSITLGWNFTK  290



>gb|AAH39078.1| Unc-50 homolog (C. elegans) [Homo sapiens]
Length=259

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ ++  V+L 
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLPWVVLI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_009635948.1| PREDICTED: protein unc-50 homolog [Egretta garzetta]
 gb|KFP14978.1| Protein unc-50 [Egretta garzetta]
Length=259

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   +   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVVGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_009280076.1| PREDICTED: protein unc-50 homolog isoform X1 [Aptenodytes forsteri]
 gb|KFM01211.1| Protein unc-50 [Aptenodytes forsteri]
Length=259

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 154/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+VI S+ L  ST+ +    D      + +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVILSIWLCVSTVGFGFVLDMGFFEMIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCIGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>dbj|BAD96319.1| unc-50 homolog [Homo sapiens]
Length=259

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 150/249 (60%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY+   Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRSFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_006734276.1| PREDICTED: protein unc-50 homolog isoform X1 [Leptonychotes weddellii]
Length=261

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/236 (38%), Positives = 145/236 (61%), Gaps = 5/236 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  16    NGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  75

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  76    KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  135

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T  FI
Sbjct  136   WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFI  191

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
                + N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+N
Sbjct  192   GYFVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWN  247



>ref|XP_004896629.1| PREDICTED: protein unc-50 homolog isoform X2 [Heterocephalus 
glaber]
 ref|XP_004896630.1| PREDICTED: protein unc-50 homolog isoform X3 [Heterocephalus 
glaber]
 ref|XP_004896631.1| PREDICTED: protein unc-50 homolog isoform X4 [Heterocephalus 
glaber]
 ref|XP_004844468.1| PREDICTED: protein unc-50 homolog isoform X1 [Heterocephalus 
glaber]
 ref|XP_004844469.1| PREDICTED: protein unc-50 homolog isoform X2 [Heterocephalus 
glaber]
 ref|XP_004844470.1| PREDICTED: protein unc-50 homolog isoform X3 [Heterocephalus 
glaber]
Length=259

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -1

Query  1075  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1     MLPSTSVNSSMHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G ++ST  WF++N +L +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLISTLMWFISNKHLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLY  236

Query  388   PIFILTGFN  362
              + +  G+N
Sbjct  237   GLSLALGWN  245



>ref|XP_010118916.1| PREDICTED: protein unc-50 homolog [Chlamydotis macqueenii]
 gb|KFP42052.1| Protein unc-50 [Chlamydotis macqueenii]
Length=259

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 154/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+SL  R+  +              +   +YLRR+  ++QMD E+  WQML+L  SP
Sbjct  1     MLPTTSLNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFISP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_009078456.1| PREDICTED: protein unc-50 homolog [Acanthisitta chloris]
 gb|KFP85954.1| Protein unc-50 [Acanthisitta chloris]
Length=259

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPT--SSLKGRTSSHARPNSVFP--------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT  SS +G+ +    P             +YLRR++ ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTLSSPRGQGNGALSPRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++     Y  R
Sbjct  237   LISLACGWNFTKMLCTFYKYR  257



>ref|XP_006734277.1| PREDICTED: protein unc-50 homolog isoform X2 [Leptonychotes weddellii]
 ref|XP_008698011.1| PREDICTED: protein unc-50 homolog [Ursus maritimus]
Length=259

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/236 (38%), Positives = 145/236 (61%), Gaps = 5/236 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14    NGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74    KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T  FI
Sbjct  134   WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFI  189

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
                + N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+N
Sbjct  190   GYFVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWN  245



>ref|XP_004400190.1| PREDICTED: protein unc-50 homolog isoform 1 [Odobenus rosmarus 
divergens]
 ref|XP_004400191.1| PREDICTED: protein unc-50 homolog isoform 2 [Odobenus rosmarus 
divergens]
Length=259

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/236 (38%), Positives = 145/236 (61%), Gaps = 5/236 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14    NGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74    KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T  FI
Sbjct  134   WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFVNHVILTDTFI  189

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
                + N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+N
Sbjct  190   GYFVGNTLWLVAVGYYIYITFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWN  245



>ref|XP_005212369.2| PREDICTED: protein unc-50 homolog isoform X2 [Bos taurus]
Length=303

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 151/243 (62%), Gaps = 9/243 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  55    AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  110

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  111   FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  170

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPI  551
              ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +
Sbjct  171   LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHV  226

Query  550   LVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILT  371
             ++T  FI  L+ N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  
Sbjct  227   ILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLAL  286

Query  370   GFN  362
             G+N
Sbjct  287   GWN  289



>gb|EFB24064.1| hypothetical protein PANDA_008691, partial [Ailuropoda melanoleuca]
Length=275

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 146/239 (61%), Gaps = 5/239 (2%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  896
             M    +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y 
Sbjct  27    MQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR  86

Query  895   KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLS  716
             KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++S
Sbjct  87    KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLIS  146

Query  715   TCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTH  539
             T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T 
Sbjct  147   TLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTD  202

Query  538   GFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
              FI   + N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +++L  + +  G+N
Sbjct  203   TFIGYFVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLVLLYGLSLALGWN  261



>ref|XP_011272571.1| putative membrane protein [Wickerhamomyces ciferrii]
 emb|CCH45543.1| putative membrane protein [Wickerhamomyces ciferrii]
Length=300

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 148/259 (57%), Gaps = 7/259 (3%)
 Frame = -1

Query  1087  STGNMLPTSSLKG-RTS--SHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  917
             ST N    S + G RT   S +R N   P +++R  K   +D E   W++ +L  SPK V
Sbjct  43    STSNGTNRSRVFGSRTDRFSPSRSNFKIPIFIKRFFKPPTLDFETAIWEIFYLIVSPKRV  102

Query  916   YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  737
             Y+   YHKQTKN+WARDDP+F+++    L  S +A+  AY  +    + +++ ++   F 
Sbjct  103   YKSLYYHKQTKNRWARDDPSFMILLVGFLTLSAIAWGVAYSPNIISILKLILYMVFIDFF  162

Query  736   VTGAVLSTCCWFLTNNYLREEAPSS---HVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHY  566
             + G  +ST  WFL N + R+   ++    V E  +EW Y FDVHCNSF  ++++LY++ +
Sbjct  163   IVGVFISTLGWFLANRFFRKRNTNNTIGAVTEGDLEWAYCFDVHCNSFLVIWVLLYMIQF  222

Query  565   FLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSP  386
              L P+L    +  L L N L+ I+ SYY  + F GY+ LPFLE T   L+PIGI  VL  
Sbjct  223   ILLPLLTMSNWFGLFLGNTLYFISISYYFIITFYGYNALPFLEHTQLILFPIGIFSVLYF  282

Query  385   IFILTGFNPSRYFMNIYFS  329
             I  L GFN ++   + YFS
Sbjct  283   I-SLFGFNVAKAMTSNYFS  300



>ref|XP_005750571.1| PREDICTED: protein unc-50 homolog [Pundamilia nyererei]
 ref|XP_005948785.1| PREDICTED: protein unc-50 homolog isoform X1 [Haplochromis burtoni]
Length=265

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 160/268 (60%), Gaps = 11/268 (4%)
 Frame = -1

Query  1075  MLPTSSLKG----RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             MLPT++  G    R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++
Sbjct  1     MLPTTNSNGALASRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSPQRVYRN  60

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
              +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    +     T+ +++ V+    +  G
Sbjct  61    FQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLEMGVVETLKLLLWVVFVDCIGVG  120

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPIL  548
              ++ST  W +TN YL ++ PS +     VEW YAFDVH N+F+P+ ++L+ +  F    L
Sbjct  121   LLISTIMWVVTNRYLLKQ-PSRNF---DVEWGYAFDVHLNAFYPLLVILHFLQLFFINHL  176

Query  547   V---THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
             V   +  F+   + N L++IA  YY Y+ FLGY+ LPFL+ T   LYP  ++ +L  + I
Sbjct  177   VMISSDWFLGYFVGNTLWLIAIGYYLYITFLGYNALPFLKNTVVLLYPFALLGLLYILSI  236

Query  376   LTGFNPSRYFMNIYFSRAL*SQLRLVIG  293
               G+N +R   + Y  R +  +L   IG
Sbjct  237   SLGWNFTRGLCSFYKYRVMQERLASEIG  264



>ref|XP_004575434.1| PREDICTED: protein unc-50 homolog [Maylandia zebra]
Length=265

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 160/268 (60%), Gaps = 11/268 (4%)
 Frame = -1

Query  1075  MLPTSSLKG----RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             MLPT++  G    R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++
Sbjct  1     MLPTTNSNGALASRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSPQRVYRN  60

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
              +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    +     T+ +++ V+    +  G
Sbjct  61    FQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLEMGVVETLKLLLWVVFVDCIGVG  120

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPIL  548
              ++ST  W +TN YL ++ PS +     VEW YAFDVH N+F+P+ ++L+ +  F    L
Sbjct  121   LLISTIMWVVTNRYLLKQ-PSRNF---DVEWGYAFDVHLNAFYPLLVILHFLQLFFINHL  176

Query  547   V---THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
             V   +  F+   + N L++IA  YY Y+ FLGY+ LPFL+ T   LYP  ++ +L  + I
Sbjct  177   VMISSDWFLGYFVGNTLWLIAIGYYLYITFLGYNALPFLKNTVVLLYPFALLGLLYILSI  236

Query  376   LTGFNPSRYFMNIYFSRAL*SQLRLVIG  293
               G+N +R   + Y  R +  +L   IG
Sbjct  237   SLGWNFTRGLCSFYKYRVMQDRLASEIG  264



>ref|XP_006807177.1| PREDICTED: LOW QUALITY PROTEIN: protein unc-50 homolog [Neolamprologus 
brichardi]
Length=265

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 160/268 (60%), Gaps = 11/268 (4%)
 Frame = -1

Query  1075  MLPTSSLKG----RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             MLPT++  G    R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++
Sbjct  1     MLPTTNSNGALASRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSPQRVYRN  60

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
              +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    +     T+ +++ V+    +  G
Sbjct  61    FQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLEMGVVETLKLLLWVVFVDCIGVG  120

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVHYFLSPIL  548
              ++ST  W +TN YL ++ PS +     VEW YAFDVH N+F+P+ ++L+ +  F    L
Sbjct  121   LLISTIMWVVTNRYLLKQ-PSRNF---DVEWGYAFDVHLNAFYPLLVILHFLQLFFINHL  176

Query  547   V---THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFI  377
             V   +  F+   + N L++IA  YY Y+ FLGY+ LPFL+ T   LYP  ++ +L  + I
Sbjct  177   VMISSDWFLGYFVGNTLWLIAIGYYLYITFLGYNALPFLKNTVVLLYPFALLGLLYILSI  236

Query  376   LTGFNPSRYFMNIYFSRAL*SQLRLVIG  293
               G+N +R   + Y  R +  +L   IG
Sbjct  237   SLGWNFTRGLCSFYKYRVMXDRLASEIG  264



>ref|XP_004704408.1| PREDICTED: protein unc-50 homolog [Echinops telfairi]
Length=259

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 144/236 (61%), Gaps = 5/236 (2%)
 Frame = -1

Query  1066  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  887
               SL  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14    NGSLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  886   KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAVLSTCC  707
             K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74    KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  706   WFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILVTHGFI  530
             WF++N YL +        +  VEW YAFDVH N+F+P+ ++L+ +  +F++ +++T  FI
Sbjct  134   WFVSNKYLVKRQSR----DSDVEWGYAFDVHLNAFYPLLVILHFIQLFFINYVILTDTFI  189

Query  529   PLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGFN  362
                + N L++ A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+N
Sbjct  190   GYFIGNTLWLTAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWN  245



>ref|XP_004752941.1| PREDICTED: protein unc-50 homolog isoform X1 [Mustela putorius 
furo]
 ref|XP_004752942.1| PREDICTED: protein unc-50 homolog isoform X2 [Mustela putorius 
furo]
 ref|XP_004792766.1| PREDICTED: protein unc-50 homolog isoform X1 [Mustela putorius 
furo]
 ref|XP_004792767.1| PREDICTED: protein unc-50 homolog isoform X2 [Mustela putorius 
furo]
Length=259

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 148/241 (61%), Gaps = 9/241 (4%)
 Frame = -1

Query  1081  GNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTK  902
             GN +  S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++  
Sbjct  13    GNGVLNSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFH  68

Query  901   YHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTGAV  722
             Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G +
Sbjct  69    YRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLL  128

Query  721   LSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPILV  545
             +ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +++
Sbjct  129   ISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVIL  184

Query  544   THGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILTGF  365
             T  FI   + N L+++A  YY Y+ FLGY  LPFL+ T   LYP   +I+L  + +  G+
Sbjct  185   TDTFIGYFVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGW  244

Query  364   N  362
             N
Sbjct  245   N  245



>ref|XP_010070908.1| PREDICTED: protein unc-50 homolog [Pterocles gutturalis]
 gb|KFU97602.1| Protein unc-50 [Pterocles gutturalis]
Length=259

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 154/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVSSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+  
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMFY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_005013489.1| PREDICTED: protein unc-50 homolog, partial [Anas platyrhynchos]
 gb|EOB05812.1| Protein unc-50-like protein, partial [Anas platyrhynchos]
Length=257

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 154/255 (60%), Gaps = 9/255 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             S GN     +L  R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++
Sbjct  9     SQGN----GALSPRDAARHTAGAKRHKYLRRLLHFRQMDFEFALWQMLYLFTSPQRVYRN  64

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  65    FHYRKQTKDQWARDDPAFLVLLSVWLCVSTVGFGFVLDMGFFETIKLLLWVVFIDCVGVG  124

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPI  551
              +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +
Sbjct  125   LLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINYV  180

Query  550   LVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILT  371
             +++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L  I +  
Sbjct  181   IISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLYLISLAC  240

Query  370   GFNPSRYFMNIYFSR  326
             G+N ++   + Y  R
Sbjct  241   GWNFTKMLCSFYKYR  255



>ref|XP_009901345.1| PREDICTED: protein unc-50 homolog [Picoides pubescens]
 gb|KFV69279.1| Protein unc-50 [Picoides pubescens]
Length=259

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 154/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGVLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW Y FDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYTFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_004896628.1| PREDICTED: protein unc-50 homolog isoform X1 [Heterocephalus 
glaber]
Length=271

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 151/250 (60%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  12    KMLPSTSVNSSMHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  71

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+ 
Sbjct  72    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVF  131

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G ++ST  WF++N +L +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  132   IDCVGVGLLISTLMWFISNKHLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  187

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L
Sbjct  188   LFFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILL  247

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  248   YGLSLALGWN  257



>ref|XP_005151440.1| PREDICTED: protein unc-50 homolog [Melopsittacus undulatus]
Length=259

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 155/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVSSRSQGNGVLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++ +Y K+TK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFQYRKRTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQHRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFAFLIMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_009501868.1| PREDICTED: protein unc-50 homolog [Phalacrocorax carbo]
 gb|KFW74883.1| Protein unc-50 [Phalacrocorax carbo]
Length=259

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 154/261 (59%), Gaps = 15/261 (6%)
 Frame = -1

Query  1075  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  926
             MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1     MLPTTSVNSRSQGNGTLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  925   KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  746
             + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61    QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  745   HFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-  569
               +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121   DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  568   YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLS  389
             +F++ ++++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++ +L 
Sbjct  177   FFINYVIISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLTMLY  236

Query  388   PIFILTGFNPSRYFMNIYFSR  326
              I +  G+N ++   + Y  R
Sbjct  237   LISLACGWNFTKMLCSFYKYR  257



>ref|XP_002196813.1| PREDICTED: protein unc-50 homolog [Taeniopygia guttata]
 ref|XP_005486477.1| PREDICTED: protein unc-50 homolog [Zonotrichia albicollis]
 ref|XP_005420065.1| PREDICTED: protein unc-50 homolog [Geospiza fortis]
Length=259

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 154/255 (60%), Gaps = 9/255 (4%)
 Frame = -1

Query  1087  STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  908
             S GN + +     R ++ A+      +YLRR+  ++QMD E+  WQML+L TSP+ VY++
Sbjct  11    SQGNGVLSRRDAARHTAGAKRY----KYLRRLFHFRQMDFEFALWQMLYLFTSPQRVYRN  66

Query  907   TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLVTG  728
               Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67    FHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  727   AVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH-YFLSPI  551
              +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  +F++ +
Sbjct  127   LLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINYV  182

Query  550   LVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVLSPIFILT  371
             +++   I   + N L++IA  YY Y+ FLGY  LPFL+ T   LYP  ++I+L  I +  
Sbjct  183   IISDSVIGYFVGNTLWLIAIGYYIYVTFLGYSALPFLKNTAILLYPFALLIMLYLISLAC  242

Query  370   GFNPSRYFMNIYFSR  326
             G+N ++   + Y  R
Sbjct  243   GWNFTKMLCSFYKYR  257



>gb|EHB10596.1| unc-50-like protein, partial [Heterocephalus glaber]
Length=275

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 151/250 (60%), Gaps = 15/250 (6%)
 Frame = -1

Query  1078  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  929
              MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  16    KMLPSTSVNSSMHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  75

Query  928   PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  749
             P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+ 
Sbjct  76    PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVF  135

Query  748   FHFLVTGAVLSTCCWFLTNNYLREEAPSSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVVH  569
                +  G ++ST  WF++N +L +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  136   IDCVGVGLLISTLMWFISNKHLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  191

Query  568   -YFLSPILVTHGFIPLLLSNLLFMIAASYYHYLNFLGYDVLPFLERTTFFLYPIGIVIVL  392
              +F++ +++T  FI  L+ N L++IA  YY Y+ FLGY  LPFL+ T   LYP   +I+L
Sbjct  192   LFFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILL  251

Query  391   SPIFILTGFN  362
               + +  G+N
Sbjct  252   YGLSLALGWN  261



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3259821493258