BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5562

Length=838
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002265945.3|  PREDICTED: beta-hexosaminidase 3-like              353   2e-118   Vitis vinifera
ref|XP_011077093.1|  PREDICTED: beta-hexosaminidase 3                   360   1e-117   Sesamum indicum [beniseed]
ref|XP_010646460.1|  PREDICTED: beta-hexosaminidase 3-like              355   5e-116   Vitis vinifera
ref|XP_002311272.2|  hypothetical protein POPTR_0008s07890g             353   4e-115   
ref|XP_011010798.1|  PREDICTED: beta-hexosaminidase 3                   353   4e-115   Populus euphratica
gb|AAB60911.1|  ESTs gb|T43256,gb|46316,gb|N64930,gb|AA395255,gb|...    345   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496066.1|  PREDICTED: beta-hexosaminidase 3                   348   3e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010528624.1|  PREDICTED: beta-hexosaminidase 3                   347   4e-113   
ref|XP_006391541.1|  hypothetical protein EUTSA_v10018379mg             348   6e-113   Eutrema salsugineum [saltwater cress]
ref|NP_176737.2|  beta-hexosaminidase 3                                 348   8e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012078912.1|  PREDICTED: beta-hexosaminidase 3                   347   1e-112   
gb|KDP32489.1|  hypothetical protein JCGZ_13414                         347   2e-112   Jatropha curcas
ref|XP_010415100.1|  PREDICTED: beta-hexosaminidase 3-like isofor...    347   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010673847.1|  PREDICTED: beta-hexosaminidase 3                   347   2e-112   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB14661.1|  hypothetical protein B456_002G136400                    347   2e-112   Gossypium raimondii
ref|XP_010415101.1|  PREDICTED: beta-hexosaminidase 3-like isofor...    347   2e-112   Camelina sativa [gold-of-pleasure]
gb|KJB14660.1|  hypothetical protein B456_002G136400                    346   2e-112   Gossypium raimondii
ref|XP_010470437.1|  PREDICTED: beta-hexosaminidase 3-like              348   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002886950.1|  glycosyl hydrolase family 20 protein               346   3e-112   Arabidopsis lyrata subsp. lyrata
gb|EYU39500.1|  hypothetical protein MIMGU_mgv1a004365mg                346   3e-112   Erythranthe guttata [common monkey flower]
ref|XP_009782309.1|  PREDICTED: beta-hexosaminidase 3                   346   3e-112   Nicotiana sylvestris
gb|KFK41002.1|  hypothetical protein AALP_AA2G072600                    345   6e-112   Arabis alpina [alpine rockcress]
ref|XP_006302115.1|  hypothetical protein CARUB_v10020116mg             345   6e-112   Capsella rubella
ref|XP_004250088.1|  PREDICTED: beta-hexosaminidase 3                   342   1e-110   
ref|XP_002514769.1|  beta-hexosaminidase, putative                      341   2e-110   Ricinus communis
ref|XP_009602901.1|  PREDICTED: beta-hexosaminidase 3 isoform X2        341   2e-110   
ref|XP_009602900.1|  PREDICTED: beta-hexosaminidase 3 isoform X1        341   3e-110   Nicotiana tomentosiformis
ref|XP_007028399.1|  Beta-hexosaminidase 3 isoform 5                    335   4e-110   
ref|XP_007028397.1|  Beta-hexosaminidase 3 isoform 3                    336   4e-110   
ref|XP_009105156.1|  PREDICTED: beta-hexosaminidase 3                   340   5e-110   Brassica rapa
dbj|BAK05483.1|  predicted protein                                      339   2e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS61134.1|  Beta-hexosaminidase subunit B2                          336   2e-109   Triticum urartu
ref|XP_006353240.1|  PREDICTED: beta-hexosaminidase 3-like isofor...    338   2e-109   Solanum tuberosum [potatoes]
gb|EMT17377.1|  Beta-hexosaminidase subunit B2                          337   3e-109   
emb|CDY07456.1|  BnaA07g25350D                                          338   4e-109   Brassica napus [oilseed rape]
ref|XP_007028395.1|  Beta-hexosaminidase 3 isoform 1                    337   9e-109   
ref|XP_004962080.1|  PREDICTED: beta-hexosaminidase 3-like              337   1e-108   Setaria italica
ref|XP_007028398.1|  Beta-hexosaminidase 3 isoform 4                    336   2e-108   
ref|XP_008649645.1|  PREDICTED: beta-hexosaminidase 3 isoform X1        336   2e-108   Zea mays [maize]
ref|XP_007028396.1|  Beta-hexosaminidase 3 isoform 2                    337   2e-108   
ref|XP_008788259.1|  PREDICTED: beta-hexosaminidase 3                   335   3e-108   Phoenix dactylifera
gb|KDO77087.1|  hypothetical protein CISIN_1g008945mg                   332   4e-108   Citrus sinensis [apfelsine]
ref|XP_006448517.1|  hypothetical protein CICLE_v10014808mg             336   4e-108   Citrus clementina [clementine]
emb|CDP21161.1|  unnamed protein product                                334   5e-108   Coffea canephora [robusta coffee]
emb|CDY39278.1|  BnaC06g27130D                                          331   6e-108   Brassica napus [oilseed rape]
ref|XP_010908516.1|  PREDICTED: beta-hexosaminidase 3                   335   9e-108   
ref|XP_006468639.1|  PREDICTED: beta-hexosaminidase 3-like              333   3e-107   Citrus sinensis [apfelsine]
gb|KDO77088.1|  hypothetical protein CISIN_1g008945mg                   333   3e-107   Citrus sinensis [apfelsine]
ref|NP_001045052.1|  Os01g0891000                                       332   5e-107   
ref|XP_006645150.1|  PREDICTED: beta-hexosaminidase 3-like              332   6e-107   Oryza brachyantha
ref|XP_010231374.1|  PREDICTED: beta-hexosaminidase 3-like              332   8e-107   
dbj|BAK06905.1|  predicted protein                                      332   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008441912.1|  PREDICTED: beta-hexosaminidase 3                   332   1e-106   Cucumis melo [Oriental melon]
ref|XP_003564819.1|  PREDICTED: beta-hexosaminidase 3-like              330   4e-106   Brachypodium distachyon [annual false brome]
ref|XP_004970859.1|  PREDICTED: beta-hexosaminidase 3-like              328   3e-105   Setaria italica
emb|CBI18622.3|  unnamed protein product                                317   5e-105   Vitis vinifera
ref|XP_004152838.1|  PREDICTED: beta-hexosaminidase 3                   328   5e-105   Cucumis sativus [cucumbers]
ref|XP_010251932.1|  PREDICTED: beta-hexosaminidase 3-like              327   8e-105   Nelumbo nucifera [Indian lotus]
gb|EMS52859.1|  Beta-hexosaminidase subunit B2                          326   2e-104   Triticum urartu
gb|EMT19841.1|  Beta-hexosaminidase subunit B2                          325   2e-104   
ref|XP_004963769.1|  PREDICTED: beta-hexosaminidase 3-like              325   4e-104   Setaria italica
emb|CDM85418.1|  unnamed protein product                                323   1e-103   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001170188.1|  hypothetical protein precursor                     322   8e-103   Zea mays [maize]
ref|XP_010277798.1|  PREDICTED: beta-hexosaminidase 3-like              321   2e-102   Nelumbo nucifera [Indian lotus]
gb|ERN20212.1|  hypothetical protein AMTR_s00066p00132700               315   6e-102   Amborella trichopoda
ref|XP_011628773.1|  PREDICTED: beta-hexosaminidase 3                   316   8e-102   
gb|EEC79230.1|  hypothetical protein OsI_19972                          315   4e-100   Oryza sativa Indica Group [Indian rice]
gb|AAT77374.1|  putative beta-N-acetylhexosaminidase                    314   5e-100   Oryza sativa Japonica Group [Japonica rice]
emb|CDP11166.1|  unnamed protein product                                313   6e-100   Coffea canephora [robusta coffee]
ref|NP_001055557.1|  Os05g0415700                                       314   6e-100   
ref|XP_010110142.1|  Beta-hexosaminidase subunit                        315   5e-99    
ref|XP_006655326.1|  PREDICTED: beta-hexosaminidase 3-like              310   3e-98    
gb|KHG19961.1|  hexa[2]: Beta-hexosaminidase subunit A1                 268   2e-83    Gossypium arboreum [tree cotton]
gb|KHG19960.1|  hexb2                                                   268   3e-82    Gossypium arboreum [tree cotton]
ref|XP_002981850.1|  hypothetical protein SELMODRAFT_445016             263   4e-80    
gb|ERN19143.1|  hypothetical protein AMTR_s00061p00161080               263   6e-80    Amborella trichopoda
ref|XP_006857676.2|  PREDICTED: beta-hexosaminidase 1                   263   9e-80    Amborella trichopoda
ref|XP_006436102.1|  hypothetical protein CICLE_v10031139mg             261   3e-79    Citrus clementina [clementine]
ref|XP_006436103.1|  hypothetical protein CICLE_v10031139mg             261   4e-79    Citrus clementina [clementine]
ref|XP_002982816.1|  hypothetical protein SELMODRAFT_445341             255   4e-77    
ref|XP_008649646.1|  PREDICTED: beta-hexosaminidase 3 isoform X2        253   6e-77    Zea mays [maize]
ref|XP_010321284.1|  PREDICTED: beta-hexosaminidase 2 isoform X1        253   3e-76    Solanum lycopersicum
ref|XP_009789884.1|  PREDICTED: beta-hexosaminidase 1                   253   4e-76    Nicotiana sylvestris
ref|NP_001234613.1|  beta-hexosaminidase 2                              253   4e-76    
ref|XP_011076893.1|  PREDICTED: beta-hexosaminidase 1                   253   4e-76    
ref|XP_004307561.1|  PREDICTED: beta-hexosaminidase 1                   252   6e-76    Fragaria vesca subsp. vesca
ref|XP_009631516.1|  PREDICTED: beta-hexosaminidase 1                   252   9e-76    Nicotiana tomentosiformis
ref|XP_006345934.1|  PREDICTED: beta-hexosaminidase 1-like              252   9e-76    Solanum tuberosum [potatoes]
ref|XP_009402372.1|  PREDICTED: beta-hexosaminidase 1                   252   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP00030.1|  unnamed protein product                                251   2e-75    Coffea canephora [robusta coffee]
gb|KHN37321.1|  Beta-hexosaminidase subunit B2                          250   4e-75    Glycine soja [wild soybean]
ref|XP_003535778.1|  PREDICTED: beta-hexosaminidase 1-like              250   4e-75    Glycine max [soybeans]
ref|XP_007142707.1|  hypothetical protein PHAVU_007G010100g             250   7e-75    Phaseolus vulgaris [French bean]
gb|EYU19904.1|  hypothetical protein MIMGU_mgv1a003720mg                250   7e-75    Erythranthe guttata [common monkey flower]
gb|KCW65489.1|  hypothetical protein EUGRSUZ_G02896                     246   8e-75    Eucalyptus grandis [rose gum]
gb|ABR16487.1|  unknown                                                 249   1e-74    Picea sitchensis
ref|XP_010937791.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    249   1e-74    
ref|XP_003569011.1|  PREDICTED: beta-hexosaminidase 1                   249   1e-74    Brachypodium distachyon [annual false brome]
ref|XP_008245395.1|  PREDICTED: beta-hexosaminidase 1-like              239   3e-74    Prunus mume [ume]
ref|XP_008371159.1|  PREDICTED: beta-hexosaminidase 1-like              248   3e-74    Malus domestica [apple tree]
ref|XP_010534474.1|  PREDICTED: beta-hexosaminidase 1 isoform X3        244   5e-74    
ref|XP_009335906.1|  PREDICTED: beta-hexosaminidase 1-like              247   5e-74    Pyrus x bretschneideri [bai li]
ref|XP_009357661.1|  PREDICTED: beta-hexosaminidase 1-like              247   6e-74    Pyrus x bretschneideri [bai li]
ref|XP_001764768.1|  predicted protein                                  244   7e-74    
ref|XP_007139272.1|  hypothetical protein PHAVU_008G015400g             247   8e-74    Phaseolus vulgaris [French bean]
gb|AFW78020.1|  hypothetical protein ZEAMMB73_303571                    235   8e-74    
ref|XP_008369980.1|  PREDICTED: beta-hexosaminidase 1-like              246   1e-73    
dbj|BAK03346.1|  predicted protein                                      246   2e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE62107.1|  hypothetical protein OsJ_16891                          245   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003555621.1|  PREDICTED: beta-hexosaminidase 1                   245   3e-73    Glycine max [soybeans]
ref|XP_009337556.1|  PREDICTED: beta-hexosaminidase 1-like              245   3e-73    Pyrus x bretschneideri [bai li]
ref|NP_001054468.1|  Os05g0115900                                       245   3e-73    
gb|KJB76035.1|  hypothetical protein B456_012G068200                    245   3e-73    Gossypium raimondii
ref|XP_007009542.1|  Beta-hexosaminidase 1 isoform 1                    245   3e-73    
ref|XP_010669816.1|  PREDICTED: beta-hexosaminidase 1                   245   4e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008245392.1|  PREDICTED: beta-hexosaminidase 1                   245   4e-73    Prunus mume [ume]
ref|XP_010534473.1|  PREDICTED: beta-hexosaminidase 1 isoform X2        245   5e-73    Tarenaya hassleriana [spider flower]
ref|XP_008246029.1|  PREDICTED: beta-hexosaminidase 1-like              236   5e-73    Prunus mume [ume]
ref|XP_010534472.1|  PREDICTED: beta-hexosaminidase 1 isoform X1        244   6e-73    Tarenaya hassleriana [spider flower]
emb|CDY02928.1|  BnaC04g25580D                                          244   6e-73    
ref|XP_010068876.1|  PREDICTED: beta-hexosaminidase 1                   247   6e-73    
ref|XP_006403480.1|  hypothetical protein EUTSA_v10010264mg             244   7e-73    Eutrema salsugineum [saltwater cress]
ref|XP_007220020.1|  hypothetical protein PRUPE_ppa003880mg             244   9e-73    Prunus persica
ref|XP_009139188.1|  PREDICTED: beta-hexosaminidase 1                   244   1e-72    Brassica rapa
gb|KHN27204.1|  Beta-hexosaminidase subunit B2                          242   1e-72    Glycine soja [wild soybean]
ref|XP_004492083.1|  PREDICTED: beta-hexosaminidase 1-like              244   1e-72    Cicer arietinum [garbanzo]
ref|XP_003552672.1|  PREDICTED: beta-hexosaminidase 1-like              244   1e-72    Glycine max [soybeans]
gb|AFP90754.1|  beta-hexosaminidase 1                                   244   1e-72    Prunus persica
emb|CDX76112.1|  BnaA04g03760D                                          244   1e-72    
gb|KEH44495.1|  glycoside hydrolase family 20 domain protein            243   2e-72    Medicago truncatula
ref|XP_010516090.1|  PREDICTED: beta-hexosaminidase 1                   243   2e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010427290.1|  PREDICTED: beta-hexosaminidase 1-like              243   3e-72    Camelina sativa [gold-of-pleasure]
ref|XP_002440479.1|  hypothetical protein SORBIDRAFT_09g001670          243   3e-72    Sorghum bicolor [broomcorn]
ref|XP_003518662.1|  PREDICTED: beta-hexosaminidase 1-like              243   3e-72    Glycine max [soybeans]
ref|XP_002876291.1|  glycosyl hydrolase family 20 protein               242   5e-72    
gb|AAM61367.1|  beta-N-acetylhexosaminidase-like protein                239   5e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290865.1|  hypothetical protein CARUB_v10016974mg             242   6e-72    Capsella rubella
ref|XP_004960487.1|  PREDICTED: beta-hexosaminidase 1-like              242   6e-72    Setaria italica
ref|XP_002316315.1|  hypothetical protein POPTR_0010s21790g             241   7e-72    Populus trichocarpa [western balsam poplar]
ref|XP_006654923.1|  PREDICTED: beta-hexosaminidase 1-like              242   8e-72    Oryza brachyantha
ref|NP_001147583.1|  LOC100281192 precursor                             241   1e-71    Zea mays [maize]
ref|XP_004497309.1|  PREDICTED: beta-hexosaminidase 1-like              241   2e-71    Cicer arietinum [garbanzo]
ref|XP_002282535.1|  PREDICTED: beta-hexosaminidase 1                   241   2e-71    Vitis vinifera
ref|XP_010504376.1|  PREDICTED: beta-hexosaminidase 1-like              240   2e-71    Camelina sativa [gold-of-pleasure]
ref|NP_567017.2|  beta-hexosaminidase 1                                 240   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008647788.1|  PREDICTED: LOC100281192 isoform X1                 241   3e-71    
emb|CAB75760.1|  beta-N-acetylhexosaminidase-like protein               240   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012072944.1|  PREDICTED: beta-hexosaminidase 1                   240   4e-71    Jatropha curcas
ref|XP_004147704.1|  PREDICTED: beta-hexosaminidase 1                   240   4e-71    Cucumis sativus [cucumbers]
ref|XP_010253321.1|  PREDICTED: beta-hexosaminidase 1 isoform X1        242   5e-71    Nelumbo nucifera [Indian lotus]
ref|XP_008461628.1|  PREDICTED: beta-hexosaminidase 1                   239   5e-71    Cucumis melo [Oriental melon]
gb|KEH21878.1|  glycoside hydrolase family 20 domain protein            238   3e-70    Medicago truncatula
ref|XP_011027114.1|  PREDICTED: beta-hexosaminidase 1                   237   5e-70    Populus euphratica
gb|KJB73732.1|  hypothetical protein B456_011G246500                    237   6e-70    Gossypium raimondii
dbj|BAE99290.1|  beta-N-acetylhexosaminidase -like protein              236   1e-69    Arabidopsis thaliana [mouse-ear cress]
gb|AFK39607.1|  unknown                                                 233   2e-68    Medicago truncatula
ref|XP_008810522.1|  PREDICTED: beta-hexosaminidase 1-like              221   1e-67    
ref|XP_004347426.1|  beta-hexosaminidase subunit beta                   222   1e-64    Capsaspora owczarzaki ATCC 30864
ref|XP_002982865.1|  hypothetical protein SELMODRAFT_117332             217   8e-64    
gb|KDO67769.1|  hypothetical protein CISIN_1g0088211mg                  217   8e-63    Citrus sinensis [apfelsine]
ref|XP_002531964.1|  beta-hexosaminidase, putative                      204   3e-61    
ref|XP_009388075.1|  PREDICTED: beta-hexosaminidase 3-like              202   3e-61    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC71936.1|  hypothetical protein OsI_04746                          208   2e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_009383360.1|  PREDICTED: beta-hexosaminidase 3-like              196   5e-59    
ref|XP_010040776.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    196   9e-57    
gb|KCW44937.1|  hypothetical protein EUGRSUZ_L01476                     193   4e-56    Eucalyptus grandis [rose gum]
ref|XP_002990966.1|  hypothetical protein SELMODRAFT_429306             196   1e-54    
ref|XP_002982864.1|  hypothetical protein SELMODRAFT_422139             194   1e-53    
ref|XP_002982872.1|  hypothetical protein SELMODRAFT_422155             189   2e-52    
emb|CBK19885.2|  unnamed protein product                                189   3e-52    Blastocystis hominis
ref|WP_028831726.1|  hypothetical protein                               180   3e-49    
ref|XP_002990975.1|  hypothetical protein SELMODRAFT_429321             178   2e-48    
ref|XP_010096667.1|  Beta-hexosaminidase subunit                        172   2e-48    
ref|XP_001745279.1|  hypothetical protein                               175   7e-48    Monosiga brevicollis MX1
ref|XP_004994812.1|  hypothetical protein PTSG_03917                    178   1e-47    Salpingoeca rosetta
ref|XP_007009544.1|  Beta-hexosaminidase 1 isoform 3                    174   3e-47    
emb|CBK22342.2|  unnamed protein product                                176   4e-47    Blastocystis hominis
ref|XP_002990967.1|  hypothetical protein SELMODRAFT_429308             175   6e-47    
gb|ETO34651.1|  beta-hexosaminidase                                     165   3e-46    Reticulomyxa filosa
ref|XP_009038483.1|  hypothetical protein AURANDRAFT_28648              172   8e-46    Aureococcus anophagefferens
gb|EMT33327.1|  Beta-hexosaminidase subunit B2                          155   2e-40    
gb|EFA84209.1|  beta-N-acetylhexosaminidase                             158   1e-39    Heterostelium album PN500
ref|XP_002990916.1|  hypothetical protein SELMODRAFT_429325             150   3e-37    
gb|EYU39499.1|  hypothetical protein MIMGU_mgv1a004365mg                146   4e-37    Erythranthe guttata [common monkey flower]
gb|ETO08778.1|  hypothetical protein RFI_28610                          142   4e-37    Reticulomyxa filosa
ref|XP_007478591.1|  PREDICTED: beta-hexosaminidase subunit alpha       141   1e-34    Monodelphis domestica
emb|CBK19718.2|  unnamed protein product                                144   1e-34    Blastocystis hominis
ref|XP_004628811.1|  PREDICTED: beta-hexosaminidase subunit alpha       139   6e-34    Octodon degus
ref|XP_005393661.1|  PREDICTED: beta-hexosaminidase subunit alpha       139   7e-34    Chinchilla lanigera
gb|KJB14662.1|  hypothetical protein B456_002G136400                    137   1e-33    Gossypium raimondii
ref|XP_004855581.1|  PREDICTED: beta-hexosaminidase subunit alpha...    137   2e-33    
ref|XP_008149598.1|  PREDICTED: beta-hexosaminidase subunit alpha       137   2e-33    Eptesicus fuscus
gb|AAH21030.1|  HEXA protein                                            134   2e-33    synthetic construct
dbj|BAK63426.1|  beta-hexosaminidase alpha chain precursor              135   3e-33    Pan troglodytes
ref|XP_006087896.1|  PREDICTED: beta-hexosaminidase subunit alpha       137   3e-33    Myotis lucifugus
ref|XP_008629505.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   3e-33    
gb|EHB08675.1|  Beta-hexosaminidase subunit alpha                       136   3e-33    Heterocephalus glaber [naked mole rat]
gb|EPQ18046.1|  Beta-hexosaminidase subunit alpha                       136   4e-33    Myotis brandtii
ref|XP_005882901.1|  PREDICTED: beta-hexosaminidase subunit alpha       136   5e-33    Myotis brandtii
ref|XP_004893525.1|  PREDICTED: beta-hexosaminidase subunit alpha       136   6e-33    
ref|XP_005316823.1|  PREDICTED: beta-hexosaminidase subunit alpha       136   6e-33    Ictidomys tridecemlineatus
ref|XP_010625459.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   6e-33    Fukomys damarensis [Damara mole rat]
ref|XP_003755208.1|  PREDICTED: beta-hexosaminidase subunit alpha       136   8e-33    Sarcophilus harrisii
ref|XP_011947909.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   8e-33    Cercocebus atys
gb|KFO57282.1|  Beta-hexosaminidase subunit alpha                       135   8e-33    Corvus brachyrhynchos
gb|AAH01138.2|  HEXA protein                                            134   8e-33    Homo sapiens [man]
gb|KFQ33085.1|  Beta-hexosaminidase subunit alpha                       135   1e-32    Merops nubicus
ref|XP_007118442.1|  PREDICTED: beta-hexosaminidase subunit alpha       133   1e-32    
gb|AAA51827.1|  N-acetyl-alpha-glucosaminidase prepro-polypeptide       135   1e-32    Homo sapiens [man]
gb|AAV34701.1|  beta-hexosaminidase alpha-subunit                       135   1e-32    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008942185.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   1e-32    Merops nubicus
gb|AAD13932.1|1680052_1  lysosomal enzyme beta-N-acetylhexosamini...    135   2e-32    Homo sapiens [man]
ref|XP_003818608.1|  PREDICTED: beta-hexosaminidase subunit alpha...    135   2e-32    Pan paniscus [bonobo]
pdb|2GK1|A  Chain A, X-Ray Crystal Structure Of Ngt-Bound Hexa          134   2e-32    Homo sapiens [man]
dbj|BAG62619.1|  unnamed protein product                                135   2e-32    Homo sapiens [man]
ref|XP_010410730.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   2e-32    
ref|XP_005917247.1|  PREDICTED: beta-hexosaminidase subunit beta-...    135   2e-32    Haplochromis burtoni
emb|CAH10482.1|  hypothetical protein                                   134   2e-32    Homo sapiens [man]
ref|XP_003267055.2|  PREDICTED: beta-hexosaminidase subunit alpha       134   2e-32    
ref|XP_004056493.1|  PREDICTED: beta-hexosaminidase subunit alpha...    134   2e-32    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_009383359.1|  PREDICTED: beta-hexosaminidase 3-like              134   2e-32    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002717746.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   2e-32    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008071061.1|  PREDICTED: beta-hexosaminidase subunit alpha...    132   2e-32    Carlito syrichta
ref|NP_000511.2|  beta-hexosaminidase subunit alpha preproprotein       134   2e-32    Homo sapiens [man]
ref|XP_004056494.1|  PREDICTED: beta-hexosaminidase subunit alpha...    134   2e-32    
ref|XP_005720244.1|  PREDICTED: beta-hexosaminidase subunit beta-...    134   2e-32    Pundamilia nyererei
ref|XP_006753040.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   2e-32    Myotis davidii
ref|XP_003449709.1|  PREDICTED: beta-hexosaminidase subunit beta-...    134   3e-32    Oreochromis niloticus
ref|XP_007197822.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   3e-32    Balaenoptera acutorostrata scammoni
ref|XP_007467925.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   3e-32    Lipotes vexillifer [baiji]
ref|NP_001192280.1|  beta-hexosaminidase subunit alpha precursor        134   3e-32    Pongo abelii [orang utan]
ref|XP_008323900.1|  PREDICTED: beta-hexosaminidase subunit beta ...    134   3e-32    
ref|XP_010807183.1|  PREDICTED: beta-hexosaminidase subunit alpha...    132   3e-32    
ref|XP_006796907.1|  PREDICTED: beta-hexosaminidase subunit beta-...    134   4e-32    Neolamprologus brichardi [lyretail cichlid]
ref|NP_001271667.1|  uncharacterized protein LOC101925292 precursor     134   4e-32    Macaca fascicularis [crab eating macaque]
ref|XP_005369558.1|  PREDICTED: beta-hexosaminidase subunit alpha       134   4e-32    Microtus ochrogaster [prairie voles]
ref|NP_001248458.1|  beta-hexosaminidase subunit alpha precursor        134   4e-32    Macaca mulatta [rhesus macaque]
ref|XP_010363113.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   4e-32    Rhinopithecus roxellana
ref|XP_002753354.2|  PREDICTED: beta-hexosaminidase subunit alpha       134   5e-32    Callithrix jacchus [common marmoset]
ref|XP_011833992.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   5e-32    Mandrillus leucophaeus
ref|XP_003901203.1|  PREDICTED: beta-hexosaminidase subunit alpha       133   5e-32    Papio anubis [baboon]
ref|XP_011809216.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   5e-32    Colobus angolensis palliatus
ref|XP_007548936.1|  PREDICTED: beta-hexosaminidase subunit beta ...    133   5e-32    Poecilia formosa
ref|XP_010363112.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   5e-32    Rhinopithecus roxellana
ref|XP_008293712.1|  PREDICTED: beta-hexosaminidase subunit beta ...    133   5e-32    Stegastes partitus
ref|XP_004276318.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    133   5e-32    
ref|XP_008014190.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   5e-32    Chlorocebus sabaeus
gb|EHH27459.1|  hypothetical protein EGK_17654                          133   5e-32    Macaca mulatta [rhesus macaque]
ref|XP_011833991.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   6e-32    Mandrillus leucophaeus
ref|XP_011809215.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   6e-32    Colobus angolensis palliatus
dbj|BAD96222.1|  hexosaminidase A preproprotein variant                 133   6e-32    Homo sapiens [man]
ref|XP_006034690.1|  PREDICTED: beta-hexosaminidase subunit beta        132   7e-32    
ref|XP_005720243.1|  PREDICTED: beta-hexosaminidase subunit beta-...    133   7e-32    Pundamilia nyererei
ref|XP_011223885.1|  PREDICTED: beta-hexosaminidase subunit alpha...    131   8e-32    
ref|XP_005917246.1|  PREDICTED: beta-hexosaminidase subunit beta-...    133   8e-32    Haplochromis burtoni
ref|XP_005007246.1|  PREDICTED: beta-hexosaminidase subunit alpha...    133   8e-32    
gb|KFO38010.1|  Beta-hexosaminidase subunit alpha                       133   8e-32    Fukomys damarensis [Damara mole rat]
ref|XP_003477693.2|  PREDICTED: beta-hexosaminidase subunit alpha...    132   9e-32    Cavia porcellus [guinea pig]
ref|XP_006824994.1|  PREDICTED: beta-hexosaminidase subunit beta-...    133   9e-32    Saccoglossus kowalevskii
ref|XP_005685238.1|  PREDICTED: beta-hexosaminidase subunit alpha...    132   9e-32    Capra hircus [domestic goat]
ref|XP_005685239.1|  PREDICTED: beta-hexosaminidase subunit alpha...    132   1e-31    
ref|XP_002126592.1|  PREDICTED: beta-hexosaminidase subunit alpha       132   1e-31    
ref|XP_003449710.1|  PREDICTED: beta-hexosaminidase subunit beta-...    132   1e-31    Oreochromis niloticus
ref|XP_007548937.1|  PREDICTED: beta-hexosaminidase subunit beta ...    132   1e-31    Poecilia formosa
ref|XP_008525249.1|  PREDICTED: beta-hexosaminidase subunit alpha...    130   1e-31    Equus przewalskii [Przewalski horse]
ref|XP_008421770.1|  PREDICTED: beta-hexosaminidase subunit beta ...    132   1e-31    Poecilia reticulata
ref|XP_005971626.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    132   1e-31    Pantholops hodgsonii [Tibetan antelope]
ref|XP_011223884.1|  PREDICTED: beta-hexosaminidase subunit alpha...    131   1e-31    
ref|XP_004074569.1|  PREDICTED: beta-hexosaminidase subunit beta ...    132   1e-31    Oryzias latipes [Japanese rice fish]
ref|XP_008071051.1|  PREDICTED: beta-hexosaminidase subunit alpha...    132   1e-31    Carlito syrichta
gb|KFM07281.1|  Beta-hexosaminidase subunit alpha                       132   1e-31    Aptenodytes forsteri
ref|NP_001068632.1|  beta-hexosaminidase subunit alpha precursor        132   1e-31    Bos taurus [bovine]
gb|ELR49174.1|  Beta-hexosaminidase subunit alpha                       132   1e-31    Bos mutus
ref|XP_005816509.1|  PREDICTED: beta-hexosaminidase subunit beta-...    131   1e-31    
ref|XP_010114048.1|  PREDICTED: beta-hexosaminidase subunit alpha...    129   1e-31    Chlamydotis macqueenii
ref|XP_009277192.1|  PREDICTED: beta-hexosaminidase subunit alpha       132   1e-31    Aptenodytes forsteri
gb|KFR11707.1|  Beta-hexosaminidase subunit alpha                       131   1e-31    Opisthocomus hoazin [hoatzin]
ref|XP_006056961.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    132   1e-31    
ref|XP_005905661.1|  PREDICTED: beta-hexosaminidase subunit alpha...    132   2e-31    Bos mutus
ref|XP_008421772.1|  PREDICTED: beta-hexosaminidase subunit beta ...    132   2e-31    
ref|XP_006796906.1|  PREDICTED: beta-hexosaminidase subunit beta-...    132   2e-31    
ref|XP_544758.2|  PREDICTED: beta-hexosaminidase subunit alpha          132   2e-31    
ref|XP_004712015.1|  PREDICTED: beta-hexosaminidase subunit alpha       132   2e-31    
ref|XP_009934198.1|  PREDICTED: beta-hexosaminidase subunit alpha       131   2e-31    
ref|XP_011373887.1|  PREDICTED: beta-hexosaminidase subunit alpha       131   3e-31    
ref|XP_008706881.1|  PREDICTED: beta-hexosaminidase subunit alpha       131   3e-31    
ref|XP_007056536.1|  PREDICTED: beta-hexosaminidase subunit alpha       131   3e-31    
ref|XP_009318194.1|  PREDICTED: beta-hexosaminidase subunit alpha       131   3e-31    
ref|NP_001119815.1|  beta-hexosaminidase subunit alpha precursor        131   3e-31    
ref|XP_006922713.1|  PREDICTED: beta-hexosaminidase subunit alpha       131   3e-31    
ref|XP_012150681.1|  PREDICTED: beta-hexosaminidase subunit alpha...    131   3e-31    
ref|XP_002121203.2|  PREDICTED: beta-hexosaminidase subunit alpha...    131   3e-31    
ref|XP_008593170.1|  PREDICTED: beta-hexosaminidase subunit alpha       131   3e-31    
ref|XP_005017277.1|  PREDICTED: beta-hexosaminidase subunit alpha       130   4e-31    
ref|XP_007668444.1|  PREDICTED: beta-hexosaminidase subunit alpha...    127   5e-31    
gb|KFO95265.1|  Beta-hexosaminidase subunit alpha                       129   5e-31    
gb|KFV16838.1|  Beta-hexosaminidase subunit alpha                       130   5e-31    
ref|XP_003929709.1|  PREDICTED: beta-hexosaminidase subunit alpha       130   5e-31    
ref|XP_006197724.1|  PREDICTED: beta-hexosaminidase subunit beta        130   6e-31    
ref|XP_006213800.1|  PREDICTED: beta-hexosaminidase subunit alpha...    128   6e-31    
ref|XP_001494361.1|  PREDICTED: beta-hexosaminidase subunit alpha       130   6e-31    
ref|XP_009982998.1|  PREDICTED: beta-hexosaminidase subunit alpha       130   7e-31    
ref|XP_008525251.1|  PREDICTED: beta-hexosaminidase subunit alpha...    130   7e-31    
emb|CDQ79278.1|  unnamed protein product                                130   7e-31    
ref|XP_003784529.1|  PREDICTED: beta-hexosaminidase subunit alpha       130   7e-31    
ref|XP_010160765.1|  PREDICTED: beta-hexosaminidase subunit alpha       128   7e-31    
ref|XP_004666704.1|  PREDICTED: beta-hexosaminidase subunit alpha       132   7e-31    
ref|XP_010116904.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    129   7e-31    
ref|XP_006561863.1|  PREDICTED: beta-hexosaminidase subunit beta-...    130   8e-31    
ref|XP_003413972.1|  PREDICTED: beta-hexosaminidase subunit alpha       130   8e-31    
ref|XP_010783339.1|  PREDICTED: beta-hexosaminidase subunit beta ...    128   8e-31    
ref|XP_004415395.1|  PREDICTED: beta-hexosaminidase subunit alpha...    130   8e-31    
ref|XP_008489455.1|  PREDICTED: beta-hexosaminidase subunit alpha       129   8e-31    
ref|XP_007084734.1|  PREDICTED: beta-hexosaminidase subunit alpha       130   9e-31    
gb|KFU95826.1|  Beta-hexosaminidase subunit alpha                       129   9e-31    
dbj|BAE39189.1|  unnamed protein product                                130   9e-31    
ref|XP_008293711.1|  PREDICTED: beta-hexosaminidase subunit beta ...    130   9e-31    
ref|XP_003427857.1|  PREDICTED: beta-hexosaminidase subunit beta-...    130   9e-31    
ref|XP_001513475.2|  PREDICTED: beta-hexosaminidase subunit beta        130   9e-31    
dbj|BAE30831.1|  unnamed protein product                                130   9e-31    
ref|XP_006789340.1|  PREDICTED: beta-hexosaminidase subunit alpha...    130   9e-31    
dbj|BAE40146.1|  unnamed protein product                                130   9e-31    
ref|XP_006731338.1|  PREDICTED: beta-hexosaminidase subunit alpha       129   1e-30    
dbj|BAE29566.1|  unnamed protein product                                129   1e-30    
ref|NP_034551.2|  beta-hexosaminidase subunit alpha precursor           129   1e-30    
emb|CAA45615.1|  beta-N-acetylhexosaminidase                            129   1e-30    
ref|XP_004415396.1|  PREDICTED: beta-hexosaminidase subunit alpha...    129   1e-30    
dbj|BAE35636.1|  unnamed protein product                                129   1e-30    
dbj|BAE34808.1|  unnamed protein product                                129   1e-30    
ref|XP_003785963.1|  PREDICTED: beta-hexosaminidase subunit beta        129   1e-30    
ref|XP_006032375.1|  PREDICTED: beta-hexosaminidase subunit alpha       129   1e-30    
ref|XP_010715422.1|  PREDICTED: beta-hexosaminidase subunit alpha       129   1e-30    
ref|NP_001142218.1|  uncharacterized protein LOC100274386               129   1e-30    
dbj|BAC38018.1|  unnamed protein product                                129   1e-30    
ref|XP_006277165.1|  PREDICTED: beta-hexosaminidase subunit alpha       131   1e-30    
ref|NP_001025561.1|  beta-hexosaminidase subunit alpha precursor        129   1e-30    
gb|KFV89811.1|  Beta-hexosaminidase subunit alpha                       129   1e-30    
ref|XP_003690301.1|  PREDICTED: beta-hexosaminidase subunit beta-...    129   1e-30    
ref|XP_010391094.1|  PREDICTED: beta-hexosaminidase subunit beta        127   1e-30    
ref|XP_010004236.1|  PREDICTED: beta-hexosaminidase subunit alpha       129   1e-30    
ref|XP_005051878.1|  PREDICTED: beta-hexosaminidase subunit alpha       129   1e-30    
gb|KFO06345.1|  Beta-hexosaminidase subunit alpha                       129   1e-30    
ref|XP_009934731.1|  PREDICTED: beta-hexosaminidase subunit beta        127   1e-30    
ref|XP_010160160.1|  PREDICTED: beta-hexosaminidase subunit alpha       129   2e-30    
ref|XP_009488711.1|  PREDICTED: beta-hexosaminidase subunit alpha       129   2e-30    
ref|XP_010876598.1|  PREDICTED: beta-hexosaminidase subunit beta        129   2e-30    
ref|XP_004553154.1|  PREDICTED: beta-hexosaminidase subunit alpha...    129   2e-30    
ref|XP_005928844.1|  PREDICTED: beta-hexosaminidase subunit alpha...    129   2e-30    
ref|XP_008636857.1|  PREDICTED: beta-hexosaminidase subunit beta        128   2e-30    
gb|KFZ49896.1|  Beta-hexosaminidase subunit alpha                       128   2e-30    
ref|XP_637108.1|  hypothetical protein DDB_G0287659                     129   2e-30    
ref|XP_010308721.1|  PREDICTED: beta-hexosaminidase subunit alpha       128   2e-30    
ref|NP_001004443.1|  beta-hexosaminidase subunit alpha precursor        129   2e-30    
ref|XP_009882561.1|  PREDICTED: beta-hexosaminidase subunit beta        127   2e-30    
ref|XP_010823012.1|  PREDICTED: beta-hexosaminidase subunit beta-...    125   3e-30    
gb|KFW81131.1|  Beta-hexosaminidase subunit alpha                       128   3e-30    
ref|XP_005824481.1|  hypothetical protein GUITHDRAFT_78031              128   3e-30    
ref|XP_002601536.1|  hypothetical protein BRAFLDRAFT_230606             128   3e-30    
ref|XP_008834662.1|  PREDICTED: beta-hexosaminidase subunit alpha...    126   3e-30    
ref|XP_005141356.1|  PREDICTED: beta-hexosaminidase subunit alpha       128   3e-30    
ref|XP_008323899.1|  PREDICTED: beta-hexosaminidase subunit beta ...    128   3e-30    
ref|XP_008922374.1|  PREDICTED: beta-hexosaminidase subunit alpha       128   3e-30    
ref|XP_004586323.1|  PREDICTED: beta-hexosaminidase subunit beta        128   3e-30    
gb|KGL88416.1|  Beta-hexosaminidase subunit alpha                       127   3e-30    
ref|XP_011587909.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   3e-30    
gb|KFQ77035.1|  Beta-hexosaminidase subunit alpha                       127   3e-30    
gb|KFW05233.1|  Beta-hexosaminidase subunit alpha                       127   4e-30    
dbj|BAE35457.1|  unnamed protein product                                128   4e-30    
gb|KFP53331.1|  Beta-hexosaminidase subunit alpha                       127   4e-30    
ref|XP_008165744.1|  PREDICTED: beta-hexosaminidase subunit beta ...    126   4e-30    
ref|XP_007259695.1|  PREDICTED: beta-hexosaminidase subunit beta ...    128   4e-30    
ref|XP_005521771.1|  PREDICTED: beta-hexosaminidase subunit alpha       128   4e-30    
ref|XP_009893877.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   4e-30    
ref|XP_004611783.1|  PREDICTED: beta-hexosaminidase subunit alpha...    128   4e-30    
gb|KFV81733.1|  Beta-hexosaminidase subunit alpha                       127   4e-30    
gb|KFP70941.1|  Beta-hexosaminidase subunit alpha                       127   4e-30    
ref|NP_001135106.1|  Beta-hexosaminidase beta chain precursor           128   4e-30    
ref|XP_006182080.1|  PREDICTED: beta-hexosaminidase subunit alpha...    126   4e-30    
ref|XP_004611784.1|  PREDICTED: beta-hexosaminidase subunit alpha...    128   5e-30    
ref|XP_010947593.1|  PREDICTED: beta-hexosaminidase subunit beta        127   5e-30    
ref|XP_010221794.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    126   5e-30    
ref|XP_010973301.1|  PREDICTED: beta-hexosaminidase subunit beta        127   5e-30    
ref|XP_010287454.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   5e-30    
ref|XP_011588732.1|  PREDICTED: beta-hexosaminidase subunit beta ...    128   5e-30    
ref|XP_007064575.1|  PREDICTED: beta-hexosaminidase subunit beta        128   5e-30    
ref|XP_006122259.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   5e-30    
ref|XP_004611782.1|  PREDICTED: beta-hexosaminidase subunit alpha...    127   5e-30    
ref|XP_004758416.1|  PREDICTED: beta-hexosaminidase subunit alpha       128   5e-30    
ref|XP_010754177.1|  PREDICTED: beta-hexosaminidase subunit beta        128   5e-30    
ref|XP_005470746.1|  PREDICTED: beta-hexosaminidase subunit alpha...    127   5e-30    
ref|XP_009576431.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   5e-30    
ref|XP_010581112.1|  PREDICTED: beta-hexosaminidase subunit beta        128   5e-30    
ref|XP_009077712.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   5e-30    
ref|NP_001265764.1|  beta-hexosaminidase subunit alpha precursor        127   5e-30    
ref|XP_010864647.1|  PREDICTED: beta-hexosaminidase subunit alpha...    127   6e-30    
ref|XP_004421836.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   6e-30    
ref|XP_009088344.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   7e-30    
ref|XP_009674017.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   7e-30    
dbj|BAM48826.1|  beta-N-acetylhexosaminidase beta subunit mRNA, p...    127   7e-30    
ref|XP_008834660.1|  PREDICTED: beta-hexosaminidase subunit alpha...    127   7e-30    
gb|KFR02044.1|  Beta-hexosaminidase subunit alpha                       126   8e-30    
ref|XP_010285782.1|  PREDICTED: beta-hexosaminidase subunit beta        127   8e-30    
ref|XP_005232665.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   8e-30    
ref|XP_008561214.1|  PREDICTED: beta-hexosaminidase subunit beta-...    127   8e-30    
ref|XP_011137428.1|  PREDICTED: beta-hexosaminidase subunit beta-...    127   8e-30    
ref|XP_005329008.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    127   8e-30    
ref|XP_005437573.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   8e-30    
ref|XP_009467999.1|  PREDICTED: beta-hexosaminidase subunit alpha       127   9e-30    
dbj|BAM48827.1|  beta-N-acetylhexosaminidase beta subunit, exons ...    126   9e-30    
ref|XP_005244669.1|  PREDICTED: LOW QUALITY PROTEIN: hexosaminida...    126   9e-30    
ref|XP_010181240.1|  PREDICTED: beta-hexosaminidase subunit alpha       126   9e-30    
ref|XP_009504844.1|  PREDICTED: beta-hexosaminidase subunit beta        126   9e-30    
ref|XP_006195435.1|  PREDICTED: beta-hexosaminidase subunit beta        128   9e-30    
gb|KFP20045.1|  Beta-hexosaminidase subunit alpha                       126   1e-29    
ref|XP_005522781.1|  PREDICTED: beta-hexosaminidase subunit beta        127   1e-29    
ref|XP_010168230.1|  PREDICTED: beta-hexosaminidase subunit beta        125   1e-29    
ref|XP_011641273.1|  PREDICTED: beta-hexosaminidase subunit beta-...    127   1e-29    
ref|XP_005647988.1|  putative beta-N-acetylhexosaminidase               125   1e-29    
ref|XP_008834657.1|  PREDICTED: beta-hexosaminidase subunit alpha...    126   1e-29    
ref|XP_009464152.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    125   1e-29    
ref|XP_005386118.1|  PREDICTED: beta-hexosaminidase subunit beta        126   1e-29    
ref|XP_009555937.1|  PREDICTED: beta-hexosaminidase subunit beta        126   1e-29    
ref|XP_009299723.1|  PREDICTED: beta-hexosaminidase subunit beta ...    126   1e-29    
ref|XP_005512252.1|  PREDICTED: beta-hexosaminidase subunit alpha       126   1e-29    
gb|EFA05959.1|  hypothetical protein TcasGA2_TC008777                   126   1e-29    
ref|XP_009686822.1|  PREDICTED: beta-hexosaminidase subunit beta        126   1e-29    
ref|XP_975658.1|  PREDICTED: beta-hexosaminidase subunit alpha-like     126   1e-29    
ref|XP_008165019.1|  PREDICTED: beta-hexosaminidase subunit alpha...    125   1e-29    
ref|XP_010191989.1|  PREDICTED: beta-hexosaminidase subunit beta        124   1e-29    
ref|NP_001108317.1|  beta-hexosaminidase subunit beta precursor         126   1e-29    
ref|XP_008165021.1|  PREDICTED: beta-hexosaminidase subunit alpha...    125   1e-29    
ref|XP_009642066.1|  PREDICTED: beta-hexosaminidase subunit alpha       126   1e-29    
ref|XP_010008364.1|  PREDICTED: beta-hexosaminidase subunit beta        124   1e-29    
ref|XP_009635526.1|  PREDICTED: beta-hexosaminidase subunit beta        124   1e-29    
gb|ERL85065.1|  hypothetical protein D910_02488                         126   2e-29    
ref|XP_010976232.1|  PREDICTED: beta-hexosaminidase subunit alpha       126   2e-29    
ref|XP_006124343.1|  PREDICTED: beta-hexosaminidase subunit beta        124   2e-29    
ref|XP_005440860.1|  PREDICTED: beta-hexosaminidase subunit beta        125   2e-29    
ref|XP_009701401.1|  PREDICTED: beta-hexosaminidase subunit beta        125   2e-29    
ref|XP_005617969.1|  PREDICTED: beta-hexosaminidase subunit beta        126   2e-29    
gb|KFP66480.1|  Beta-hexosaminidase subunit beta                        125   2e-29    
ref|XP_004687558.1|  PREDICTED: beta-hexosaminidase subunit alpha       126   2e-29    
ref|XP_003488866.1|  PREDICTED: beta-hexosaminidase subunit beta-...    126   2e-29    
gb|KFV00576.1|  Beta-hexosaminidase subunit alpha                       125   2e-29    
gb|KFZ60094.1|  Beta-hexosaminidase subunit beta                        125   2e-29    
ref|XP_003965306.1|  PREDICTED: beta-hexosaminidase subunit beta ...    126   2e-29    
ref|NP_001278933.1|  beta-hexosaminidase subunit beta isoform 2         124   2e-29    
ref|NP_001116693.1|  beta-hexosaminidase subunit alpha precursor        126   2e-29    
gb|AJO25046.1|  beta-N-acetylhexosaminidase                             126   2e-29    
ref|XP_010783338.1|  PREDICTED: beta-hexosaminidase subunit beta ...    124   2e-29    
ref|XP_005288318.1|  PREDICTED: beta-hexosaminidase subunit beta ...    126   2e-29    
ref|XP_009974433.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    124   2e-29    
emb|CAG05204.1|  unnamed protein product                                126   2e-29    
ref|XP_009092241.1|  PREDICTED: beta-hexosaminidase subunit beta        124   2e-29    
ref|XP_006610098.1|  PREDICTED: beta-hexosaminidase subunit beta-...    126   2e-29    
gb|KFV67759.1|  Beta-hexosaminidase subunit alpha                       125   2e-29    
ref|XP_003397815.1|  PREDICTED: beta-hexosaminidase subunit beta-...    126   2e-29    
ref|XP_004374779.1|  PREDICTED: beta-hexosaminidase subunit alpha...    125   2e-29    
ref|XP_004374778.1|  PREDICTED: beta-hexosaminidase subunit alpha...    125   2e-29    
ref|XP_009705516.1|  PREDICTED: beta-hexosaminidase subunit alpha       125   3e-29    
ref|XP_004420596.1|  PREDICTED: beta-hexosaminidase subunit beta        126   3e-29    
ref|XP_004374780.1|  PREDICTED: beta-hexosaminidase subunit alpha...    125   3e-29    
ref|XP_010079481.1|  PREDICTED: beta-hexosaminidase subunit alpha       125   3e-29    
ref|XP_008275046.1|  PREDICTED: beta-hexosaminidase subunit alpha...    125   3e-29    
emb|CAD57204.1|  putative beta-N-acetylhexosaminidase                   125   3e-29    
ref|XP_009990218.1|  PREDICTED: beta-hexosaminidase subunit beta        125   3e-29    
ref|XP_010138334.1|  PREDICTED: beta-hexosaminidase subunit beta        125   3e-29    
ref|XP_009899325.1|  PREDICTED: beta-hexosaminidase subunit alpha       125   3e-29    
ref|XP_003498963.1|  PREDICTED: beta-hexosaminidase subunit alpha       125   3e-29    
gb|ENN72853.1|  hypothetical protein YQE_10502                          125   3e-29    
gb|KFZ56922.1|  Beta-hexosaminidase subunit alpha                       124   4e-29    
ref|XP_010148207.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    124   4e-29    
ref|XP_005425987.1|  PREDICTED: beta-hexosaminidase subunit alpha       124   4e-29    
ref|XP_005281047.1|  PREDICTED: beta-hexosaminidase subunit alpha...    125   4e-29    
gb|ERL85064.1|  hypothetical protein D910_02487                         125   4e-29    
ref|XP_005428333.1|  PREDICTED: beta-hexosaminidase subunit beta        124   4e-29    
gb|AAV34702.1|  beta-hexosaminidase beta-subunit                        124   4e-29    
gb|ELU13491.1|  hypothetical protein CAPTEDRAFT_183554                  125   4e-29    
ref|XP_006866634.1|  PREDICTED: beta-hexosaminidase subunit alpha       125   5e-29    
gb|KFP93349.1|  Beta-hexosaminidase subunit alpha                       124   5e-29    
gb|ERE76429.1|  beta-hexosaminidase subunit alpha                       125   5e-29    
ref|XP_010815004.1|  PREDICTED: beta-hexosaminidase subunit beta ...    125   5e-29    
ref|XP_006874473.1|  PREDICTED: beta-hexosaminidase subunit beta        125   5e-29    
ref|XP_010205184.1|  PREDICTED: beta-hexosaminidase subunit alpha       124   5e-29    
ref|XP_004999983.1|  PREDICTED: beta-hexosaminidase subunit beta        124   5e-29    
gb|KFP33741.1|  Beta-hexosaminidase subunit alpha                       124   5e-29    
ref|XP_009876214.1|  PREDICTED: beta-hexosaminidase subunit beta        123   5e-29    
ref|XP_011479800.1|  PREDICTED: beta-hexosaminidase subunit beta ...    125   5e-29    
ref|XP_009910825.1|  PREDICTED: beta-hexosaminidase subunit alpha...    124   6e-29    
gb|KFO92138.1|  Beta-hexosaminidase subunit beta                        124   6e-29    
ref|XP_005069690.1|  PREDICTED: beta-hexosaminidase subunit alpha       124   6e-29    
ref|XP_005141195.1|  PREDICTED: LOW QUALITY PROTEIN: beta-hexosam...    125   7e-29    
ref|NP_001133930.1|  beta-hexosaminidase subunit beta                   124   7e-29    
ref|XP_010208801.1|  PREDICTED: beta-hexosaminidase subunit beta        124   7e-29    
ref|XP_009949918.1|  PREDICTED: beta-hexosaminidase subunit beta        124   7e-29    
ref|XP_011171063.1|  PREDICTED: beta-hexosaminidase subunit beta-...    124   7e-29    
pdb|1O7A|A  Chain A, Human Beta-Hexosaminidase B                        124   8e-29    
pdb|2GK1|B  Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa          124   8e-29    Homo sapiens [man]
ref|XP_004887612.1|  PREDICTED: beta-hexosaminidase subunit beta        124   8e-29    
gb|AAA68620.1|  beta-hexosaminidase beta-subunit                        124   8e-29    



>ref|XP_002265945.3| PREDICTED: beta-hexosaminidase 3-like, partial [Vitis vinifera]
Length=275

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/222 (80%), Positives = 199/222 (90%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK FKY+FVHLGGDEVNT+CWT TP I KWL+    D   AYQYFVL+AQKIALSHGYE
Sbjct  54   FSKTFKYRFVHLGGDEVNTSCWTETPHIRKWLRQHGLDTSGAYQYFVLRAQKIALSHGYE  113

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFN+FG+KLSRKTVVHNWLGGG+A++VVAAGLRCIVSNQD+WYLDHLDAPW+GF
Sbjct  114  IINWEETFNDFGSKLSRKTVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHLDAPWEGF  173

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT+ + Q L+LGGEVCMWGE+IDASDIEQTIWPRAAAAAERLW++ +NL  D
Sbjct  174  YMNEPLTNITNHQQQKLILGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWSAYDNLAKD  233

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P++V GRLAHFRCLLNQRGVAAAPLVG GR APE+PGSC+ Q
Sbjct  234  PSQVFGRLAHFRCLLNQRGVAAAPLVGPGRVAPEEPGSCYKQ  275



>ref|XP_011077093.1| PREDICTED: beta-hexosaminidase 3 [Sesamum indicum]
 ref|XP_011077094.1| PREDICTED: beta-hexosaminidase 3 [Sesamum indicum]
Length=532

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/222 (81%), Positives = 196/222 (88%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKYKF+HLGGDEVNT+CW STP +  WL+    DG +AYQYFVL+AQKIALSHGYE
Sbjct  311  FSKIFKYKFIHLGGDEVNTSCWQSTPHVRTWLRRHGMDGSKAYQYFVLRAQKIALSHGYE  370

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KLSRKTVVHNWLG G+AQQVV AGLRCIVSNQD+WYLDHLDA W  F
Sbjct  371  IINWEETFNNFGSKLSRKTVVHNWLGSGVAQQVVKAGLRCIVSNQDKWYLDHLDALWQDF  430

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NITDP+ QALVLGGEVC WGE+IDASDIEQTIWPRAAAAAERLWTS E L  D
Sbjct  431  YTNEPLTNITDPRQQALVLGGEVCAWGEHIDASDIEQTIWPRAAAAAERLWTSYEKLAKD  490

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P +V GRL++FRCLLNQRGVAAAPL G GR APE+PGSC+LQ
Sbjct  491  PEQVRGRLSYFRCLLNQRGVAAAPLDGLGRAAPEEPGSCYLQ  532



>ref|XP_010646460.1| PREDICTED: beta-hexosaminidase 3-like [Vitis vinifera]
Length=522

 Score =   355 bits (912),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 177/222 (80%), Positives = 199/222 (90%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK FKY+FVHLGGDEVNT+CWT TP I KWL+    D   AYQYFVL+AQKIALSHGYE
Sbjct  301  FSKTFKYRFVHLGGDEVNTSCWTETPHIRKWLRQHGLDTSGAYQYFVLRAQKIALSHGYE  360

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFN+FG+KLSRKTVVHNWLGGG+A++VVAAGLRCIVSNQD+WYLDHLDAPW+GF
Sbjct  361  IINWEETFNDFGSKLSRKTVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHLDAPWEGF  420

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT+ + Q L+LGGEVCMWGE+IDASDIEQTIWPRAAAAAERLW++ +NL  D
Sbjct  421  YMNEPLTNITNHQQQKLILGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWSAYDNLAKD  480

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P++V GRLAHFRCLLNQRGVAAAPLVG GR APE+PGSC+ Q
Sbjct  481  PSQVFGRLAHFRCLLNQRGVAAAPLVGPGRVAPEEPGSCYKQ  522



>ref|XP_002311272.2| hypothetical protein POPTR_0008s07890g [Populus trichocarpa]
 gb|EEE88639.2| hypothetical protein POPTR_0008s07890g [Populus trichocarpa]
Length=528

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/222 (79%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEV+ +CWT TP I KWLK    +G QAYQYFVL+AQKIALSHG+E
Sbjct  307  FSKIFKFKFVHLGGDEVDPSCWTKTPHITKWLKEHRMNGSQAYQYFVLRAQKIALSHGFE  366

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFN+F NKLSRKTVVHNWLGGG+A+QVVA+GLRCIVSNQD+WYLDHLD PW+ F
Sbjct  367  IVNWEETFNDFRNKLSRKTVVHNWLGGGVAEQVVASGLRCIVSNQDKWYLDHLDTPWEEF  426

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT+P+ Q+LVLGGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  427  YKNEPLTNITNPEQQSLVLGGEVCMWGETVDGSDIEQTIWPRAAAAAERLWTPYDKLAKD  486

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P KVAGRLAHFRCLLNQRGVAAAPL G GRGAP +PGSC+ Q
Sbjct  487  PEKVAGRLAHFRCLLNQRGVAAAPLAGPGRGAPIEPGSCYGQ  528



>ref|XP_011010798.1| PREDICTED: beta-hexosaminidase 3 [Populus euphratica]
Length=527

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 194/222 (87%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEV+ +CWT TP I KWLK    +G QAYQYFVL+AQKIALSHG+E
Sbjct  306  FSKIFKFKFVHLGGDEVDPSCWTKTPHITKWLKEHRMNGSQAYQYFVLRAQKIALSHGFE  365

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFN F NKLSRKTVVHNWLGGG+A+QVVA+GLRCIVSN+D+WYLDHLD PW+ F
Sbjct  366  IVNWEETFNGFRNKLSRKTVVHNWLGGGVAEQVVASGLRCIVSNEDKWYLDHLDTPWEEF  425

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT P+ Q+LVLGGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  426  YKNEPLTNITKPEQQSLVLGGEVCMWGEKVDGSDIEQTIWPRAAAAAERLWTPYDKLAKD  485

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P KVAGRLAHFRCLLNQRGVAAAPL G GRGAP +PGSC++Q
Sbjct  486  PEKVAGRLAHFRCLLNQRGVAAAPLAGPGRGAPIEPGSCYVQ  527



>gb|AAB60911.1| ESTs gb|T43256,gb|46316,gb|N64930,gb|AA395255,gb|AA404382 come 
from this gene [Arabidopsis thaliana]
Length=397

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 188/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK      ++AYQYFVL+AQKIALSHGYE
Sbjct  176  FSKIFKFKFVHLGGDEVNTTCWSATPRIAQWLKKHRMSEKEAYQYFVLRAQKIALSHGYE  235

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETF NFG+KL+RKTVVHNWL  GL + V A+GLRCIVSNQ+ WYLDH+DAPW GF
Sbjct  236  IINWEETFINFGSKLNRKTVVHNWLNTGLVENVTASGLRCIVSNQEFWYLDHIDAPWQGF  295

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEP  NITD K Q+LVLGGEVCMWGE+IDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  296  YANEPFQNITDKKQQSLVLGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTPYAKLAKN  355

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            PN V  RLAHFRCLLNQRGVAAAPLVG GR  P +PGSC  Q
Sbjct  356  PNNVTTRLAHFRCLLNQRGVAAAPLVGGGRVVPFEPGSCLAQ  397



>ref|XP_010496066.1| PREDICTED: beta-hexosaminidase 3 [Camelina sativa]
Length=535

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK      ++AYQYFVL+AQKIALSHGYE
Sbjct  314  FSKIFKFKFVHLGGDEVNTTCWSATPRIAQWLKKHRMSEEEAYQYFVLRAQKIALSHGYE  373

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL+ KTVVHNWLG G+ ++V A+GLRCIVSNQD+WYLDH+DAPW GF
Sbjct  374  IINWEETFNNFGSKLNPKTVVHNWLGTGVVERVTASGLRCIVSNQDKWYLDHIDAPWQGF  433

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL +I D K Q+LVLGGEVCMWGE+IDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  434  YDNEPLQDIKDKKQQSLVLGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTPYAKLATN  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLLNQRGVAAAPLVG GR  P +PGSC  Q
Sbjct  494  PDKVTTRLAHFRCLLNQRGVAAAPLVGGGRVVPLEPGSCLAQ  535



>ref|XP_010528624.1| PREDICTED: beta-hexosaminidase 3, partial [Tarenaya hassleriana]
Length=497

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNTTCW++TPRI KWL+       QAYQYFVL+AQ+IALSHGYE
Sbjct  276  FSKVFKFKFVHLGGDEVNTTCWSTTPRIAKWLRRHRMSELQAYQYFVLRAQRIALSHGYE  335

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG KLSRKTVVHNWLG G+A++V  +GLRCIVSNQD+WYLDH+D PW+ F
Sbjct  336  VINWEETFNNFGKKLSRKTVVHNWLGAGVAEEVTRSGLRCIVSNQDKWYLDHIDTPWESF  395

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL+NIT+ + Q LVLGGEVC WGE+IDASDIEQTIWPRAAAAAERLWT+ + L +D
Sbjct  396  YMNEPLENITNHEQQRLVLGGEVCAWGEHIDASDIEQTIWPRAAAAAERLWTTYDRLAND  455

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P KV  RLAHFRCLL+QRGVAAAPL G GR AP +PGSC +Q
Sbjct  456  PEKVRTRLAHFRCLLDQRGVAAAPLEGGGRAAPFEPGSCFVQ  497



>ref|XP_006391541.1| hypothetical protein EUTSA_v10018379mg [Eutrema salsugineum]
 gb|ESQ28827.1| hypothetical protein EUTSA_v10018379mg [Eutrema salsugineum]
Length=535

 Score =   348 bits (892),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 189/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK       +AY+YFVL+AQKIALSHGYE
Sbjct  314  FSKIFKFKFVHLGGDEVNTTCWSTTPRIAQWLKKHRKSEAEAYEYFVLRAQKIALSHGYE  373

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG KLS KTVVHNWLG G+ ++V A+GLRCIVSNQD+WYLDH+D+PW  F
Sbjct  374  IINWEETFNNFGGKLSPKTVVHNWLGTGVVEKVTASGLRCIVSNQDKWYLDHIDSPWQNF  433

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YSNEPL NI D K Q+LVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  434  YSNEPLANIKDQKQQSLVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTPYAKLAKN  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLLNQRGVAAAPLVG GR  P +PGSC  Q
Sbjct  494  PDKVTTRLAHFRCLLNQRGVAAAPLVGGGRVVPFEPGSCLAQ  535



>ref|NP_176737.2| beta-hexosaminidase 3 [Arabidopsis thaliana]
 sp|Q8L7S6.1|HEXO3_ARATH RecName: Full=Beta-hexosaminidase 3; AltName: Full=Beta-GlcNAcase 
3; AltName: Full=Beta-N-acetylhexosaminidase 3; AltName: 
Full=Beta-hexosaminidase 1; Short=AtHEX1; AltName: Full=N-acetyl-beta-glucosaminidase 
3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM91092.1| At1g65600/F5I14_13 [Arabidopsis thaliana]
 gb|AAN33206.1| At1g65600/F5I14_13 [Arabidopsis thaliana]
 gb|AEE34399.1| beta-hexosaminidase 3 [Arabidopsis thaliana]
Length=535

 Score =   348 bits (892),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 188/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK      ++AYQYFVL+AQKIALSHGYE
Sbjct  314  FSKIFKFKFVHLGGDEVNTTCWSATPRIAQWLKKHRMSEKEAYQYFVLRAQKIALSHGYE  373

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETF NFG+KL+RKTVVHNWL  GL + V A+GLRCIVSNQ+ WYLDH+DAPW GF
Sbjct  374  IINWEETFINFGSKLNRKTVVHNWLNTGLVENVTASGLRCIVSNQEFWYLDHIDAPWQGF  433

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEP  NITD K Q+LVLGGEVCMWGE+IDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  434  YANEPFQNITDKKQQSLVLGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTPYAKLAKN  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            PN V  RLAHFRCLLNQRGVAAAPLVG GR  P +PGSC  Q
Sbjct  494  PNNVTTRLAHFRCLLNQRGVAAAPLVGGGRVVPFEPGSCLAQ  535



>ref|XP_012078912.1| PREDICTED: beta-hexosaminidase 3 [Jatropha curcas]
 ref|XP_012078913.1| PREDICTED: beta-hexosaminidase 3 [Jatropha curcas]
 ref|XP_012078914.1| PREDICTED: beta-hexosaminidase 3 [Jatropha curcas]
 ref|XP_012078915.1| PREDICTED: beta-hexosaminidase 3 [Jatropha curcas]
Length=533

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEV+T+CW+ST RI+KWL+    +  QAYQYFVL+AQKIALSHGYE
Sbjct  312  FSKVFKFKFVHLGGDEVDTSCWSSTSRIQKWLEKHGMNASQAYQYFVLRAQKIALSHGYE  371

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKLSRKTVVHNWLGGG+A+QVVAAGLRCIVSNQD+WYLDHLD  W+ F
Sbjct  372  IINWEETFNNFGNKLSRKTVVHNWLGGGVAKQVVAAGLRCIVSNQDKWYLDHLDTSWEKF  431

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI D + Q LV+GGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  432  YMNEPLANINDTEQQQLVIGGEVCMWGEMVDGSDIEQTIWPRAAAAAERLWTPYDKLAKD  491

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V  RLAHFRCLLNQRGVAAAPL G GRGAPE+PGSC+ Q
Sbjct  492  PTHVTRRLAHFRCLLNQRGVAAAPLAGPGRGAPEEPGSCYSQ  533



>gb|KDP32489.1| hypothetical protein JCGZ_13414 [Jatropha curcas]
Length=531

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEV+T+CW+ST RI+KWL+    +  QAYQYFVL+AQKIALSHGYE
Sbjct  310  FSKVFKFKFVHLGGDEVDTSCWSSTSRIQKWLEKHGMNASQAYQYFVLRAQKIALSHGYE  369

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKLSRKTVVHNWLGGG+A+QVVAAGLRCIVSNQD+WYLDHLD  W+ F
Sbjct  370  IINWEETFNNFGNKLSRKTVVHNWLGGGVAKQVVAAGLRCIVSNQDKWYLDHLDTSWEKF  429

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI D + Q LV+GGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  430  YMNEPLANINDTEQQQLVIGGEVCMWGEMVDGSDIEQTIWPRAAAAAERLWTPYDKLAKD  489

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V  RLAHFRCLLNQRGVAAAPL G GRGAPE+PGSC+ Q
Sbjct  490  PTHVTRRLAHFRCLLNQRGVAAAPLAGPGRGAPEEPGSCYSQ  531



>ref|XP_010415100.1| PREDICTED: beta-hexosaminidase 3-like isoform X1 [Camelina sativa]
Length=535

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK      ++AYQYFVL+AQKIALSHGYE
Sbjct  314  FSKIFKFKFVHLGGDEVNTTCWSATPRIAQWLKKHRMSEEEAYQYFVLRAQKIALSHGYE  373

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             INWEETFNNFG+KL+ KTVVHNWLG G+ ++V A+GLRCIVSNQD+WYLDH+DAPW GF
Sbjct  374  TINWEETFNNFGSKLNPKTVVHNWLGTGVVERVTASGLRCIVSNQDKWYLDHIDAPWQGF  433

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL +I D K Q+LVLGGEVCMWGE+IDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  434  YDNEPLQDIKDKKQQSLVLGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTPYAKLATN  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLLNQRGVAAAPLVG GR  P +PGSC  Q
Sbjct  494  PDKVTTRLAHFRCLLNQRGVAAAPLVGGGRVVPLEPGSCLAQ  535



>ref|XP_010673847.1| PREDICTED: beta-hexosaminidase 3 [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 193/222 (87%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FKYKFVHLGGDEV+T CW ST R+++WL++R     QAYQYFVL+AQKIALSHGYE
Sbjct  313  FSKVFKYKFVHLGGDEVDTGCWQSTHRVDRWLQSRRMVSSQAYQYFVLRAQKIALSHGYE  372

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL RKTV+HNWLGGG+A++V AAGLRCIVSNQD+WYLDHLD  WD F
Sbjct  373  IINWEETFNNFGDKLDRKTVIHNWLGGGVAEKVTAAGLRCIVSNQDKWYLDHLDITWDEF  432

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI++PK Q  V+GGEVCMWGE+IDASDIEQTIWPRAAAAAERLWTSS+ L  +
Sbjct  433  YMNEPLTNISNPKQQKSVIGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTSSDKLARN  492

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P +V  RLAHFRCLLNQRGVAAAPL G GR APE PGSC+ Q
Sbjct  493  PRQVTRRLAHFRCLLNQRGVAAAPLAGPGRIAPEDPGSCYTQ  534



>gb|KJB14661.1| hypothetical protein B456_002G136400 [Gossypium raimondii]
Length=535

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIF +KFVHLGGDEVNT+CWT+TPRI  WLK    +  QAYQYFVL+AQ IALSHGYE
Sbjct  314  FSKIFNFKFVHLGGDEVNTSCWTTTPRIRNWLKKHGMNESQAYQYFVLRAQNIALSHGYE  373

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFN+FGNKLSRKTVVHNWLGGG+AQ+VVA+GLRCIVSNQD+WYLDHLD PW  F
Sbjct  374  IINWEETFNDFGNKLSRKTVVHNWLGGGVAQRVVASGLRCIVSNQDKWYLDHLDTPWQEF  433

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NIT+ K Q LV+GGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + L  +
Sbjct  434  YANEPLTNITNLKQQKLVIGGEVCMWGETVDGSDIEQTIWPRAAAAAERLWTPFDKLAKN  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V GRLAHFRCLLNQRGVAAAP+ G GR APE PGSC+ Q
Sbjct  494  PRDVTGRLAHFRCLLNQRGVAAAPVAGLGRAAPEGPGSCYRQ  535



>ref|XP_010415101.1| PREDICTED: beta-hexosaminidase 3-like isoform X2 [Camelina sativa]
Length=535

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK      ++AYQYFVL+AQKIALSHGYE
Sbjct  314  FSKIFKFKFVHLGGDEVNTTCWSATPRIAQWLKKHRMSEEEAYQYFVLRAQKIALSHGYE  373

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             INWEETFNNFG+KL+ KTVVHNWLG G+ ++V A+GLRCIVSNQD+WYLDH+DAPW GF
Sbjct  374  TINWEETFNNFGSKLNPKTVVHNWLGTGVVERVTASGLRCIVSNQDKWYLDHIDAPWQGF  433

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL +I D K Q+LVLGGEVCMWGE+IDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  434  YDNEPLQDIKDKKQQSLVLGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTPYAKLATN  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLLNQRGVAAAPLVG GR  P +PGSC  Q
Sbjct  494  PDKVTTRLAHFRCLLNQRGVAAAPLVGGGRVVPLEPGSCLAQ  535



>gb|KJB14660.1| hypothetical protein B456_002G136400 [Gossypium raimondii]
Length=524

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIF +KFVHLGGDEVNT+CWT+TPRI  WLK    +  QAYQYFVL+AQ IALSHGYE
Sbjct  303  FSKIFNFKFVHLGGDEVNTSCWTTTPRIRNWLKKHGMNESQAYQYFVLRAQNIALSHGYE  362

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFN+FGNKLSRKTVVHNWLGGG+AQ+VVA+GLRCIVSNQD+WYLDHLD PW  F
Sbjct  363  IINWEETFNDFGNKLSRKTVVHNWLGGGVAQRVVASGLRCIVSNQDKWYLDHLDTPWQEF  422

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NIT+ K Q LV+GGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + L  +
Sbjct  423  YANEPLTNITNLKQQKLVIGGEVCMWGETVDGSDIEQTIWPRAAAAAERLWTPFDKLAKN  482

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V GRLAHFRCLLNQRGVAAAP+ G GR APE PGSC+ Q
Sbjct  483  PRDVTGRLAHFRCLLNQRGVAAAPVAGLGRAAPEGPGSCYRQ  524



>ref|XP_010470437.1| PREDICTED: beta-hexosaminidase 3-like [Camelina sativa]
Length=592

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK      ++AYQYFVL+AQKIALSHGYE
Sbjct  371  FSKIFKFKFVHLGGDEVNTTCWSATPRIAQWLKKHQMSEEEAYQYFVLRAQKIALSHGYE  430

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL+ KTVVHNWLG G+ ++V A+GLRCIVSNQD+WYLDH+DAPW GF
Sbjct  431  IINWEETFNNFGSKLNPKTVVHNWLGTGVVERVTASGLRCIVSNQDKWYLDHIDAPWQGF  490

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL  I D K Q+LVLGGEVCMWGE+IDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  491  YDNEPLQAIKDKKQQSLVLGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTPYAKLATN  550

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLLNQRGVAAAPLVG GR  P +PGSC  Q
Sbjct  551  PDKVTTRLAHFRCLLNQRGVAAAPLVGGGRVVPLEPGSCLAQ  592



>ref|XP_002886950.1| glycosyl hydrolase family 20 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63209.1| glycosyl hydrolase family 20 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=535

 Score =   346 bits (888),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 188/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK       +AYQYFVL+AQKIALSHGYE
Sbjct  314  FSKIFKFKFVHLGGDEVNTTCWSATPRIAQWLKKHRMSEGEAYQYFVLRAQKIALSHGYE  373

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETF NFG+KL+ KTVVHNWL  GL + V A+GLRCIVSNQ+ WYLDH+DAPW GF
Sbjct  374  IINWEETFINFGSKLNSKTVVHNWLNTGLVENVTASGLRCIVSNQEYWYLDHIDAPWQGF  433

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NITD K Q+LVLGGEVCMWGE+IDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  434  YANEPLQNITDKKQQSLVLGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTPYAKLAKN  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            PNKV  RLAHFRCLLN+RGVAAAPLVG GR  P +PGSC  Q
Sbjct  494  PNKVTTRLAHFRCLLNRRGVAAAPLVGGGRVVPFEPGSCLAQ  535



>gb|EYU39500.1| hypothetical protein MIMGU_mgv1a004365mg [Erythranthe guttata]
Length=531

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKYKF+HLGGDEV+T+CW  TP + KWL+    +  +AYQYFVL+AQKIALSHGYE
Sbjct  310  FSKIFKYKFIHLGGDEVDTSCWQLTPHVRKWLQKNGMNASEAYQYFVLRAQKIALSHGYE  369

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KLSRKTVVHNWLG G+A++VV  GLRCIVSNQD+WYLDHLDA W GF
Sbjct  370  IINWEETFNNFGSKLSRKTVVHNWLGSGVAERVVKDGLRCIVSNQDKWYLDHLDALWQGF  429

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NIT+P  QALVLGGEVCMW E+IDASDIEQTIWPRAAAAAERLWT  + +  D
Sbjct  430  YTNEPLTNITNPNEQALVLGGEVCMWAEHIDASDIEQTIWPRAAAAAERLWTPYDKIAKD  489

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P +V  RL +FRCLLNQRGVAAAPL G GR APE+PGSC++Q
Sbjct  490  PEEVRDRLTYFRCLLNQRGVAAAPLDGFGRAAPEEPGSCYMQ  531



>ref|XP_009782309.1| PREDICTED: beta-hexosaminidase 3 [Nicotiana sylvestris]
 ref|XP_009782310.1| PREDICTED: beta-hexosaminidase 3 [Nicotiana sylvestris]
 ref|XP_009782311.1| PREDICTED: beta-hexosaminidase 3 [Nicotiana sylvestris]
 ref|XP_009782312.1| PREDICTED: beta-hexosaminidase 3 [Nicotiana sylvestris]
Length=530

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKY+FVHLGGDEV+T+CWT TPRI KWLK    +G  AY+YFVL+AQKIALSHGYE
Sbjct  309  FSKIFKYRFVHLGGDEVDTSCWTLTPRIRKWLKQNKLNGTTAYEYFVLRAQKIALSHGYE  368

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKLS KT+VHNWLGGG+AQQV AAGLRCIVSNQD+WYLDH+D  W  F
Sbjct  369  IINWEETFNNFGNKLSPKTIVHNWLGGGVAQQVTAAGLRCIVSNQDKWYLDHIDTTWQDF  428

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YSNEPL NIT+PK Q LV+GGEVCMWGE+ID S+IE TIWPRAAAAAERLWT+ +NL  +
Sbjct  429  YSNEPLTNITNPKQQRLVIGGEVCMWGEHIDGSNIETTIWPRAAAAAERLWTAYDNLAKN  488

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P++V  RLAHFRCLLNQRGVA+ PL G GR APE PGSC+ Q
Sbjct  489  PSQVTRRLAHFRCLLNQRGVASGPLTGGGRAAPEDPGSCYQQ  530



>gb|KFK41002.1| hypothetical protein AALP_AA2G072600 [Arabis alpina]
Length=529

 Score =   345 bits (885),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 187/222 (84%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WLK       +AYQYFVLQAQKIALSHGYE
Sbjct  308  FSKIFKFKFVHLGGDEVNTTCWSTTPRIAQWLKKHRMSEAKAYQYFVLQAQKIALSHGYE  367

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KLS KTVVHNWLG G+ ++V AAG RCIVSNQD+WYLDH+D PW  F
Sbjct  368  IINWEETFNNFGSKLSPKTVVHNWLGTGVVERVTAAGFRCIVSNQDKWYLDHIDTPWQDF  427

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NI D K Q+LVLGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT    L  +
Sbjct  428  YANEPLQNIKDKKQQSLVLGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPYAKLAKN  487

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLL+QRGVAAAPLVG GR  P  PGSC  Q
Sbjct  488  PDKVTARLAHFRCLLDQRGVAAAPLVGGGRVVPLDPGSCLAQ  529



>ref|XP_006302115.1| hypothetical protein CARUB_v10020116mg [Capsella rubella]
 gb|EOA35013.1| hypothetical protein CARUB_v10020116mg [Capsella rubella]
Length=536

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNTTCW++TPRI +WL+       +AYQYFVL+AQKIA+SHGYE
Sbjct  315  FSKIFKFKFVHLGGDEVNTTCWSATPRIAQWLQKHRMREDEAYQYFVLRAQKIAMSHGYE  374

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG++L+ KTVVHNWLG G+ ++V A+GLRCIVSNQD+WYLDH+DAPW GF
Sbjct  375  IINWEETFNNFGSELNPKTVVHNWLGTGVVERVTASGLRCIVSNQDKWYLDHIDAPWQGF  434

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YSNEPL +I D K Q+LVLGGEVCMWGE+IDASDIEQTIWPRAAAAAERLWT    L  +
Sbjct  435  YSNEPLQDIKDKKQQSLVLGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWTPYAKLAKN  494

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLLNQRGVAAAPLVG GR  P +PGSC  Q
Sbjct  495  PDKVTTRLAHFRCLLNQRGVAAAPLVGGGRVVPLEPGSCLAQ  536



>ref|XP_004250088.1| PREDICTED: beta-hexosaminidase 3 [Solanum lycopersicum]
 ref|XP_010312625.1| PREDICTED: beta-hexosaminidase 3 [Solanum lycopersicum]
 ref|XP_010312626.1| PREDICTED: beta-hexosaminidase 3 [Solanum lycopersicum]
Length=530

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKYKFVHLGGDEV+T+CWT TPRI KWLK   F+G  AY+YFVL+AQKIALSHGYE
Sbjct  309  FSKIFKYKFVHLGGDEVDTSCWTLTPRISKWLKQHRFNGTGAYEYFVLRAQKIALSHGYE  368

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKLS KT+VHNWLGGG+AQQV AAGLRCIVSNQD+WYLDH+D  W  F
Sbjct  369  IINWEETFNNFGNKLSPKTIVHNWLGGGVAQQVTAAGLRCIVSNQDKWYLDHIDTTWQNF  428

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YSNEPL NIT P+ Q LV+GGEVCMWGE+ID S+IE TIWPRAAAAAERLWT+ +N+  +
Sbjct  429  YSNEPLTNITKPEQQRLVMGGEVCMWGEHIDGSNIETTIWPRAAAAAERLWTAYDNIAKN  488

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P + A RLA+FRCLLNQRGVA+ PL G GR AP++PGSC+ Q
Sbjct  489  PEQAARRLAYFRCLLNQRGVASGPLSGGGRAAPDEPGSCYEQ  530



>ref|XP_002514769.1| beta-hexosaminidase, putative [Ricinus communis]
 gb|EEF47323.1| beta-hexosaminidase, putative [Ricinus communis]
Length=527

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEV+T+CWTSTP I  WLK  + +  +AYQYFVL+AQ+IALSHGYE
Sbjct  306  FSKIFKFKFVHLGGDEVDTSCWTSTPHIMNWLKKHNRNESEAYQYFVLRAQQIALSHGYE  365

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFN+FGNKLSRKTVVHNWLGGG+AQQVVA+GLRCIVSNQD+WYLDHLD  W  F
Sbjct  366  IVNWEETFNSFGNKLSRKTVVHNWLGGGVAQQVVASGLRCIVSNQDQWYLDHLDTTWQEF  425

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT+ + Q LV+GGEVCMWGE +DAS+IEQTIWPRAAAAAERLWTS + L  +
Sbjct  426  YMNEPLTNITNIEQQKLVIGGEVCMWGETVDASNIEQTIWPRAAAAAERLWTSYDKLAKN  485

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P +V GRLAHFRCLLNQRGVAAAP+ G GRGAP +PGSC+LQ
Sbjct  486  PREVTGRLAHFRCLLNQRGVAAAPVAGPGRGAPLEPGSCYLQ  527



>ref|XP_009602901.1| PREDICTED: beta-hexosaminidase 3 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602902.1| PREDICTED: beta-hexosaminidase 3 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602903.1| PREDICTED: beta-hexosaminidase 3 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602904.1| PREDICTED: beta-hexosaminidase 3 isoform X2 [Nicotiana tomentosiformis]
Length=530

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKY+FVHLGGDEV+T+CWT TPRI KWLK    +G  AY+YFVL+AQKIALSHGY+
Sbjct  309  FSKIFKYRFVHLGGDEVDTSCWTLTPRIRKWLKQHRLNGTTAYEYFVLRAQKIALSHGYQ  368

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKLS KT+VHNWLGGG+AQQV AAGLRCIVSNQD+WYLDH+D  W  F
Sbjct  369  IINWEETFNNFGNKLSPKTIVHNWLGGGVAQQVTAAGLRCIVSNQDKWYLDHIDTTWQDF  428

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YSNEPL NIT+P+ Q LV+GGEVCMWGE+ID S+IE TIWPRAAAAAERLWT+ + L  +
Sbjct  429  YSNEPLTNITNPELQRLVIGGEVCMWGEHIDGSNIETTIWPRAAAAAERLWTAYDKLAKN  488

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P++V  RLAHFRCLLNQRGVA+ PL G GR APE+PGSC+ Q
Sbjct  489  PSQVTRRLAHFRCLLNQRGVASGPLTGGGRAAPEEPGSCYQQ  530



>ref|XP_009602900.1| PREDICTED: beta-hexosaminidase 3 isoform X1 [Nicotiana tomentosiformis]
Length=535

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKY+FVHLGGDEV+T+CWT TPRI KWLK    +G  AY+YFVL+AQKIALSHGY+
Sbjct  314  FSKIFKYRFVHLGGDEVDTSCWTLTPRIRKWLKQHRLNGTTAYEYFVLRAQKIALSHGYQ  373

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKLS KT+VHNWLGGG+AQQV AAGLRCIVSNQD+WYLDH+D  W  F
Sbjct  374  IINWEETFNNFGNKLSPKTIVHNWLGGGVAQQVTAAGLRCIVSNQDKWYLDHIDTTWQDF  433

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YSNEPL NIT+P+ Q LV+GGEVCMWGE+ID S+IE TIWPRAAAAAERLWT+ + L  +
Sbjct  434  YSNEPLTNITNPELQRLVIGGEVCMWGEHIDGSNIETTIWPRAAAAAERLWTAYDKLAKN  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P++V  RLAHFRCLLNQRGVA+ PL G GR APE+PGSC+ Q
Sbjct  494  PSQVTRRLAHFRCLLNQRGVASGPLTGGGRAAPEEPGSCYQQ  535



>ref|XP_007028399.1| Beta-hexosaminidase 3 isoform 5 [Theobroma cacao]
 gb|EOY08901.1| Beta-hexosaminidase 3 isoform 5 [Theobroma cacao]
Length=377

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEV+T+CWT+TP I KWLK    +  QAYQYFVL+AQ +ALSHGYE
Sbjct  157  FSKIFKFKFVHLGGDEVDTSCWTTTPHISKWLKKNGMNESQAYQYFVLRAQNLALSHGYE  216

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLSRKTVVHNWLGGG+AQQVVA+GLRCIVSNQD+WYLDHLD  W  F
Sbjct  217  IVNWEETFNNFGNKLSRKTVVHNWLGGGVAQQVVASGLRCIVSNQDKWYLDHLDTTWQEF  276

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NIT+ K Q LV+GGEVCMWGE ID SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  277  YANEPLTNITNLKQQKLVIGGEVCMWGERIDGSDIEQTIWPRAAAAAERLWTPYDELAKD  336

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSC  182
            P +V GRLAHFRCLLNQRGVAAAPL G GR APE    C
Sbjct  337  PRQVTGRLAHFRCLLNQRGVAAAPLAGQGRAAPEANRGC  375



>ref|XP_007028397.1| Beta-hexosaminidase 3 isoform 3 [Theobroma cacao]
 gb|EOY08899.1| Beta-hexosaminidase 3 isoform 3 [Theobroma cacao]
Length=394

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEV+T+CWT+TP I KWLK    +  QAYQYFVL+AQ +ALSHGYE
Sbjct  174  FSKIFKFKFVHLGGDEVDTSCWTTTPHISKWLKKNGMNESQAYQYFVLRAQNLALSHGYE  233

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLSRKTVVHNWLGGG+AQQVVA+GLRCIVSNQD+WYLDHLD  W  F
Sbjct  234  IVNWEETFNNFGNKLSRKTVVHNWLGGGVAQQVVASGLRCIVSNQDKWYLDHLDTTWQEF  293

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NIT+ K Q LV+GGEVCMWGE ID SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  294  YANEPLTNITNLKQQKLVIGGEVCMWGERIDGSDIEQTIWPRAAAAAERLWTPYDELAKD  353

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSC  182
            P +V GRLAHFRCLLNQRGVAAAPL G GR APE    C
Sbjct  354  PRQVTGRLAHFRCLLNQRGVAAAPLAGQGRAAPEANRGC  392



>ref|XP_009105156.1| PREDICTED: beta-hexosaminidase 3 [Brassica rapa]
Length=534

 Score =   340 bits (873),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 189/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KF+HLGGDEVNTTCW++TPRI KWLK       +AY+YFVL+AQKIALSHGYE
Sbjct  313  FSKIFKFKFIHLGGDEVNTTCWSTTPRISKWLKKHRKTEAEAYEYFVLRAQKIALSHGYE  372

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKL+ KTVVHNWLG G+  +V AAGLRCI+SNQD+WYLDH+D PW  F
Sbjct  373  IINWEETFNNFGNKLNPKTVVHNWLGTGVVGRVTAAGLRCIMSNQDKWYLDHIDTPWQMF  432

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEP + I D K Q+LVLGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT    L ++
Sbjct  433  YANEPFEMIKDEKRQSLVLGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPYTKLAEN  492

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLLN+RGVAAAPLVG GR AP +PGSC  Q
Sbjct  493  PDKVTTRLAHFRCLLNERGVAAAPLVGGGRVAPFEPGSCLAQ  534



>dbj|BAK05483.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEV+T+CWT+TPRI+ WL     +   AY+YFVL+AQKIA+SHGYE
Sbjct  305  FSKVFKFKFVHLGGDEVDTSCWTTTPRIKSWLVQHGMNESDAYRYFVLRAQKIAISHGYE  364

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL RKTVVHNWLGGG+A++VV+AGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  365  VINWEETFNNFGDKLDRKTVVHNWLGGGVAEKVVSAGLRCIVSNQDKWYLDHLDATWEGF  424

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI +P+ Q L+LGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT  E L  +
Sbjct  425  YMNEPLTNIYNPEQQKLILGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPVERLAKN  484

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V  RLAHFRCLLN+RGVAAAPL G GR AP +PGSC  Q
Sbjct  485  PTAVTARLAHFRCLLNERGVAAAPLAGYGRTAPSEPGSCMRQ  526



>gb|EMS61134.1| Beta-hexosaminidase subunit B2 [Triticum urartu]
Length=436

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEV+T+CWT+TPRI+ WL     +   AY+YFVL+AQKIA+SHGYE
Sbjct  215  FSKVFKFKFVHLGGDEVDTSCWTTTPRIKSWLVQHGMNESDAYRYFVLKAQKIAISHGYE  274

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL RKTVVHNWLGGG+A++VV+AGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  275  IINWEETFNNFGDKLDRKTVVHNWLGGGVAEKVVSAGLRCIVSNQDKWYLDHLDATWEGF  334

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI +P+ Q L+LGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT  E L  D
Sbjct  335  YMNEPLTNIYNPEQQKLILGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPVEKLAKD  394

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
               V  RLAHFRCLLN+RGVAAAPL G GR AP +PGSC  Q
Sbjct  395  TTAVTARLAHFRCLLNERGVAAAPLAGYGRTAPSEPGSCVRQ  436



>ref|XP_006353240.1| PREDICTED: beta-hexosaminidase 3-like isoform X1 [Solanum tuberosum]
 ref|XP_006353241.1| PREDICTED: beta-hexosaminidase 3-like isoform X2 [Solanum tuberosum]
Length=531

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKYKFVHLGGDEV+T+CWT TPRI KWLK    +G  AY+YFVL+AQKIALSHGYE
Sbjct  310  FSKIFKYKFVHLGGDEVDTSCWTLTPRISKWLKQHRLNGTSAYEYFVLRAQKIALSHGYE  369

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKLS KT+VHNWLGGG+AQQV AAGLRCIVSNQD+WYLDH+D  W  F
Sbjct  370  IINWEETFNNFGNKLSPKTIVHNWLGGGVAQQVTAAGLRCIVSNQDKWYLDHIDTTWQDF  429

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YSNEPL NIT P+ Q LV+GGEVCMWGE+ID S+IE TIWPRAAAAAERLWT+ +N+  +
Sbjct  430  YSNEPLTNITKPEQQRLVIGGEVCMWGEHIDGSNIETTIWPRAAAAAERLWTAYDNIAKN  489

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P +   RLA+FRCLLNQRGVA+ PL G GR AP++PGSC+ Q
Sbjct  490  PEQAVRRLAYFRCLLNQRGVASGPLTGGGRAAPDEPGSCYEQ  531



>gb|EMT17377.1| Beta-hexosaminidase subunit B2 [Aegilops tauschii]
Length=490

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEV+T+CWT+TPRI+ WL     +   AY+YFVL+AQKIA+SHGYE
Sbjct  269  FSKVFKFKFVHLGGDEVDTSCWTTTPRIKSWLVQHGMNESDAYRYFVLKAQKIAISHGYE  328

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL RKTVVHNWLGGG+A++VV+AGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  329  IINWEETFNNFGDKLDRKTVVHNWLGGGVAEKVVSAGLRCIVSNQDKWYLDHLDATWEGF  388

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI +P+ Q L+LGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT  E L  D
Sbjct  389  YMNEPLTNIYNPEQQKLILGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPVEKLAKD  448

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
               V  RLAHFRCLLN+RGVAAAPL G GR AP +PGSC  Q
Sbjct  449  TTAVTARLAHFRCLLNERGVAAAPLAGYGRTAPSEPGSCVRQ  490



>emb|CDY07456.1| BnaA07g25350D [Brassica napus]
Length=534

 Score =   338 bits (866),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 188/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KF+HLGGDEVNTTCW++TPRI KWLK       +AY+YFVL+AQKIA SHGYE
Sbjct  313  FSKIFKFKFIHLGGDEVNTTCWSTTPRISKWLKKHRKTEAEAYEYFVLRAQKIASSHGYE  372

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKL+ KTVVHNWLG G+  +V AAGLRCI+SNQD+WYLDH+D PW  F
Sbjct  373  IINWEETFNNFGNKLNPKTVVHNWLGTGVVGRVTAAGLRCIMSNQDKWYLDHIDTPWQMF  432

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEP + I D K Q+LVLGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT    L ++
Sbjct  433  YANEPFEMIKDEKRQSLVLGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPYTKLAEN  492

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P+KV  RLAHFRCLLN+RGVAAAPLVG GR AP +PGSC  Q
Sbjct  493  PDKVTTRLAHFRCLLNERGVAAAPLVGGGRVAPFEPGSCLAQ  534



>ref|XP_007028395.1| Beta-hexosaminidase 3 isoform 1 [Theobroma cacao]
 gb|EOY08897.1| Beta-hexosaminidase 3 isoform 1 [Theobroma cacao]
Length=543

 Score =   337 bits (865),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 187/218 (86%), Gaps = 0/218 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEV+T+CWT+TP I KWLK    +  QAYQYFVL+AQ +ALSHGYE
Sbjct  321  FSKIFKFKFVHLGGDEVDTSCWTTTPHISKWLKKNGMNESQAYQYFVLRAQNLALSHGYE  380

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLSRKTVVHNWLGGG+AQQVVA+GLRCIVSNQD+WYLDHLD  W  F
Sbjct  381  IVNWEETFNNFGNKLSRKTVVHNWLGGGVAQQVVASGLRCIVSNQDKWYLDHLDTTWQEF  440

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NIT+ K Q LV+GGEVCMWGE ID SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  441  YANEPLTNITNLKQQKLVIGGEVCMWGERIDGSDIEQTIWPRAAAAAERLWTPYDELAKD  500

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGS  185
            P +V GRLAHFRCLLNQRGVAAAPL G GR APE P +
Sbjct  501  PRQVTGRLAHFRCLLNQRGVAAAPLAGQGRAAPEGPAN  538



>ref|XP_004962080.1| PREDICTED: beta-hexosaminidase 3-like [Setaria italica]
Length=528

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 187/222 (84%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNT+CWT+TPRI+ WL     +   AY+YFVL+AQKIA+SHGY+
Sbjct  307  FSKIFKFKFVHLGGDEVNTSCWTTTPRIKSWLIKHGMNESDAYRYFVLRAQKIAISHGYD  366

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL RKTVVHNWLG G+A++VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  367  IINWEETFNNFGDKLDRKTVVHNWLGSGVAEKVVAAGLRCIVSNQDKWYLDHLDATWEGF  426

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI +P+ Q LVLGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT  E L  D
Sbjct  427  YMNEPLTNIYNPQQQKLVLGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPIEKLAKD  486

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
               V  RLA FRCLLNQRGVAAAPL G GR AP  PGSC  Q
Sbjct  487  AGSVTARLARFRCLLNQRGVAAAPLAGYGRSAPSDPGSCLRQ  528



>ref|XP_007028398.1| Beta-hexosaminidase 3 isoform 4 [Theobroma cacao]
 gb|EOY08900.1| Beta-hexosaminidase 3 isoform 4 [Theobroma cacao]
Length=541

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEV+T+CWT+TP I KWLK    +  QAYQYFVL+AQ +ALSHGYE
Sbjct  321  FSKIFKFKFVHLGGDEVDTSCWTTTPHISKWLKKNGMNESQAYQYFVLRAQNLALSHGYE  380

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLSRKTVVHNWLGGG+AQQVVA+GLRCIVSNQD+WYLDHLD  W  F
Sbjct  381  IVNWEETFNNFGNKLSRKTVVHNWLGGGVAQQVVASGLRCIVSNQDKWYLDHLDTTWQEF  440

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NIT+ K Q LV+GGEVCMWGE ID SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  441  YANEPLTNITNLKQQKLVIGGEVCMWGERIDGSDIEQTIWPRAAAAAERLWTPYDELAKD  500

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSC  182
            P +V GRLAHFRCLLNQRGVAAAPL G GR APE    C
Sbjct  501  PRQVTGRLAHFRCLLNQRGVAAAPLAGQGRAAPEANRGC  539



>ref|XP_008649645.1| PREDICTED: beta-hexosaminidase 3 isoform X1 [Zea mays]
 gb|AFW78018.1| hypothetical protein ZEAMMB73_303571 [Zea mays]
Length=529

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 188/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNT+CW++TP I+ WL     +   AY+YFVL+AQKIA+SHGY+
Sbjct  308  FSKIFKFKFVHLGGDEVNTSCWSTTPHIKSWLMQHSMNESDAYRYFVLRAQKIAISHGYD  367

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL RKTVVHNWLG G+A++VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  368  IINWEETFNNFGDKLDRKTVVHNWLGSGVAEKVVAAGLRCIVSNQDKWYLDHLDATWEGF  427

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NI +P+ Q LVLGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT  E L  D
Sbjct  428  YTNEPLTNIYNPEQQKLVLGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPIEKLAKD  487

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
               V  RLA FRCLLNQRGVAAAPL G GR AP +PGSC  Q
Sbjct  488  TRSVTARLARFRCLLNQRGVAAAPLAGYGRSAPSEPGSCLRQ  529



>ref|XP_007028396.1| Beta-hexosaminidase 3 isoform 2 [Theobroma cacao]
 gb|EOY08898.1| Beta-hexosaminidase 3 isoform 2 [Theobroma cacao]
Length=558

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEV+T+CWT+TP I KWLK    +  QAYQYFVL+AQ +ALSHGYE
Sbjct  338  FSKIFKFKFVHLGGDEVDTSCWTTTPHISKWLKKNGMNESQAYQYFVLRAQNLALSHGYE  397

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLSRKTVVHNWLGGG+AQQVVA+GLRCIVSNQD+WYLDHLD  W  F
Sbjct  398  IVNWEETFNNFGNKLSRKTVVHNWLGGGVAQQVVASGLRCIVSNQDKWYLDHLDTTWQEF  457

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NIT+ K Q LV+GGEVCMWGE ID SDIEQTIWPRAAAAAERLWT  + L  D
Sbjct  458  YANEPLTNITNLKQQKLVIGGEVCMWGERIDGSDIEQTIWPRAAAAAERLWTPYDELAKD  517

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSC  182
            P +V GRLAHFRCLLNQRGVAAAPL G GR APE    C
Sbjct  518  PRQVTGRLAHFRCLLNQRGVAAAPLAGQGRAAPEANRGC  556



>ref|XP_008788259.1| PREDICTED: beta-hexosaminidase 3 [Phoenix dactylifera]
Length=531

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FS++FK++FVHLGGDEVNT+CWTSTP I KWLK    +    YQYFVL+AQKIALSHGYE
Sbjct  310  FSEVFKFRFVHLGGDEVNTSCWTSTPHINKWLKEHRMNESGGYQYFVLRAQKIALSHGYE  369

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KLS KTVVHNWLGGG+A  VVAAGLRCIVSNQD WYLDHLDA W  F
Sbjct  370  VINWEETFNNFGDKLSPKTVVHNWLGGGVAPTVVAAGLRCIVSNQDSWYLDHLDATWQKF  429

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI+ P+ Q LV+GGEVCMWGE+ID SDIEQTIWPRAAAAAERLWT  E L  D
Sbjct  430  YMNEPLKNISKPEQQKLVIGGEVCMWGEHIDTSDIEQTIWPRAAAAAERLWTPLEKLAKD  489

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSC  182
            P +V  RLA FRCLLNQRGVAAAPL G GRGAP  PGSC
Sbjct  490  PKQVTSRLARFRCLLNQRGVAAAPLAGPGRGAPTGPGSC  528



>gb|KDO77087.1| hypothetical protein CISIN_1g008945mg [Citrus sinensis]
Length=445

 Score =   332 bits (852),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 188/228 (82%), Gaps = 6/228 (3%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FKYKFVHLGGDEVNT+CWT TP + KWLK    +  QAYQYFVLQAQKIAL HGYE
Sbjct  218  FSKVFKYKFVHLGGDEVNTSCWTLTPHVSKWLKEHSMNESQAYQYFVLQAQKIALLHGYE  277

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLS KTVVHNWLGGG+AQ+VVAAGLRCIVSNQD+WYLDHLD  W+ F
Sbjct  278  IVNWEETFNNFGNKLSPKTVVHNWLGGGVAQRVVAAGLRCIVSNQDKWYLDHLDTTWEQF  337

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT  + Q LV+GGEVCMWGE +DASDI+QTIWPRAAAAAERLWT  + L  +
Sbjct  338  YMNEPLTNITKSEQQKLVIGGEVCMWGETVDASDIQQTIWPRAAAAAERLWTPYDKLAKE  397

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS------GRGAPEQPGSCHLQ  173
              +V GRLAHFRCLLNQRG+AAAPL         GR AP +PGSC+LQ
Sbjct  398  AKQVTGRLAHFRCLLNQRGIAAAPLAADTPLTQPGRSAPLEPGSCYLQ  445



>ref|XP_006448517.1| hypothetical protein CICLE_v10014808mg [Citrus clementina]
 gb|ESR61757.1| hypothetical protein CICLE_v10014808mg [Citrus clementina]
Length=548

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 189/228 (83%), Gaps = 6/228 (3%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FKYKFVHLGGDEVNT+CWT TP + KWLK    +  QAYQYFVLQAQKIALSHGYE
Sbjct  321  FSKVFKYKFVHLGGDEVNTSCWTLTPHVSKWLKEHSMNESQAYQYFVLQAQKIALSHGYE  380

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLS KTVVHNWLGGG+AQ+VVAAGLRCIVSNQD+WYLDHLD  W+ F
Sbjct  381  IVNWEETFNNFGNKLSPKTVVHNWLGGGVAQRVVAAGLRCIVSNQDKWYLDHLDTTWEQF  440

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT  + Q LV+GGEVCMWGE +DASDI+QTIWPRAAAAAERLWT  + L  +
Sbjct  441  YMNEPLTNITKSEQQKLVIGGEVCMWGETVDASDIQQTIWPRAAAAAERLWTPYDKLAKE  500

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS------GRGAPEQPGSCHLQ  173
              +V GRLAHFRCLLNQRG+AAAPL         GR AP +PGSC+LQ
Sbjct  501  AKQVTGRLAHFRCLLNQRGIAAAPLAADTPLTQPGRSAPLEPGSCYLQ  548



>emb|CDP21161.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   334 bits (857),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FKY+FVHLGGDEV+T+CWT TP +  WLK R  +   AYQYFVL+AQ+IALSHGYE
Sbjct  286  FSKVFKYRFVHLGGDEVDTSCWTFTPHVSDWLKKRGLNESGAYQYFVLKAQQIALSHGYE  345

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL+ KTVVHNWLGGG+AQ+VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  346  IINWEETFNNFGSKLNPKTVVHNWLGGGVAQKVVAAGLRCIVSNQDKWYLDHLDATWEGF  405

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YSNEPL NIT P+ QALV+GGEVC WGE+ID SDIEQTIWPRAAAAAERLWT   NL  +
Sbjct  406  YSNEPLANITKPEEQALVIGGEVCTWGEHIDGSDIEQTIWPRAAAAAERLWTPYHNLAKN  465

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
             ++V  RLA+FRCLLNQRGVAAAPL G GR AP +PGSC+ Q
Sbjct  466  SSEVTARLANFRCLLNQRGVAAAPLAGPGRVAPLEPGSCYKQ  507



>emb|CDY39278.1| BnaC06g27130D [Brassica napus]
Length=423

 Score =   331 bits (849),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 188/223 (84%), Gaps = 1/223 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KF+HLGGDEVNTTCW++TPRI KWLK       +AY+YFVL+AQKIA SHGYE
Sbjct  201  FSKIFKFKFIHLGGDEVNTTCWSTTPRISKWLKKHRKTEAEAYEYFVLRAQKIASSHGYE  260

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFGNKL+ KTVVHNWLG G+  +V AAGLRCI+SNQD+WYLDH+D PW  F
Sbjct  261  IINWEETFNNFGNKLNPKTVVHNWLGTGVVGRVTAAGLRCIMSNQDKWYLDHIDTPWQMF  320

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIE-QTIWPRAAAAAERLWTSSENLPD  302
            Y+NEP + I D K Q+LVLGGEVCMWGE+IDASDI+ QTIWPRAAAAAERLWT    L +
Sbjct  321  YANEPFEMIKDEKRQSLVLGGEVCMWGEHIDASDIQPQTIWPRAAAAAERLWTPYTKLAE  380

Query  301  DPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            +P+KV  RLAHFRCLLN+RGVAAAPLVG GR AP +PGSC  Q
Sbjct  381  NPDKVTTRLAHFRCLLNERGVAAAPLVGGGRVAPFEPGSCLAQ  423



>ref|XP_010908516.1| PREDICTED: beta-hexosaminidase 3 [Elaeis guineensis]
Length=531

 Score =   335 bits (858),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 184/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK++FVHLGGDEVNT+CWTSTP + +WLK    +G  AYQYFVL+AQKIALSHGYE
Sbjct  310  FSKVFKFRFVHLGGDEVNTSCWTSTPHVNQWLKKHRMNGSDAYQYFVLRAQKIALSHGYE  369

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETF+NFGNKLS KTVVHNWLG G+A +VVAAGLRC+VSNQD WYLDHLD  W  F
Sbjct  370  VINWEETFDNFGNKLSPKTVVHNWLGVGVAPRVVAAGLRCLVSNQDSWYLDHLDTTWPKF  429

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI++P+ Q LV+GGEVCMWGE+ID SDIEQTIWPRAAAAAERLWT  E L  D
Sbjct  430  YMNEPLTNISNPEQQKLVIGGEVCMWGEHIDTSDIEQTIWPRAAAAAERLWTPLEKLAKD  489

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSC  182
            P +V  RLA FRCLLNQRGVAAAPL G GR AP  PGSC
Sbjct  490  PKQVTSRLARFRCLLNQRGVAAAPLSGPGRVAPMDPGSC  528



>ref|XP_006468639.1| PREDICTED: beta-hexosaminidase 3-like [Citrus sinensis]
Length=548

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 188/228 (82%), Gaps = 6/228 (3%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FKYKFVHLGGDEVNT+CWT TP + KWLK    +  QAYQYFVLQAQKIAL HGYE
Sbjct  321  FSKVFKYKFVHLGGDEVNTSCWTLTPHVSKWLKEHSMNESQAYQYFVLQAQKIALLHGYE  380

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLS KTVVHNWLGGG+AQ+VVAAGLRCIVSNQD+WYLDHLD  W+ F
Sbjct  381  IVNWEETFNNFGNKLSPKTVVHNWLGGGVAQRVVAAGLRCIVSNQDKWYLDHLDTTWEQF  440

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT  + Q LV+GGEVCMWGE +DASDI+QTIWPRAAAAAERLWT  + L  +
Sbjct  441  YMNEPLTNITKSEQQKLVIGGEVCMWGETVDASDIQQTIWPRAAAAAERLWTPYDKLAKE  500

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS------GRGAPEQPGSCHLQ  173
              +V GRLAHFRCLLNQRG+AAAPL         GR AP +PGSC+LQ
Sbjct  501  AKQVTGRLAHFRCLLNQRGIAAAPLAADTPLTQPGRSAPLEPGSCYLQ  548



>gb|KDO77088.1| hypothetical protein CISIN_1g008945mg [Citrus sinensis]
Length=548

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 188/228 (82%), Gaps = 6/228 (3%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FKYKFVHLGGDEVNT+CWT TP + KWLK    +  QAYQYFVLQAQKIAL HGYE
Sbjct  321  FSKVFKYKFVHLGGDEVNTSCWTLTPHVSKWLKEHSMNESQAYQYFVLQAQKIALLHGYE  380

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFGNKLS KTVVHNWLGGG+AQ+VVAAGLRCIVSNQD+WYLDHLD  W+ F
Sbjct  381  IVNWEETFNNFGNKLSPKTVVHNWLGGGVAQRVVAAGLRCIVSNQDKWYLDHLDTTWEQF  440

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT  + Q LV+GGEVCMWGE +DASDI+QTIWPRAAAAAERLWT  + L  +
Sbjct  441  YMNEPLTNITKSEQQKLVIGGEVCMWGETVDASDIQQTIWPRAAAAAERLWTPYDKLAKE  500

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS------GRGAPEQPGSCHLQ  173
              +V GRLAHFRCLLNQRG+AAAPL         GR AP +PGSC+LQ
Sbjct  501  AKQVTGRLAHFRCLLNQRGIAAAPLAADTPLTQPGRSAPLEPGSCYLQ  548



>ref|NP_001045052.1| Os01g0891000 [Oryza sativa Japonica Group]
 dbj|BAD87534.1| putative beta-N-acetylhexosaminidase [Oryza sativa Japonica Group]
 dbj|BAF06966.1| Os01g0891000 [Oryza sativa Japonica Group]
 gb|EEE55788.1| hypothetical protein OsJ_04367 [Oryza sativa Japonica Group]
Length=526

 Score =   332 bits (852),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 187/222 (84%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWT+TP I+KWL     +   AY+YFVL++QK+A+SHGY+
Sbjct  305  FSKVFKFKFVHLGGDEVNTSCWTATPHIKKWLDDNQMNVSDAYRYFVLRSQKLAISHGYD  364

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL R+TVVHNWLG  +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  365  VINWEETFNNFGDKLDRRTVVHNWLGEDVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGF  424

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL  I DP+ Q+LV+GGEVCMWGE IDASDIEQTIWPRAAAAAERLWT  E + +D
Sbjct  425  YTNEPLKGIDDPEQQSLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWTPIEKIAED  484

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V  RLA FRCLLNQRGVAAAP+ G GR AP +PG C  Q
Sbjct  485  PRLVTSRLARFRCLLNQRGVAAAPVAGYGRTAPYEPGPCVRQ  526



>ref|XP_006645150.1| PREDICTED: beta-hexosaminidase 3-like [Oryza brachyantha]
Length=526

 Score =   332 bits (852),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 185/222 (83%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWT+TP I+KWL   H +   AY+YFVL++QKIA+SHGY+
Sbjct  305  FSKVFKFKFVHLGGDEVNTSCWTATPHIKKWLDDNHMNVTDAYRYFVLRSQKIAISHGYD  364

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL R+TVVHNWL   +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  365  VINWEETFNNFGDKLDRRTVVHNWLDEDVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGF  424

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL +I +P  Q LV+GGEVCMWGE IDASDIEQTIWPRAAAAAERLWT  E +  D
Sbjct  425  YTNEPLKDIDNPDQQRLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWTPIEKIALD  484

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V  RLA FRCLLNQRGVAAAPL G GR AP +PG C  Q
Sbjct  485  PRLVTPRLARFRCLLNQRGVAAAPLAGYGRTAPYEPGPCVRQ  526



>ref|XP_010231374.1| PREDICTED: beta-hexosaminidase 3-like [Brachypodium distachyon]
Length=521

 Score =   332 bits (850),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 187/222 (84%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWT+TPRI+ WL     +   AY+YFVL+AQKIA+SHGY+
Sbjct  300  FSKVFKFKFVHLGGDEVNTSCWTTTPRIKSWLVQHGMNESDAYRYFVLRAQKIAISHGYD  359

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL RKTVVHNWLGGG+A++VV+AGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  360  IINWEETFNNFGDKLDRKTVVHNWLGGGVAEKVVSAGLRCIVSNQDKWYLDHLDATWEGF  419

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI +P+ Q L+LGGEVCMWGE IDASDI+QTIWPRAAAAAERLWT  E L   
Sbjct  420  YMNEPLTNIYNPEQQKLILGGEVCMWGERIDASDIQQTIWPRAAAAAERLWTPVEKLAKG  479

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
               V  RLA FRCLLN+RGVAAAPL G GR AP +PGSC  Q
Sbjct  480  ATVVTARLARFRCLLNERGVAAAPLAGYGRTAPLEPGSCIRQ  521



>dbj|BAK06905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/222 (73%), Positives = 186/222 (84%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWT+TP I++WL   H +   AY+YFVL+AQKIA+SHGY+
Sbjct  300  FSKVFKFKFVHLGGDEVNTSCWTATPHIKEWLNNNHMNVSDAYRYFVLRAQKIAISHGYD  359

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL RKTVVHNWLGG +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  360  VINWEETFNNFGDKLDRKTVVHNWLGGDVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGF  419

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL  I DP+ Q LV+GGEVCMWGE IDASDIEQTIWPRAAAAAERLW+  E + DD
Sbjct  420  YLNEPLKGINDPEQQRLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWSPREQIADD  479

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
                  RL+ FRCLLNQRGVAAAPL G+GR AP +PG C  Q
Sbjct  480  TRSATSRLSRFRCLLNQRGVAAAPLAGNGRTAPYEPGPCVRQ  521



>ref|XP_008441912.1| PREDICTED: beta-hexosaminidase 3 [Cucumis melo]
Length=539

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 188/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKY+FVHLGGDEVNTTCWT TP I  WL+ +      AY+YFVL+AQKIALSHGYE
Sbjct  318  FSKIFKYRFVHLGGDEVNTTCWTVTPHIRNWLRKKGMKESDAYKYFVLRAQKIALSHGYE  377

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            ++NWEETFN+FG++LSRKTVVHNWLG G+AQ+VVAAGLRCIVSNQD WYLDH+D  W+ F
Sbjct  378  LVNWEETFNDFGSELSRKTVVHNWLGTGVAQKVVAAGLRCIVSNQDSWYLDHIDTSWEQF  437

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NI DP+ Q LV+GGEVCMWGE +DAS+IEQTIWPRAAAAAERLWT  +NL  D
Sbjct  438  YTNEPLQNIKDPRQQKLVIGGEVCMWGEVVDASNIEQTIWPRAAAAAERLWTPYDNLAKD  497

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P++V  RLAHFRCLLNQRG+ AAP+ G GR AP  PGSC +Q
Sbjct  498  PSQVFARLAHFRCLLNQRGIDAAPVSGLGRSAPWGPGSCFVQ  539



>ref|XP_003564819.1| PREDICTED: beta-hexosaminidase 3-like [Brachypodium distachyon]
Length=521

 Score =   330 bits (845),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 184/222 (83%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWT TP I++WL   H +   AY+YFVL++QKIA++HGY+
Sbjct  300  FSKVFKFKFVHLGGDEVNTSCWTKTPHIKEWLNNNHMNASDAYRYFVLRSQKIAIAHGYD  359

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFN+FG KL RKT+VHNWLGG +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  360  VINWEETFNDFGEKLDRKTIVHNWLGGKVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGF  419

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL  I +P+ Q LV+GGEVCMWGE IDASDIEQTIWPRAAAAAERLWT  E L +D
Sbjct  420  YMNEPLKGIDNPEQQRLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWTPIEKLAED  479

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P     RL+ FRCLLNQRGVAAAPL G GR AP +PG C  Q
Sbjct  480  PRSATSRLSRFRCLLNQRGVAAAPLAGDGRTAPYEPGPCVRQ  521



>ref|XP_004970859.1| PREDICTED: beta-hexosaminidase 3-like [Setaria italica]
Length=527

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/222 (73%), Positives = 182/222 (82%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KF HLGGDEVNT+CWT+TP IE WL   H +   AY+ FVL++QKIA+SHGY+
Sbjct  306  FSKVFKFKFAHLGGDEVNTSCWTTTPHIEGWLNNNHMNVSDAYRDFVLRSQKIAISHGYD  365

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL RKTVVHNWLG  +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  366  IINWEETFNNFGDKLDRKTVVHNWLGEDVAPKVVAAGLRCIVSNQDKWYLDHLDASWEGF  425

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL  I D K Q LV+GGEVCMWGE IDASDIEQTIWPRAAAAAERLWT +E L +D
Sbjct  426  YMNEPLKGIDDTKQQQLVIGGEVCMWGEEIDASDIEQTIWPRAAAAAERLWTPTEKLAND  485

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
               V  RLA FRCLLNQRGVAAAPL G GR +P +PG C  Q
Sbjct  486  TRLVTSRLARFRCLLNQRGVAAAPLAGYGRASPAEPGPCVRQ  527



>emb|CBI18622.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   317 bits (812),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  784  TTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEIINWEETFNNFGNKLSRK  605
            + CWT TP I KWL+    D   AYQYFVL+AQKIALSHGYEIINWEETFN+FG+KLSRK
Sbjct  22   SGCWTETPHIRKWLRQHGLDTSGAYQYFVLRAQKIALSHGYEIINWEETFNDFGSKLSRK  81

Query  604  TVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALV  425
            TVVHNWLGGG+A++VVAAGLRCIVSNQD+WYLDHLDAPW+GFY NEPL NIT+ + Q L+
Sbjct  82   TVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHLDAPWEGFYMNEPLTNITNHQQQKLI  141

Query  424  LGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNKVAGRLAHFRCLLNQR  245
            LGGEVCMWGE+IDASDIEQTIWPRAAAAAERLW++ +NL  DP++V GRLAHFRCLLNQR
Sbjct  142  LGGEVCMWGEHIDASDIEQTIWPRAAAAAERLWSAYDNLAKDPSQVFGRLAHFRCLLNQR  201

Query  244  GVAAAPLVGSGRGAPEQPGSCHLQ  173
            GVAAAPLVG GR APE+PGSC+ Q
Sbjct  202  GVAAAPLVGPGRVAPEEPGSCYKQ  225



>ref|XP_004152838.1| PREDICTED: beta-hexosaminidase 3 [Cucumis sativus]
 gb|KGN61237.1| hypothetical protein Csa_2G073000 [Cucumis sativus]
Length=539

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 187/222 (84%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKY+FVHLGGDEVNTTCWT TP I+ WL+ +      AY+YFVL+AQKIALSHGYE
Sbjct  318  FSKIFKYRFVHLGGDEVNTTCWTVTPHIKNWLRKKGMKESDAYKYFVLRAQKIALSHGYE  377

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            ++NWEETFN+FG++LSRKTVVHNWLG G+AQ+VVAAGLRCIVSNQD WYLDH+D  W+ F
Sbjct  378  LVNWEETFNDFGSELSRKTVVHNWLGTGVAQKVVAAGLRCIVSNQDSWYLDHIDTSWEKF  437

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NI +P+ Q LV+GGEVCMWGE +DAS+IEQTIWPRAAAAAERLWT  +NL  D
Sbjct  438  YANEPLQNIKNPRQQKLVIGGEVCMWGEVVDASNIEQTIWPRAAAAAERLWTQYDNLAKD  497

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P +V  RLAHFRCLLNQRG+ AAP+ G GR  P  PGSC +Q
Sbjct  498  PRQVFARLAHFRCLLNQRGIDAAPVSGLGRSDPWGPGSCFVQ  539



>ref|XP_010251932.1| PREDICTED: beta-hexosaminidase 3-like [Nelumbo nucifera]
Length=527

 Score =   327 bits (838),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 181/222 (82%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            F ++FK++FVHLGGDEV T CW +TPR+ +WL  +  +   AY+YFVLQ QKIALSHGYE
Sbjct  306  FKRVFKFRFVHLGGDEVKTDCWVTTPRVGRWLSKKGMNKSDAYKYFVLQVQKIALSHGYE  365

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG +LS KTVV NWL   + ++VVAAGLRCI+SNQD+WYLDH+D  W  F
Sbjct  366  VINWEETFNNFGKQLSPKTVVQNWLDNSVPEKVVAAGLRCIISNQDKWYLDHMDQSWRDF  425

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NITDP  + LV+GGEVCMWGE +D SDI+QTIWPRAAAAAERLWTS + L  D
Sbjct  426  YTNEPLSNITDPTQKKLVIGGEVCMWGEYVDGSDIQQTIWPRAAAAAERLWTSYDKLAKD  485

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P +V GRLAHFRCLLNQRG+AAAPL+G GR  P +PGSC+ Q
Sbjct  486  PEQVIGRLAHFRCLLNQRGIAAAPLLGYGRAVPTEPGSCYKQ  527



>gb|EMS52859.1| Beta-hexosaminidase subunit B2 [Triticum urartu]
Length=521

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 184/222 (83%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWT+TP I++WL   H +   AY+YFVL+AQKIA+SHGYE
Sbjct  300  FSKVFKFKFVHLGGDEVNTSCWTATPHIKEWLNNNHMNVSDAYRYFVLRAQKIAISHGYE  359

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL RKTVVHNWLGG +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  360  VINWEETFNNFGDKLDRKTVVHNWLGGDVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGF  419

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL  I + + Q LV+GGEVCMWGE IDASDIEQTIWPRAAAAAERLW+  E + +D
Sbjct  420  YLNEPLKGINNTEQQRLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWSPLEQIAED  479

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
                  RL+ FRCLLNQRGVAAAPL G GR AP +PG C  Q
Sbjct  480  TRSATSRLSRFRCLLNQRGVAAAPLAGDGRTAPYEPGPCVRQ  521



>gb|EMT19841.1| Beta-hexosaminidase subunit B2 [Aegilops tauschii]
Length=521

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 184/222 (83%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWT TP I++WL   H +   AY+YFVL+AQKIA+SHGYE
Sbjct  300  FSKVFKFKFVHLGGDEVNTSCWTETPHIKEWLNNNHMNVSDAYRYFVLRAQKIAISHGYE  359

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL RKTVVHNWLGG +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  360  VINWEETFNNFGDKLDRKTVVHNWLGGDVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGF  419

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL  I + + Q LV+GGEVCMWGE IDASDIEQTIWPRAAAAAERLW+  E + +D
Sbjct  420  YLNEPLKGINNTEQQRLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWSPLEQIAED  479

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
                  RL+ FRCLLNQRGVAAAPL G+GR AP +PG C  Q
Sbjct  480  TRSATSRLSRFRCLLNQRGVAAAPLAGNGRTAPYEPGPCVRQ  521



>ref|XP_004963769.1| PREDICTED: beta-hexosaminidase 3-like [Setaria italica]
Length=519

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 184/222 (83%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KF+HLGGDEVNT+CWT+TPRI++WL     D   AY+YFVL+AQKIA S+GY+
Sbjct  298  FSKIFKFKFIHLGGDEVNTSCWTTTPRIKEWLILNGMDETDAYRYFVLRAQKIARSYGYD  357

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEE FNNFG+KL R TVVHNWLGG +A++ VAAGLRCI+S Q+ WYLDHLDAPW+GF
Sbjct  358  IINWEEPFNNFGDKLDRNTVVHNWLGGTVAEKAVAAGLRCILSKQESWYLDHLDAPWEGF  417

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI  P+ Q L+LGGEVCMWGE +DASDI+QTIWPRAAAAAERLWT  E +  +
Sbjct  418  YMNEPLANIYKPEQQRLILGGEVCMWGEQVDASDIQQTIWPRAAAAAERLWTPIEKIATN  477

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
             + VA RLA FRCLLNQRGVAAAPLVG GR AP  PGSC  Q
Sbjct  478  TSMVAPRLARFRCLLNQRGVAAAPLVGYGRSAPSDPGSCISQ  519



>emb|CDM85418.1| unnamed protein product [Triticum aestivum]
Length=521

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 182/222 (82%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KF HLGGDEVNT+CWT TP I++WL   H +   AY+YFVL+AQKIA+SHGYE
Sbjct  300  FSKVFKFKFAHLGGDEVNTSCWTETPHIKEWLNNNHMNVSDAYRYFVLRAQKIAISHGYE  359

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL RKTVVHNWLGG +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  360  VINWEETFNNFGDKLDRKTVVHNWLGGDVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGF  419

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL  I + + Q LV+GGEVCMWGE IDASDIEQTIWPRAAAAAERLW+  E + +D
Sbjct  420  YLNEPLKGINNTEQQRLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWSPLEQIAED  479

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
                  RL+ FRCLLNQRGVAAAPL G GR AP +PG C  Q
Sbjct  480  TRSATSRLSRFRCLLNQRGVAAAPLAGDGRTAPYEPGPCVRQ  521



>ref|NP_001170188.1| hypothetical protein precursor [Zea mays]
 gb|ACN36154.1| unknown [Zea mays]
 gb|AFW84326.1| hypothetical protein ZEAMMB73_740578 [Zea mays]
Length=525

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 179/222 (81%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNT+CWT TP IE WL   H +   AY+ FVL++QKIA+SHGY+
Sbjct  304  FSKIFKFKFVHLGGDEVNTSCWTRTPHIEGWLNNNHMNVSDAYRDFVLRSQKIAISHGYD  363

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFN+FG+KL  KTVVHNWLG  +A +VVAAG RCIVSNQD+WYLDHLDA W+GF
Sbjct  364  VINWEETFNSFGDKLDPKTVVHNWLGEDVAPKVVAAGHRCIVSNQDKWYLDHLDASWEGF  423

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL  I D K Q LV+GGEVCMWGE IDASDI+QTIWPRAAAAAERLWT  E L +D
Sbjct  424  YMNEPLKGINDTKQQQLVIGGEVCMWGEEIDASDIQQTIWPRAAAAAERLWTPIEKLAND  483

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
               V  RLA FRCLLNQRGVAAAPL G GR +P +PG C  Q
Sbjct  484  TRFVTSRLARFRCLLNQRGVAAAPLAGYGRASPSEPGPCVRQ  525



>ref|XP_010277798.1| PREDICTED: beta-hexosaminidase 3-like [Nelumbo nucifera]
 ref|XP_010277799.1| PREDICTED: beta-hexosaminidase 3-like [Nelumbo nucifera]
Length=527

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 182/222 (82%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            F K F ++FVHLGGDEV+T CW  TP ++KWL     +   AY+YFVL+AQ IALSHG+E
Sbjct  306  FKKTFNFRFVHLGGDEVDTGCWVITPHVKKWLIKHRMNESDAYKYFVLRAQHIALSHGFE  365

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETFNNFG +L+ KTVVHNWLGGG+AQ+VV AGLRCIVSNQD+WYLDHLDA W GF
Sbjct  366  IVNWEETFNNFGKQLNPKTVVHNWLGGGVAQKVVLAGLRCIVSNQDKWYLDHLDATWQGF  425

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NIT+P  Q LV+GGEVCMWGE +DASD+EQTIWPRAAAAAERLWT  + L  +
Sbjct  426  YMNEPLTNITNPNEQKLVIGGEVCMWGERVDASDLEQTIWPRAAAAAERLWTPYDKLAKN  485

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P +V GRL+HFRCLL QRGVAAAPL G GR  PE+PGSC+ Q
Sbjct  486  PKQVIGRLSHFRCLLTQRGVAAAPLAGLGRAVPEEPGSCYKQ  527



>gb|ERN20212.1| hypothetical protein AMTR_s00066p00132700 [Amborella trichopoda]
Length=384

 Score =   315 bits (806),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 178/222 (80%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+F +KFVHLGGDEV+ +CW +TP + +WL     +   AY+YFVL+AQKIA+SHGY+
Sbjct  163  FSKVFNFKFVHLGGDEVDNSCWLTTPHVRQWLNRHGLNESDAYKYFVLRAQKIAISHGYD  222

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFN+FG  LS +TVVHNWLGG +A +VVAAGLRCIVSNQD WYLDHLD  W  F
Sbjct  223  VINWEETFNSFGKDLSPRTVVHNWLGGDVAPKVVAAGLRCIVSNQDMWYLDHLDTTWQKF  282

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEP  NITDPK QALV+GGEVCMWGE++DASD EQTIWPRAAAAAER+WT    L  +
Sbjct  283  YMNEPFTNITDPKQQALVIGGEVCMWGEHVDASDFEQTIWPRAAAAAERMWTPLNKLAKN  342

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V GRLAHFRCLLNQRGVAAAPL G GR AP  P SC+ Q
Sbjct  343  PRTVTGRLAHFRCLLNQRGVAAAPLAGPGRVAPLYPASCYSQ  384



>ref|XP_011628773.1| PREDICTED: beta-hexosaminidase 3 [Amborella trichopoda]
Length=439

 Score =   316 bits (810),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 178/222 (80%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+F +KFVHLGGDEV+ +CW +TP + +WL     +   AY+YFVL+AQKIA+SHGY+
Sbjct  218  FSKVFNFKFVHLGGDEVDNSCWLTTPHVRQWLNRHGLNESDAYKYFVLRAQKIAISHGYD  277

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFN+FG  LS +TVVHNWLGG +A +VVAAGLRCIVSNQD WYLDHLD  W  F
Sbjct  278  VINWEETFNSFGKDLSPRTVVHNWLGGDVAPKVVAAGLRCIVSNQDMWYLDHLDTTWQKF  337

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEP  NITDPK QALV+GGEVCMWGE++DASD EQTIWPRAAAAAER+WT    L  +
Sbjct  338  YMNEPFTNITDPKQQALVIGGEVCMWGEHVDASDFEQTIWPRAAAAAERMWTPLNKLAKN  397

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
            P  V GRLAHFRCLLNQRGVAAAPL G GR AP  P SC+ Q
Sbjct  398  PRTVTGRLAHFRCLLNQRGVAAAPLAGPGRVAPLYPASCYSQ  439



>gb|EEC79230.1| hypothetical protein OsI_19972 [Oryza sativa Indica Group]
Length=527

 Score =   315 bits (806),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 182/224 (81%), Gaps = 2/224 (1%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWTSTPR++ WL         AY+YFVL+AQKIA SHGYE
Sbjct  304  FSKVFKFKFVHLGGDEVNTSCWTSTPRVKAWLAQHGMKESDAYRYFVLRAQKIAKSHGYE  363

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL R+TVVHNWLGGG+A++VVAAGLRCIVSNQD+WYLDHL+  WDGF
Sbjct  364  VINWEETFNNFGDKLDRRTVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHLEVTWDGF  423

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPD-  302
            Y NEPL NI +P  Q LVLGGEVCMW E+IDASDI+QTIWPRAAAAAERLWT  E L   
Sbjct  424  YMNEPLRNIKNPAQQKLVLGGEVCMWAEHIDASDIQQTIWPRAAAAAERLWTPFEKLSKE  483

Query  301  -DPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
             +   ++ RLA FRCLLN RG+AA P+ G GR AP +P SC  Q
Sbjct  484  WEIAALSARLARFRCLLNHRGIAAGPVTGYGRSAPAEPSSCIKQ  527



>gb|AAT77374.1| putative beta-N-acetylhexosaminidase [Oryza sativa Japonica Group]
 gb|EEE63737.1| hypothetical protein OsJ_18555 [Oryza sativa Japonica Group]
Length=527

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 182/224 (81%), Gaps = 2/224 (1%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWTSTPR++ WL         AY+YFVL+AQKIA SHGYE
Sbjct  304  FSKVFKFKFVHLGGDEVNTSCWTSTPRVKAWLAQHGMKESDAYRYFVLRAQKIAKSHGYE  363

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL R+TVVHNWLGGG+A++VVAAGLRCIVSNQD+WYLDHL+  WDGF
Sbjct  364  VINWEETFNNFGDKLDRRTVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHLEVTWDGF  423

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPD-  302
            Y NEPL NI +P  Q LVLGGEVCMW E+IDASDI+QTIWPRAAAAAERLWT  E L   
Sbjct  424  YMNEPLRNIKNPAQQKLVLGGEVCMWAEHIDASDIQQTIWPRAAAAAERLWTPFEKLSKE  483

Query  301  -DPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
             +   ++ RLA FRCLLN RG+AA P+ G GR AP +P SC  Q
Sbjct  484  WEIAALSARLARFRCLLNHRGIAAGPVTGYGRSAPAEPSSCIKQ  527



>emb|CDP11166.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 183/222 (82%), Gaps = 0/222 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
             SKIFKY+FVHLGGDEVNT+CWTSTP +  WLK +  +G +AY+YFVL+AQ+IALS+GY+
Sbjct  260  ISKIFKYRFVHLGGDEVNTSCWTSTPHVSNWLKEQGLNGDEAYRYFVLKAQEIALSYGYK  319

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I+NWEETF NFG+KLSR+TV+H+WL GG+ QQ VAAG +CIVSNQ+ WYLD++   W  F
Sbjct  320  IVNWEETFVNFGSKLSRETVIHHWLRGGVVQQAVAAGFQCIVSNQESWYLDNVGTTWKTF  379

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y+NEPL NI  P+ +ALV+GGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + +  D
Sbjct  380  YANEPLFNIRKPQQKALVMGGEVCMWGERVDGSDIEQTIWPRAAAAAERLWTPYDKVAKD  439

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
              +V  RLAHFRCLLNQRGVAAAPL G GR AP +PGSC+ Q
Sbjct  440  TTEVTERLAHFRCLLNQRGVAAAPLTGWGRAAPMEPGSCYKQ  481



>ref|NP_001055557.1| Os05g0415700 [Oryza sativa Japonica Group]
 gb|AAV32135.1| putative beta-N-acetylhexosaminidase [Oryza sativa Japonica Group]
 dbj|BAF17471.1| Os05g0415700 [Oryza sativa Japonica Group]
 dbj|BAG95560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 182/224 (81%), Gaps = 2/224 (1%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWTSTPR++ WL         AY+YFVL+AQKIA SHGYE
Sbjct  308  FSKVFKFKFVHLGGDEVNTSCWTSTPRVKAWLAQHGMKESDAYRYFVLRAQKIAKSHGYE  367

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL R+TVVHNWLGGG+A++VVAAGLRCIVSNQD+WYLDHL+  WDGF
Sbjct  368  VINWEETFNNFGDKLDRRTVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHLEVTWDGF  427

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPD-  302
            Y NEPL NI +P  Q LVLGGEVCMW E+IDASDI+QTIWPRAAAAAERLWT  E L   
Sbjct  428  YMNEPLRNIKNPAQQKLVLGGEVCMWAEHIDASDIQQTIWPRAAAAAERLWTPFEKLSKE  487

Query  301  -DPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
             +   ++ RLA FRCLLN RG+AA P+ G GR AP +P SC  Q
Sbjct  488  WEIAALSARLARFRCLLNHRGIAAGPVTGYGRSAPAEPSSCIKQ  531



>ref|XP_010110142.1| Beta-hexosaminidase subunit [Morus notabilis]
 gb|EXC25311.1| Beta-hexosaminidase subunit [Morus notabilis]
Length=645

 Score =   315 bits (808),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 183/221 (83%), Gaps = 4/221 (2%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEI  656
            S  F +K +      + + CWT+TPRI KWL+ +  +G +AY+YFVL+AQ IALS+GY+I
Sbjct  429  SSEFTFKVI----SGILSGCWTTTPRIRKWLRKQGMNGSEAYEYFVLRAQNIALSYGYDI  484

Query  655  INWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFY  476
            +NWEETFNNFGN+LSRKTVVHNWLG G+AQ+ VAAGLRCIVSNQD+WYLDHLDA W GFY
Sbjct  485  VNWEETFNNFGNRLSRKTVVHNWLGDGVAQKAVAAGLRCIVSNQDKWYLDHLDAEWQGFY  544

Query  475  SNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDP  296
            SNEPL NIT+PK Q LV+GGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT  + L  DP
Sbjct  545  SNEPLANITNPKQQRLVIGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPYDKLAKDP  604

Query  295  NKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
              V GRLAHFRCLL QRG+AAAPL G GR APE+PGSC+ Q
Sbjct  605  RDVTGRLAHFRCLLTQRGIAAAPLAGPGRVAPEEPGSCYKQ  645



>ref|XP_006655326.1| PREDICTED: beta-hexosaminidase 3-like [Oryza brachyantha]
Length=544

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CW+STPR++ WL         AY+YFVL+AQKIA SHGYE
Sbjct  321  FSKVFKFKFVHLGGDEVNTSCWSSTPRVKAWLIQHGMKESDAYRYFVLRAQKIAKSHGYE  380

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL R+TVVHNWLGGG+A++VVAAGLRCIVSNQD+WYLDHL+  WDGF
Sbjct  381  VINWEETFNNFGDKLDRRTVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHLEVTWDGF  440

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEPL NI + + Q LVLGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT  E L  +
Sbjct  441  YMNEPLKNIKNLEQQKLVLGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPLEKLSKE  500

Query  298  PN--KVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSC  182
                 ++ RLA FRCLLN RG+AA P+ G GR AP +P SC
Sbjct  501  YEVPVLSTRLARFRCLLNHRGIAAGPVTGYGRSAPAEPSSC  541



>gb|KHG19961.1| hexa[2]: Beta-hexosaminidase subunit A1 [Gossypium arboreum]
Length=403

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 152/218 (70%), Gaps = 24/218 (11%)
 Frame = -1

Query  826  FKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEIINW  647
            F +K +    D + + CWT+TPRI  WLK R  +  QAYQYFVL+AQ IALSHGYEIINW
Sbjct  210  FTFKVI----DGILSGCWTTTPRIRNWLKKRGMNESQAYQYFVLRAQNIALSHGYEIINW  265

Query  646  EETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSNE  467
                   G  ++++ V                 LRCIVSNQD+WYLDHLD PW  FY+NE
Sbjct  266  ------LGGGVAQRVVASG--------------LRCIVSNQDKWYLDHLDTPWQEFYANE  305

Query  466  PLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNKV  287
            PL NIT+ K Q LV+GGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + L  +P  V
Sbjct  306  PLTNITNLKQQKLVIGGEVCMWGETVDGSDIEQTIWPRAAAAAERLWTPFDKLAKNPRDV  365

Query  286  AGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
             GRLAHFRCLLNQRGVAAAP+ G GR APE PGSC+ Q
Sbjct  366  TGRLAHFRCLLNQRGVAAAPVAGLGRAAPEGPGSCYRQ  403



>gb|KHG19960.1| hexb2 [Gossypium arboreum]
Length=538

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 152/218 (70%), Gaps = 24/218 (11%)
 Frame = -1

Query  826  FKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEIINW  647
            F +K +    D + + CWT+TPRI  WLK R  +  QAYQYFVL+AQ IALSHGYEIINW
Sbjct  345  FTFKVI----DGILSGCWTTTPRIRNWLKKRGMNESQAYQYFVLRAQNIALSHGYEIINW  400

Query  646  EETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSNE  467
                   G  ++++ V                 LRCIVSNQD+WYLDHLD PW  FY+NE
Sbjct  401  ------LGGGVAQRVVASG--------------LRCIVSNQDKWYLDHLDTPWQEFYANE  440

Query  466  PLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNKV  287
            PL NIT+ K Q LV+GGEVCMWGE +D SDIEQTIWPRAAAAAERLWT  + L  +P  V
Sbjct  441  PLTNITNLKQQKLVIGGEVCMWGETVDGSDIEQTIWPRAAAAAERLWTPFDKLAKNPRDV  500

Query  286  AGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
             GRLAHFRCLLNQRGVAAAP+ G GR APE PGSC+ Q
Sbjct  501  TGRLAHFRCLLNQRGVAAAPVAGLGRAAPEGPGSCYRQ  538



>ref|XP_002981850.1| hypothetical protein SELMODRAFT_445016 [Selaginella moellendorffii]
 gb|EFJ16943.1| hypothetical protein SELMODRAFT_445016 [Selaginella moellendorffii]
Length=537

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 161/242 (67%), Gaps = 20/242 (8%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            F+K F +KF+HLGGDEV+TTCW  T  I +WL   +F  +Q Y+YFVL+AQKIAL +G  
Sbjct  296  FAKTFPFKFMHLGGDEVDTTCWKKTRHIARWLAHNNFTAKQGYEYFVLRAQKIALKYGLT  355

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggg--------------------laqqvvaagLRC  539
             +NWEETFNNFG+KL+ +T++HNW                        LA  VV AG +C
Sbjct  356  PVNWEETFNNFGSKLNNETIIHNWSKLYPYVFLGYSHSWNLLFRIGPGLAPLVVGAGFKC  415

Query  538  IVSNQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIW  359
            IVS+QD WYLDHLD PW  FY NEPL NIT    Q+L++GGEVCMWGE +D SDI QTIW
Sbjct  416  IVSDQDVWYLDHLDVPWQSFYKNEPLTNITGEHEQSLIIGGEVCMWGETVDPSDIHQTIW  475

Query  358  PRAAAAAERLWTSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCH  179
            PRAAAAAERLW+         ++V  RL  FRCLL QRG+ AAP+   GR +P  PGSC+
Sbjct  476  PRAAAAAERLWSPRSFTDQGTSQVHSRLKTFRCLLQQRGIPAAPVDELGRVSPPYPGSCY  535

Query  178  LQ  173
             Q
Sbjct  536  DQ  537



>gb|ERN19143.1| hypothetical protein AMTR_s00061p00161080 [Amborella trichopoda]
Length=544

 Score =   263 bits (672),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW STP +++WL+  +   + AYQYFVL+ Q+IA++  +  +
Sbjct  324  KIFPFELFHLGGDEVNTDCWNSTPHVKQWLQDHNMTAKDAYQYFVLRGQQIAIAQKWTPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   LS +TVVHNWLG G+  Q VA G +CIVSNQ  WYLDHLD PW+ FY+
Sbjct  384  NWEETFNTFKENLSPQTVVHNWLGPGVCPQAVAKGFKCIVSNQGVWYLDHLDIPWEDFYT  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
            +EPL+ I D  HQ LVLGGEVCMWGE +DASD++QTIWPRAAAA+ERLW+  +      +
Sbjct  444  SEPLEGIDDASHQKLVLGGEVCMWGETVDASDVQQTIWPRAAAASERLWSPRDATSTGLD  503

Query  292  KVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             V  RL +FRCLLNQRG+AAAP+     R  P  PGSC+ Q
Sbjct  504  TVLQRLEYFRCLLNQRGIAAAPVANEYARRPPIGPGSCYAQ  544



>ref|XP_006857676.2| PREDICTED: beta-hexosaminidase 1 [Amborella trichopoda]
Length=562

 Score =   263 bits (672),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW STP +++WL+  +   + AYQYFVL+ Q+IA++  +  +
Sbjct  342  KIFPFELFHLGGDEVNTDCWNSTPHVKQWLQDHNMTAKDAYQYFVLRGQQIAIAQKWTPV  401

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   LS +TVVHNWLG G+  Q VA G +CIVSNQ  WYLDHLD PW+ FY+
Sbjct  402  NWEETFNTFKENLSPQTVVHNWLGPGVCPQAVAKGFKCIVSNQGVWYLDHLDIPWEDFYT  461

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
            +EPL+ I D  HQ LVLGGEVCMWGE +DASD++QTIWPRAAAA+ERLW+  +      +
Sbjct  462  SEPLEGIDDASHQKLVLGGEVCMWGETVDASDVQQTIWPRAAAASERLWSPRDATSTGLD  521

Query  292  KVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             V  RL +FRCLLNQRG+AAAP+     R  P  PGSC+ Q
Sbjct  522  TVLQRLEYFRCLLNQRGIAAAPVANEYARRPPIGPGSCYAQ  562



>ref|XP_006436102.1| hypothetical protein CICLE_v10031139mg [Citrus clementina]
 gb|ESR49342.1| hypothetical protein CICLE_v10031139mg [Citrus clementina]
Length=540

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 162/223 (73%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW+STP ++KWL+      ++AYQYFVL AQKIA+S  +  +
Sbjct  318  KIFPFELFHLGGDEVNTDCWSSTPHVKKWLRDHKMTAKEAYQYFVLTAQKIAISKNWTPV  377

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F + L+ +TVVHNWLGGG+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  378  NWEETFNSFASNLNPRTVVHNWLGGGVCPKAVAKGFRCIYSNQGFWYLDHLDVPWDEVYT  437

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I+DP +Q LVLGGEVCMWGE  D SDI QTIWPRAAAAAERLW+  E +     
Sbjct  438  AEPLEGISDPSNQELVLGGEVCMWGETADTSDIHQTIWPRAAAAAERLWSRREAISSGNI  497

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             +    RL +FRCLLN+RGV AAP++    R  P  PGSC++Q
Sbjct  498  TLTALPRLHYFRCLLNRRGVQAAPVLNKYAREPPIGPGSCYVQ  540



>ref|XP_006436103.1| hypothetical protein CICLE_v10031139mg [Citrus clementina]
 ref|XP_006486023.1| PREDICTED: beta-hexosaminidase 1-like [Citrus sinensis]
 gb|ESR49343.1| hypothetical protein CICLE_v10031139mg [Citrus clementina]
Length=552

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 162/223 (73%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW+STP ++KWL+      ++AYQYFVL AQKIA+S  +  +
Sbjct  330  KIFPFELFHLGGDEVNTDCWSSTPHVKKWLRDHKMTAKEAYQYFVLTAQKIAISKNWTPV  389

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F + L+ +TVVHNWLGGG+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  390  NWEETFNSFASNLNPRTVVHNWLGGGVCPKAVAKGFRCIYSNQGFWYLDHLDVPWDEVYT  449

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I+DP +Q LVLGGEVCMWGE  D SDI QTIWPRAAAAAERLW+  E +     
Sbjct  450  AEPLEGISDPSNQELVLGGEVCMWGETADTSDIHQTIWPRAAAAAERLWSRREAISSGNI  509

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             +    RL +FRCLLN+RGV AAP++    R  P  PGSC++Q
Sbjct  510  TLTALPRLHYFRCLLNRRGVQAAPVLNKYAREPPIGPGSCYVQ  552



>ref|XP_002982816.1| hypothetical protein SELMODRAFT_445341 [Selaginella moellendorffii]
 gb|EFJ16061.1| hypothetical protein SELMODRAFT_445341 [Selaginella moellendorffii]
Length=531

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 156/237 (66%), Gaps = 20/237 (8%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            F+K F +KF+HLGGDEV+TTCW  T  I +WL   +F  +Q Y+YFVL+AQKIAL +G  
Sbjct  273  FAKTFPFKFMHLGGDEVDTTCWKKTRHIARWLAHNNFTAKQGYEYFVLRAQKIALKYGLT  332

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggg--------------------laqqvvaagLRC  539
             +NWEETFNNFG+KL+ +T++HNW                        LA  VV AG +C
Sbjct  333  PVNWEETFNNFGSKLNNETIIHNWSKLYPYVFLGYSHSWNLLFRIGPGLAPLVVGAGFKC  392

Query  538  IVSNQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIW  359
            IVS+QD WYLDHLD PW  FY NEPL NIT    Q+L++GGEVCMWGE +D SDI QTIW
Sbjct  393  IVSDQDVWYLDHLDVPWQSFYKNEPLTNITGEHEQSLIIGGEVCMWGETVDPSDIHQTIW  452

Query  358  PRAAAAAERLWTSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPG  188
            PRAAAAAERLW+         ++V  RL  FRCLL QRG+ AAP+   GR +P  P 
Sbjct  453  PRAAAAAERLWSPRSFTDQGTSQVHSRLKTFRCLLQQRGIPAAPVDELGRVSPPYPA  509



>ref|XP_008649646.1| PREDICTED: beta-hexosaminidase 3 isoform X2 [Zea mays]
Length=492

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFK+KFVHLGGDEVNT+CW++TP I+ WL     +   AY+YFVL+AQKIA+SHGY+
Sbjct  308  FSKIFKFKFVHLGGDEVNTSCWSTTPHIKSWLMQHSMNESDAYRYFVLRAQKIAISHGYD  367

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            IINWEETFNNFG+KL RKTVVHNWLG G+A++VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  368  IINWEETFNNFGDKLDRKTVVHNWLGSGVAEKVVAAGLRCIVSNQDKWYLDHLDATWEGF  427

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPR  353
            Y+NEPL NI +P+ Q LVLGGEVCMWGE+IDASDI+QTIWPR
Sbjct  428  YTNEPLTNIYNPEQQKLVLGGEVCMWGEHIDASDIQQTIWPR  469



>ref|XP_010321284.1| PREDICTED: beta-hexosaminidase 2 isoform X1 [Solanum lycopersicum]
Length=540

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCWT+TP +++WL+      + AYQYFVL+AQ+IA+SH +  +
Sbjct  318  KIFPFELFHLGGDEVNTTCWTTTPHVKQWLQDHKMTAKDAYQYFVLKAQEIAISHNWTPV  377

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFNNF +KL+ +TVVHNWL G +  + VA+G RCI SNQ  WYLDHLD PW+  Y 
Sbjct  378  NWEETFNNFPSKLNPRTVVHNWLVGDVCAKAVASGFRCIYSNQGYWYLDHLDVPWEEVYY  437

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q L+LGGEVCMWGE  DASD++QTIWPRAAAAAERLW+  E       
Sbjct  438  AEPLEGIKSISEQKLILGGEVCMWGETADASDVQQTIWPRAAAAAERLWSDKETTSSKNT  497

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
                  RL +FRCLL +RGV AAP+     R  P  PGSC+ Q
Sbjct  498  TSTTLQRLEYFRCLLTRRGVPAAPVTNFYARRPPLGPGSCYEQ  540



>ref|XP_009789884.1| PREDICTED: beta-hexosaminidase 1 [Nicotiana sylvestris]
Length=540

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 157/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++F HLGGDEVNTTCWT+TP I++WL+  +   + AY+YFVL+AQ+IA+SH +  +
Sbjct  318  KIFPFEFFHLGGDEVNTTCWTTTPHIKQWLQDHNMTSKDAYEYFVLRAQEIAISHNWTPV  377

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL+ +TVVHNWL GG+ Q+ VA G RCI SNQ  WYLDHLD PWD  Y 
Sbjct  378  NWEETFNTFPSKLNPQTVVHNWLRGGVCQEAVAKGFRCIYSNQGFWYLDHLDVPWDKVYY  437

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q L+LGGE CMWGE  DASD++QTIWPRAAA AERLW+  E       
Sbjct  438  TEPLEGIKSISEQKLLLGGEACMWGETADASDVQQTIWPRAAAVAERLWSDKEATSSTNT  497

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              A   RL +FRCLL +RGV AAP+     R  P  PGSC+ Q
Sbjct  498  TSAALQRLEYFRCLLTRRGVPAAPVTNFYARRPPLGPGSCYEQ  540



>ref|NP_001234613.1| beta-hexosaminidase 2 [Solanum lycopersicum]
 gb|ABY83273.1| beta-hexosaminidase 2 [Solanum lycopersicum]
Length=552

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCWT+TP +++WL+      + AYQYFVL+AQ+IA+SH +  +
Sbjct  330  KIFPFELFHLGGDEVNTTCWTTTPHVKQWLQDHKMTAKDAYQYFVLKAQEIAISHNWTPV  389

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFNNF +KL+ +TVVHNWL G +  + VA+G RCI SNQ  WYLDHLD PW+  Y 
Sbjct  390  NWEETFNNFPSKLNPRTVVHNWLVGDVCAKAVASGFRCIYSNQGYWYLDHLDVPWEEVYY  449

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q L+LGGEVCMWGE  DASD++QTIWPRAAAAAERLW+  E       
Sbjct  450  AEPLEGIKSISEQKLILGGEVCMWGETADASDVQQTIWPRAAAAAERLWSDKETTSSKNT  509

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
                  RL +FRCLL +RGV AAP+     R  P  PGSC+ Q
Sbjct  510  TSTTLQRLEYFRCLLTRRGVPAAPVTNFYARRPPLGPGSCYEQ  552



>ref|XP_011076893.1| PREDICTED: beta-hexosaminidase 1 [Sesamum indicum]
 ref|XP_011076894.1| PREDICTED: beta-hexosaminidase 1 [Sesamum indicum]
Length=562

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEV+T CW+STP +++WL+  +  G+ AYQYFVL+AQ+IA+S  +  +
Sbjct  342  KIFPFELFHLGGDEVHTDCWSSTPHVKQWLQDHNMTGKDAYQYFVLRAQEIAISLNWTPV  401

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   L+ +TVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PW+  Y 
Sbjct  402  NWEETFNAFATSLNPRTVVHNWLGSGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWESVYY  461

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ ITD   Q LVLGGEVCMWGE  DAS+++QTIWPRAAAAAERLW++ E+  +  +
Sbjct  462  AEPLEGITDVSEQKLVLGGEVCMWGETADASNVQQTIWPRAAAAAERLWSNKESSGNPRS  521

Query  292  KVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             V  RL +FRCLL +RGV AAP+     R  P  PGSC+ Q
Sbjct  522  SVLPRLEYFRCLLTRRGVPAAPVRNFYARRPPGGPGSCYEQ  562



>ref|XP_004307561.1| PREDICTED: beta-hexosaminidase 1 [Fragaria vesca subsp. vesca]
Length=532

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 160/223 (72%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW  TP + KWL+ ++   + AYQYFVL+AQ+IA+S  +  +
Sbjct  310  KIFPFELFHLGGDEVNTTCWEDTPHVNKWLEQQNMTAKGAYQYFVLKAQEIAISKNWTPV  369

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL+ KTVVHNWLGGG+  + V  G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  370  NWEETFNTFPTKLNPKTVVHNWLGGGVCPKAVDQGFRCIFSNQGVWYLDHLDVPWDVTYN  429

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP-DDP  296
             +PL+ I D   Q LVLGGEVCMWGE  D S+++QTIWPRAAAAAERLW++ E+      
Sbjct  430  ADPLEGIHDSSKQKLVLGGEVCMWGETADPSNVQQTIWPRAAAAAERLWSTKESTTGKSS  489

Query  295  NKVA-GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
            NK A  RL +FRCLLN+RGV AAP+     R AP   GSC++Q
Sbjct  490  NKTALPRLHYFRCLLNRRGVQAAPVENFYARSAPTGAGSCYVQ  532



>ref|XP_009631516.1| PREDICTED: beta-hexosaminidase 1 [Nicotiana tomentosiformis]
Length=540

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCWT+TP I++WL+  +   + AY+YFVL+AQ+IA+SH +  +
Sbjct  318  KIFPFELFHLGGDEVNTTCWTTTPHIKQWLQDHNMTSKDAYEYFVLRAQEIAISHSWTPV  377

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL+ +TVVHNWL G + Q+ VA G RCI SNQ  WYLDHLD PWD  Y 
Sbjct  378  NWEETFNTFPSKLNPQTVVHNWLRGDVCQKAVAKGFRCIYSNQGFWYLDHLDVPWDKVYY  437

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LVLGGE CMWGE  DASD++QTIWPRAAA AERLW+  E       
Sbjct  438  TEPLEGIKSISAQKLVLGGEACMWGETADASDVQQTIWPRAAAVAERLWSDKEATSSTNT  497

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              A   RL +FRCLL +RGV AAP+     R  P  PGSC+ Q
Sbjct  498  TSAALQRLEYFRCLLTRRGVPAAPVTNFYARRPPIGPGSCYEQ  540



>ref|XP_006345934.1| PREDICTED: beta-hexosaminidase 1-like [Solanum tuberosum]
Length=557

 Score =   252 bits (644),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCWT+TP +++WL+  +   + AYQYFVL+AQ+IA+SH +  +
Sbjct  335  KIFPFELFHLGGDEVNTTCWTTTPHVKQWLQDHNMTAKDAYQYFVLKAQEIAISHNWTPV  394

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFNNF +KL+ +TVVHNWL G +  + VA+G RCI SNQ  WYLDHLDAPW+  Y 
Sbjct  395  NWEETFNNFPSKLNPRTVVHNWLRGDVCAKAVASGFRCIWSNQGYWYLDHLDAPWEEVYY  454

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LVLGGEVCMWGE  DAS+++QTIWPRAAAAAERLW+  E       
Sbjct  455  AEPLEGIKSISEQNLVLGGEVCMWGETADASNVQQTIWPRAAAAAERLWSDKETTSSRNT  514

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
                  RL +FRCLL +RGV AAP+     R  P  PGSC+ Q
Sbjct  515  TSTALQRLEYFRCLLTRRGVPAAPVTNFYARRPPLGPGSCYEQ  557



>ref|XP_009402372.1| PREDICTED: beta-hexosaminidase 1 [Musa acuminata subsp. malaccensis]
Length=550

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 160/223 (72%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEVNT CW ST  +++WL+ R+   ++AYQYFVL+AQKIA S G+  +
Sbjct  328  KIFPFGLFHLGGDEVNTDCWNSTRHVKQWLQERNMTTKEAYQYFVLRAQKIATSLGWIPV  387

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   L  +TVVHNWLG G+  Q VA G RCI+SNQ  WYLDHLD PW+ FY+
Sbjct  388  NWEETFNTFKENLDLQTVVHNWLGPGVCPQAVAKGFRCIMSNQGVWYLDHLDVPWENFYN  447

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSE--NLPDD  299
             EPL+ I +   Q LVLGGEVCMWGE +D S+++QTIWPRAAAAAERLW+S E  ++ + 
Sbjct  448  TEPLEGINNITQQKLVLGGEVCMWGEAVDTSNVQQTIWPRAAAAAERLWSSWEATSVGNL  507

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RG+AAAP+     R AP  P SC LQ
Sbjct  508  NTTVLPRLHYFRCLLNHRGIAAAPVTNKHAREAPYGPASCFLQ  550



>emb|CDP00030.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 157/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            +IF +KF HLGGDEVNT CW STP +++WL+  +   +  YQYFVL+AQ+IALS  +  +
Sbjct  329  EIFPFKFFHLGGDEVNTDCWNSTPHVKQWLQDHNMTVKDGYQYFVLKAQEIALSLNWTPV  388

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL+ +TVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PW+  Y 
Sbjct  389  NWEETFNTFPSKLNPQTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWNETYY  448

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSE--NLPDD  299
             EPL+ I D   Q LVLGGEVCMW E  D SD++QTIWPRAAAAAERLW+  E  + PD 
Sbjct  449  AEPLEGIKDASEQRLVLGGEVCMWSETADTSDVQQTIWPRAAAAAERLWSDREATSAPDT  508

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
                  RL +FRCLLN+RGVAAAP+     R  P  PGSC+ Q
Sbjct  509  KLSALNRLEYFRCLLNRRGVAAAPVRNQYARRPPIGPGSCYDQ  551



>gb|KHN37321.1| Beta-hexosaminidase subunit B2 [Glycine soja]
Length=543

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 155/222 (70%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CWT+T  + KWL+  +   + AYQYFVL+AQ IAL+  +  +
Sbjct  322  KIFPFELFHLGGDEVNTDCWTNTSTVNKWLRNHNMTAKDAYQYFVLKAQNIALTKNWSPV  381

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL  +TVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  382  NWEETFNTFPTKLHPRTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDDVYT  441

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  ++   + N
Sbjct  442  AEPLEGIRKASEQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRRDSTSGNVN  501

Query  292  KVA-GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +A  RL +FRCLLN+RG+ AAP+     R AP  PGSC  Q
Sbjct  502  IIALPRLHYFRCLLNRRGIPAAPVKNFIARTAPVGPGSCFEQ  543



>ref|XP_003535778.1| PREDICTED: beta-hexosaminidase 1-like [Glycine max]
Length=543

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 155/222 (70%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CWT+T  + KWL+  +   + AYQYFVL+AQ IAL+  +  +
Sbjct  322  KIFPFELFHLGGDEVNTDCWTNTSTVNKWLRNHNMTAKDAYQYFVLKAQNIALTKNWSPV  381

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL  +TVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  382  NWEETFNTFPTKLHPRTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDDVYT  441

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  ++   + N
Sbjct  442  AEPLEGIRKASEQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRRDSTSGNVN  501

Query  292  KVA-GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +A  RL +FRCLLN+RG+ AAP+     R AP  PGSC  Q
Sbjct  502  IIALPRLHYFRCLLNRRGIPAAPVKNFIARTAPVGPGSCFEQ  543



>ref|XP_007142707.1| hypothetical protein PHAVU_007G010100g [Phaseolus vulgaris]
 gb|ESW14701.1| hypothetical protein PHAVU_007G010100g [Phaseolus vulgaris]
Length=565

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CWT+T  + KWL++++   + AY+YFVL+AQKIA+S  +  +
Sbjct  344  KIFPFELFHLGGDEVNTDCWTNTSAVNKWLQSKNMTAEDAYEYFVLKAQKIAISKNWSPV  403

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   L  KTVVHNWLG G+  + VA G RCI SNQ  WYLDHL+  W+  Y+
Sbjct  404  NWEETFNTFPTNLHPKTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLNVRWETLYT  463

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LV+GGEVCMWGE  D SD++QTIWPRAAAAAERLW+  ++      
Sbjct  464  AEPLEGIHKTSEQKLVIGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSPRDSSTAHAT  523

Query  292  KVAG-RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
            ++A  RL +FRCLLN+RGVAAAP+     R AP+ PGSC +Q
Sbjct  524  EIAMRRLQYFRCLLNRRGVAAAPVTNYEARAAPDSPGSCFVQ  565



>gb|EYU19904.1| hypothetical protein MIMGU_mgv1a003720mg [Erythranthe guttata]
Length=568

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 158/221 (71%), Gaps = 1/221 (0%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEV+T CWTSTP + +WL+ ++  G+ AY+YFVL+AQ+IA++  +  +
Sbjct  348  KIFPFELFHLGGDEVHTDCWTSTPHVNQWLQDQNMTGKDAYKYFVLRAQEIAVALNWTPV  407

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F   L+ +TVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PWD  Y 
Sbjct  408  NWEETFNSFPESLNNETVVHNWLGSGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDSVYY  467

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             +PL+ ITD   Q LVLGGEVCMWGE  DAS+++QTIWPRAAAAAERLW+ +++      
Sbjct  468  ADPLEGITDSSEQKLVLGGEVCMWGETADASNVQQTIWPRAAAAAERLWSEADSASSRNT  527

Query  292  KVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             V  RL +FRCLL +RGV AAP+     R  P   GSC+ Q
Sbjct  528  SVLPRLEYFRCLLTRRGVQAAPVQNFYARSPPTGTGSCYSQ  568



>gb|KCW65489.1| hypothetical protein EUGRSUZ_G02896 [Eucalyptus grandis]
Length=428

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 159/223 (71%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CWTSTP +++WL+  +   + AY+YFVL+AQ+IA+S  +  +
Sbjct  206  KIFPFELFHLGGDEVNTDCWTSTPHVKQWLQNHNMTSKDAYKYFVLKAQEIAISKNWTPV  265

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   L+ +T+VHNWLG G+  + VA G +CI SNQ  WYLDHLD PWD  Y+
Sbjct  266  NWEETFNAFPESLNPRTIVHNWLGAGVCPKAVAKGFKCIFSNQGFWYLDHLDVPWDQVYT  325

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPD-DP  296
             EPL+ I+D   Q LV+GGEVCMWGE  D S+++QTIWPRAAAAAERLW+  + +   + 
Sbjct  326  AEPLEGISDASKQKLVIGGEVCMWGEITDTSNVQQTIWPRAAAAAERLWSRRDAISSGNI  385

Query  295  NKVA-GRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
            NK A  RL +FRCLLN RGVAAAP+     R  P  P SC+ Q
Sbjct  386  NKTALPRLHYFRCLLNGRGVAAAPVTNQYARSQPNGPASCYAQ  428



>gb|ABR16487.1| unknown [Picea sitchensis]
Length=554

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 159/223 (71%), Gaps = 1/223 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
              KIF +   HLGGDEV+T CWT++P+I++WL   +      Y+YFVL+AQ++A++ G+ 
Sbjct  332  LRKIFSFGLFHLGGDEVHTDCWTNSPKIKEWLDEHNMTAYDGYEYFVLRAQELAITQGWT  391

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             +NWEETFN F  +L+  TVVHNWLG G+  + VA G +CI SNQ  WYLDHLD PW+  
Sbjct  392  PVNWEETFNAFSERLNPNTVVHNWLGSGVCPRAVAKGFKCIFSNQGVWYLDHLDVPWEKV  451

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YS++PL+ I D   Q LV+GGEVCMWGE  DASDI+QTIWPRAAAAAERLW++ ++  + 
Sbjct  452  YSSDPLEGIADASQQQLVIGGEVCMWGETADASDIQQTIWPRAAAAAERLWSTEDDTSNG  511

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             +    RL +FRC+LNQRG+AAAP+     R  P   GSC++Q
Sbjct  512  LSTALPRLRNFRCVLNQRGIAAAPVTNELAREPPIGAGSCYMQ  554



>ref|XP_010937791.1| PREDICTED: LOW QUALITY PROTEIN: beta-hexosaminidase 1, partial 
[Elaeis guineensis]
Length=558

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 158/226 (70%), Gaps = 9/226 (4%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEVNT CW STP +++WL+  +   + AYQYFVL+AQ+IA++ G+  +
Sbjct  336  KIFPFGLFHLGGDEVNTDCWDSTPHVKQWLQEHNMTTKDAYQYFVLRAQEIAIALGWIPV  395

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   L+ +TV+HNWLG G+  + VA G RCIVSNQ  WYLDHLD PW+ FY+
Sbjct  396  NWEETFNTFKENLNPQTVIHNWLGPGVCPKAVAKGFRCIVSNQGVWYLDHLDIPWEDFYN  455

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW-----TSSENL  308
            +EPLD I     Q LVLGGEVCMWGE  D SD+ QTIWPRAAAAAERLW     TS+ NL
Sbjct  456  SEPLDGINSTLQQELVLGGEVCMWGETADTSDVLQTIWPRAAAAAERLWSPLDATSAGNL  515

Query  307  PDDPNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
                + V  RL +FRCLLN RGVAAAP+     R  P  PGSC  Q
Sbjct  516  ---NSTVLSRLHYFRCLLNHRGVAAAPVTSKYARRPPIGPGSCFAQ  558



>ref|XP_003569011.1| PREDICTED: beta-hexosaminidase 1 [Brachypodium distachyon]
Length=543

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEVNT CW  TP +++WL  R+   + AY++FVL+AQ+IA++  +  +
Sbjct  322  KIFPFGLFHLGGDEVNTGCWNITPHVKQWLDDRNMTTKDAYKFFVLKAQEIAINLNWIPV  381

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+FG  L+  TVVHNWLG G+  +VVA GLRCI+SNQ  WYLDHLD PW+  Y+
Sbjct  382  NWEETFNSFGENLNPLTVVHNWLGPGVCPKVVAKGLRCIMSNQGAWYLDHLDVPWEDVYT  441

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP-DDP  296
             EPL  I D + Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAER+W+  E +   D 
Sbjct  442  TEPLAGINDTEQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERMWSPLEAISVQDQ  501

Query  295  NKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              V  RL +FRCLLN RG+AAAP+     R  P  PGSC +Q
Sbjct  502  TIVLARLHYFRCLLNHRGIAAAPVTNYYARRPPIHPGSCFIQ  543



>ref|XP_008245395.1| PREDICTED: beta-hexosaminidase 1-like, partial [Prunus mume]
Length=259

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW+ST  +++WL+  +   + AYQYFVL+AQ+IA+S  +  +
Sbjct  37   KIFPFELFHLGGDEVNTTCWSSTRHVKQWLQQHNMTTKDAYQYFVLKAQEIAISKNWTPV  96

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL+ KTVVHNWLG G+  + VA G RCI SNQ  WYLDHL  PW+  Y+
Sbjct  97   NWEETFNTFPTKLNPKTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLHVPWEDTYN  156

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I +   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E       
Sbjct  157  AEPLEGINNVSQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRREATSARNG  216

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  217  NLTALPRLQYFRCLLNRRGVQAAPVTNLIARSPPIWSGSCYDQ  259



>ref|XP_008371159.1| PREDICTED: beta-hexosaminidase 1-like [Malus domestica]
Length=538

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 157/224 (70%), Gaps = 5/224 (2%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW +T  +++WL+ R+   + AYQYFV++AQ+IA+S  +  +
Sbjct  316  KIFPFELFHLGGDEVNTTCWNTTQHVKQWLEERNMTTKDAYQYFVIKAQEIAISKKWTPV  375

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL+ KTVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PWD  Y 
Sbjct  376  NWEETFNTFPSKLNPKTVVHNWLGSGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDVTYD  435

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ ITD   Q LV+GGEVCMWGE  D SD++QTIWPRAAAAAERLW S   +    N
Sbjct  436  AEPLEGITDISQQKLVIGGEVCMWGETADTSDVQQTIWPRAAAAAERLW-SRRGVTSRGN  494

Query  292  KVA---GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              A    RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  495  SYATALSRLQYFRCLLNRRGVQAAPVTNFYARSPPTWSGSCYDQ  538



>ref|XP_010534474.1| PREDICTED: beta-hexosaminidase 1 isoform X3 [Tarenaya hassleriana]
Length=415

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 152/223 (68%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  + +WL+ R+   + AY+YFVL+AQ+IA+S  +  +
Sbjct  193  KIFPFELFHLGGDEVNTDCWKNTTHVNEWLRYRNITTKDAYEYFVLRAQQIAISKNWTPV  252

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF +FG+KL  +TVVHNWL   +  + VA G RCI S    WYLDHLD PWD  Y 
Sbjct  253  NWEETFKSFGDKLDPRTVVHNWLENDICPKAVAKGFRCIFSYSGYWYLDHLDVPWDAVYR  312

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I D   + LV+GGEVCMWGE  D+SD+ QTIWPRAAAAAERLW+  E +     
Sbjct  313  TEPLKGINDTSLEKLVIGGEVCMWGETADSSDVLQTIWPRAAAAAERLWSKREAVSKGNI  372

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             +    RL +FRCLLNQRGV AAP+    GR  P  PGSC++Q
Sbjct  373  TLTALPRLHYFRCLLNQRGVPAAPVDNKYGRRPPSGPGSCYVQ  415



>ref|XP_009335906.1| PREDICTED: beta-hexosaminidase 1-like [Pyrus x bretschneideri]
Length=538

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 159/224 (71%), Gaps = 5/224 (2%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW +T  +++WL+ R+   + AYQYFV++AQ+IA+S  +  +
Sbjct  316  KIFPFELFHLGGDEVNTTCWNTTQHVKQWLEERNMTTKDAYQYFVIKAQEIAISKNWTPV  375

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL+ KTVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  376  NWEETFNTFPSKLNPKTVVHNWLGSGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDVTYN  435

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             +PL+ ITD   Q LV+GGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E +    N
Sbjct  436  ADPLEGITDISQQKLVIGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRRE-VTSHGN  494

Query  292  KVA---GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              A    RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  495  SYATALSRLQYFRCLLNRRGVQAAPVTNFFARSPPTWSGSCYDQ  538



>ref|XP_009357661.1| PREDICTED: beta-hexosaminidase 1-like [Pyrus x bretschneideri]
Length=538

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 159/224 (71%), Gaps = 5/224 (2%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW +T  +++WL+ R+   + AYQYFV++AQ+IA+S  +  +
Sbjct  316  KIFPFELFHLGGDEVNTTCWNTTQHVKQWLEERNMTTKDAYQYFVIKAQEIAISKNWTPV  375

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL+ KTVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  376  NWEETFNTFPSKLNPKTVVHNWLGSGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDVTYN  435

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             +PL+ ITD   Q LV+GGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E +    N
Sbjct  436  ADPLEGITDISQQKLVIGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRRE-VTSHGN  494

Query  292  KVA---GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              A    RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  495  SYATALSRLQYFRCLLNRRGVQAAPVTNFFARSPPTWSGSCYDQ  538



>ref|XP_001764768.1| predicted protein [Physcomitrella patens]
 gb|EDQ70467.1| predicted protein, partial [Physcomitrella patens]
Length=426

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 146/227 (64%), Gaps = 5/227 (2%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            F  +F +KF HLGGDEV+T CW  T  I+ WL  R+   + AY  FV++AQ IA+ HGY 
Sbjct  200  FRTVFPFKFAHLGGDEVDTGCWERTSHIQNWLNVRNITAKDAYADFVVRAQDIAIKHGYV  259

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             +NWEETF+ F ++L ++TVVHNW   G   Q V  G  CI+S+Q  WYLDHLDA WD F
Sbjct  260  PVNWEETFHTFSSRLKKETVVHNWFQSGTCAQAVKKGFSCILSDQSSWYLDHLDATWDKF  319

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y  EP  NI +   Q L+LGGEVCMWGE  D S+I QTIWPRAAAAAERLW++ E     
Sbjct  320  YETEPFSNIENKDEQDLMLGGEVCMWGETADESNILQTIWPRAAAAAERLWSTLEYTKVG  379

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPL-----VGSGRGAPEQPGSCHLQ  173
              +   R  HFRCLLN+R + AAP+        GR +P  PGSC  Q
Sbjct  380  HTQAVSRFQHFRCLLNRREIPAAPIFYGSRFAYGRSSPYGPGSCFKQ  426



>ref|XP_007139272.1| hypothetical protein PHAVU_008G015400g [Phaseolus vulgaris]
 gb|ESW11266.1| hypothetical protein PHAVU_008G015400g [Phaseolus vulgaris]
Length=549

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 157/222 (71%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW+ T  I++WL+  +   + AYQYFVL+AQ+IA+S  +  +
Sbjct  328  KIFPFELFHLGGDEVNTDCWSRTSHIKEWLQNHNMTTRDAYQYFVLKAQEIAVSKNWSPV  387

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL  KT+VHNWLG G+  + VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  388  NWEETFNTFPSKLHPKTIVHNWLGPGVCPKAVAKGFRCIYSNQGVWYLDHLDVPWNEVYT  447

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LV+GGEVCMW E +D SD++QTIWPRAAAAAERLW+  ++ P +  
Sbjct  448  AEPLEGIHTASEQELVIGGEVCMWAETVDTSDVQQTIWPRAAAAAERLWSQRDSAPPNIT  507

Query  292  KVAG-RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              A  R  +FRCLLN+RGVAAAP+     R AP  PGSC+ Q
Sbjct  508  VTAQLRFKNFRCLLNKRGVAAAPVTNYYARRAPVGPGSCYEQ  549



>gb|AFW78020.1| hypothetical protein ZEAMMB73_303571, partial [Zea mays]
Length=174

 Score =   235 bits (600),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  646  EETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSNE  467
            EETFNNFG+KL RKTVVHNWLG G+A++VVAAGLRCIVSNQD+WYLDHLDA W+GFY+NE
Sbjct  17   EETFNNFGDKLDRKTVVHNWLGSGVAEKVVAAGLRCIVSNQDKWYLDHLDATWEGFYTNE  76

Query  466  PLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNKV  287
            PL NI +P+ Q LVLGGEVCMWGE+IDASDI+QTIWPRAAAAAERLWT  E L  D   V
Sbjct  77   PLTNIYNPEQQKLVLGGEVCMWGEHIDASDIQQTIWPRAAAAAERLWTPIEKLAKDTRSV  136

Query  286  AGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
              RLA FRCLLNQRGVAAAPL G GR AP +PGSC  Q
Sbjct  137  TARLARFRCLLNQRGVAAAPLAGYGRSAPSEPGSCLRQ  174



>ref|XP_008369980.1| PREDICTED: beta-hexosaminidase 1-like [Malus domestica]
Length=538

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 157/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEV+TTCW++T  +++WLK R+   + AYQYFV++AQ++A+S  +  +
Sbjct  316  KIFPFELFHLGGDEVDTTCWSTTRHVKQWLKERNMTTKDAYQYFVVKAQEVAVSKNWSPV  375

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF+ F  KL+ KTVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  376  NWEETFDTFPTKLNPKTVVHNWLGSGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWNVTYN  435

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ ITD   Q LV+GGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E      N
Sbjct  436  AEPLEGITDISQQKLVIGGEVCMWGEKADTSDVQQTIWPRAAAAAERLWSRREATSGGKN  495

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
                  RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  496  IATALPRLQYFRCLLNRRGVQAAPVTNFYARSPPTWSGSCYDQ  538



>dbj|BAK03346.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW  TP +++WL  R+   + AY+YFVL+AQ+IA+   +  +
Sbjct  301  KIFPFGLFHLGGDEVYTGCWNLTPHVKQWLDERNMATKDAYKYFVLKAQEIAIDLNWIPV  360

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+FG  L+ +TVVHNWLG G+  +VVA GLRCI+SNQ  WYLDHLD PW+  Y+
Sbjct  361  NWEETFNSFGESLNPRTVVHNWLGPGVCPKVVAKGLRCIMSNQGVWYLDHLDVPWEQVYT  420

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPL  I D   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAER+W+  E +   D 
Sbjct  421  AEPLAGINDTAQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERMWSQLEAISTQDL  480

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RG+AAAP+     R  P  PGSC +Q
Sbjct  481  ETTVLARLHYFRCLLNHRGIAAAPVTNFYARRPPIGPGSCFVQ  523



>gb|EEE62107.1| hypothetical protein OsJ_16891 [Oryza sativa Japonica Group]
Length=524

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW +TP +++WL  R+   + AY+YFVL+AQ+IA++  +  +
Sbjct  302  KIFPFGLFHLGGDEVYTGCWNATPHVKQWLHERNMTTKDAYKYFVLKAQEIAINLNWIPV  361

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F   L+  TVVHNWLG G+  +VV  G RCI+SNQ  WYLDHLD PW  FY+
Sbjct  362  NWEETFNSFKENLNPLTVVHNWLGPGVCPKVVEKGFRCIMSNQGVWYLDHLDVPWQDFYT  421

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
            +EPL  I +   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAER+W+  E +   D 
Sbjct  422  SEPLAGINNTAQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERMWSQLEAISAQDL  481

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RG+AAAP+  S  R  P  PGSC +Q
Sbjct  482  ETTVLARLHYFRCLLNHRGIAAAPVTNSYARRPPIGPGSCFIQ  524



>ref|XP_003555621.1| PREDICTED: beta-hexosaminidase 1 [Glycine max]
 gb|KHN20280.1| Beta-hexosaminidase subunit B2 [Glycine soja]
Length=546

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 156/222 (70%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW++T  + KWL+  +   + AYQYFVL+AQ IAL+  +  +
Sbjct  325  KIFPFELFHLGGDEVNTDCWSNTSTVSKWLRNHNMTAKDAYQYFVLKAQNIALTKNWSPV  384

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL  +TVVHNWLG G+  + VA G RCI SNQ  WYL++L+ PWD  Y+
Sbjct  385  NWEETFNTFPTKLHPRTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLNYLNVPWDDVYT  444

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LVLGGEVCMWGE  D SDI+QTIWPRAAAAAERLW+  ++   + N
Sbjct  445  AEPLEGIRKASEQKLVLGGEVCMWGETADTSDIQQTIWPRAAAAAERLWSQRDSTSGNAN  504

Query  292  KVA-GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +A  RL +FRCLLN+RGV AAP+   + R AP  PGSC  Q
Sbjct  505  IIALRRLHYFRCLLNRRGVPAAPVNNFNARTAPVGPGSCFEQ  546



>ref|XP_009337556.1| PREDICTED: beta-hexosaminidase 1-like [Pyrus x bretschneideri]
Length=538

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 157/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEV+TTCW++T  +++WL+ R+   + AYQYFV++AQ++A+S  +  +
Sbjct  316  KIFPFELFHLGGDEVDTTCWSTTRHVKQWLEERNMTTKDAYQYFVVKAQEVAISKNWSPV  375

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF+ F  KL+ KTVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  376  NWEETFDTFPTKLNPKTVVHNWLGSGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWNVTYN  435

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ ITD   Q LV+GGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E      N
Sbjct  436  AEPLEGITDISQQKLVIGGEVCMWGEKADTSDVQQTIWPRAAAAAERLWSRREATSGGKN  495

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
                  RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  496  NATALHRLQYFRCLLNRRGVQAAPVTNFYARSPPTWSGSCYDQ  538



>ref|NP_001054468.1| Os05g0115900 [Oryza sativa Japonica Group]
 gb|AAU44085.1| putative beta-N-acetylhexosaminidase [Oryza sativa Japonica Group]
 gb|AAV44197.1| putative beta-N-acetylhexosaminidase [Oryza sativa Japonica Group]
 dbj|BAF16382.1| Os05g0115900 [Oryza sativa Japonica Group]
 dbj|BAG91208.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78406.1| hypothetical protein OsI_18203 [Oryza sativa Indica Group]
Length=541

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW +TP +++WL  R+   + AY+YFVL+AQ+IA++  +  +
Sbjct  319  KIFPFGLFHLGGDEVYTGCWNATPHVKQWLHERNMTTKDAYKYFVLKAQEIAINLNWIPV  378

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F   L+  TVVHNWLG G+  +VV  G RCI+SNQ  WYLDHLD PW  FY+
Sbjct  379  NWEETFNSFKENLNPLTVVHNWLGPGVCPKVVEKGFRCIMSNQGVWYLDHLDVPWQDFYT  438

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
            +EPL  I +   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAER+W+  E +   D 
Sbjct  439  SEPLAGINNTAQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERMWSQLEAISAQDL  498

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RG+AAAP+  S  R  P  PGSC +Q
Sbjct  499  ETTVLARLHYFRCLLNHRGIAAAPVTNSYARRPPIGPGSCFIQ  541



>gb|KJB76035.1| hypothetical protein B456_012G068200 [Gossypium raimondii]
Length=546

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEV+T CWTSTP I++WL  ++   + AYQYFVL+AQ+IA+S  +  +
Sbjct  324  KIFPFELFHLGGDEVHTDCWTSTPHIKQWLNDQNMTAKDAYQYFVLKAQEIAISKNWTPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F +KL+ +T+VHNWLG G+  + VA G RCI SNQ  WYLDHLD PW+  YS
Sbjct  384  NWEETFNSFPSKLNPRTIVHNWLGPGVCPKAVAKGFRCIFSNQGAWYLDHLDVPWNEVYS  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPL+ I +   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E +   + 
Sbjct  444  AEPLEGINNVSEQNLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSKREAVSARNI  503

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
               +  RL  FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  504  TLTILPRLHFFRCLLNRRGVQAAPVTNKYARQPPIGAGSCYEQ  546



>ref|XP_007009542.1| Beta-hexosaminidase 1 isoform 1 [Theobroma cacao]
 gb|EOY18352.1| Beta-hexosaminidase 1 isoform 1 [Theobroma cacao]
Length=546

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CWTSTP I++WL  R+   + AYQYFVL+AQ++A+S G+  +
Sbjct  324  KIFPFELFHLGGDEVNTDCWTSTPHIKQWLNNRNMTAKDAYQYFVLKAQEMAISKGWTPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F + L+ +TVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  384  NWEETFNAFASNLNPQTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDQVYN  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I +   Q LVLGGEVCMW E  D S+++QTIWPRAAAAAERLW+  E +     
Sbjct  444  AEPLEGINNVSEQNLVLGGEVCMWCEMADTSNVQQTIWPRAAAAAERLWSKREPVSARNI  503

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             +    R  +FRCLLN+RGV AAP      R  P  PGSC+ Q
Sbjct  504  TLTALPRYQYFRCLLNRRGVQAAPATNKYARSPPNGPGSCYEQ  546



>ref|XP_010669816.1| PREDICTED: beta-hexosaminidase 1 [Beta vulgaris subsp. vulgaris]
Length=548

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 153/225 (68%), Gaps = 3/225 (1%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
              KIF ++  HLGGDEVNT CW ST  I++WL  R+   + AYQYFVL+AQ+IA+++   
Sbjct  324  LKKIFPFELFHLGGDEVNTDCWNSTAHIKQWLHDRNMTRKDAYQYFVLKAQEIAITNNRT  383

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             +NWEETF +F  KL+ +T+VHNWL  G+  + VA G RCI SNQD WYLDHLD PW   
Sbjct  384  PVNWEETFISFPTKLNPRTIVHNWLVSGICPKAVAKGFRCIFSNQDVWYLDHLDVPWQPV  443

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y  +PL+NITD   Q L+LGGEVCMWGE  D SDI+QTIWPRAAAAAERLW+      + 
Sbjct  444  YEADPLENITDVTQQKLILGGEVCMWGETADTSDIQQTIWPRAAAAAERLWSRRGATSEG  503

Query  298  PNKVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  504  NINITALPRLHYFRCLLNVRGVQAAPVTNYYARRPPTGPGSCYEQ  548



>ref|XP_008245392.1| PREDICTED: beta-hexosaminidase 1 [Prunus mume]
Length=542

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW+ST  +++WL+  +   + AYQYFVL+AQ+IA+S  +  +
Sbjct  320  KIFPFELFHLGGDEVNTTCWSSTRHVKQWLEQHNMTTKDAYQYFVLKAQEIAISKNWTPV  379

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL+ KTVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  380  NWEETFNTFPTKLNPKTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWEDTYN  439

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I D   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E       
Sbjct  440  AEPLEGINDVSQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRREATSARNG  499

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  500  NLTALPRLQYFRCLLNRRGVQAAPVTNLIARSPPIWSGSCYDQ  542



>ref|XP_010534473.1| PREDICTED: beta-hexosaminidase 1 isoform X2 [Tarenaya hassleriana]
Length=542

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 152/223 (68%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  + +WL+ R+   + AY+YFVL+AQ+IA+S  +  +
Sbjct  320  KIFPFELFHLGGDEVNTDCWKNTTHVNEWLRYRNITTKDAYEYFVLRAQQIAISKNWTPV  379

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF +FG+KL  +TVVHNWL   +  + VA G RCI S    WYLDHLD PWD  Y 
Sbjct  380  NWEETFKSFGDKLDPRTVVHNWLENDICPKAVAKGFRCIFSYSGYWYLDHLDVPWDAVYR  439

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I D   + LV+GGEVCMWGE  D+SD+ QTIWPRAAAAAERLW+  E +     
Sbjct  440  TEPLKGINDTSLEKLVIGGEVCMWGETADSSDVLQTIWPRAAAAAERLWSKREAVSKGNI  499

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             +    RL +FRCLLNQRGV AAP+    GR  P  PGSC++Q
Sbjct  500  TLTALPRLHYFRCLLNQRGVPAAPVDNKYGRRPPSGPGSCYVQ  542



>ref|XP_008246029.1| PREDICTED: beta-hexosaminidase 1-like, partial [Prunus mume]
Length=259

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 153/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW+ST  +++WL+  +   + AYQYFVL+AQ+IA+S  +  +
Sbjct  37   KIFPFELFHLGGDEVNTTCWSSTRHVKQWLQQHNMTTKDAYQYFVLKAQEIAISKNWTPV  96

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF+ F  KL+ +TVVHNWLG G+  + VA G RCI SNQ  WYLDHL  PW+  Y+
Sbjct  97   NWEETFDTFPTKLNPRTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLHVPWEDTYN  156

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I +   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E       
Sbjct  157  AEPLEGINNVSQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRREATSARNG  216

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
                  RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  217  NFTALPRLQYFRCLLNRRGVQAAPVTNMIARSPPIWSGSCYDQ  259



>ref|XP_010534472.1| PREDICTED: beta-hexosaminidase 1 isoform X1 [Tarenaya hassleriana]
Length=543

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 152/223 (68%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  + +WL+ R+   + AY+YFVL+AQ+IA+S  +  +
Sbjct  321  KIFPFELFHLGGDEVNTDCWKNTTHVNEWLRYRNITTKDAYEYFVLRAQQIAISKNWTPV  380

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF +FG+KL  +TVVHNWL   +  + VA G RCI S    WYLDHLD PWD  Y 
Sbjct  381  NWEETFKSFGDKLDPRTVVHNWLENDICPKAVAKGFRCIFSYSGYWYLDHLDVPWDAVYR  440

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I D   + LV+GGEVCMWGE  D+SD+ QTIWPRAAAAAERLW+  E +     
Sbjct  441  TEPLKGINDTSLEKLVIGGEVCMWGETADSSDVLQTIWPRAAAAAERLWSKREAVSKGNI  500

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             +    RL +FRCLLNQRGV AAP+    GR  P  PGSC++Q
Sbjct  501  TLTALPRLHYFRCLLNQRGVPAAPVDNKYGRRPPSGPGSCYVQ  543



>emb|CDY02928.1| BnaC04g25580D [Brassica napus]
Length=546

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++F HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL++Q+IA+S  +  +
Sbjct  324  KIFPFEFFHLGGDEVNTDCWKNTTHVKEWLQGRNFTSKDAYKYFVLRSQQIAISKNWTPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TVV NWL   + Q+ VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  384  NWEETFSSFGKDLDPRTVVQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWDQVYN  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  444  TEPLNGIHDPSQQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  503

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  504  TLTALPRLHYFRCLLNNRGVPAAPVDNWYARRPPSGPGSCYAQ  546



>ref|XP_010068876.1| PREDICTED: beta-hexosaminidase 1 [Eucalyptus grandis]
Length=657

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 159/223 (71%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CWTSTP +++WL+  +   + AY+YFVL+AQ+IA+S  +  +
Sbjct  435  KIFPFELFHLGGDEVNTDCWTSTPHVKQWLQNHNMTSKDAYKYFVLKAQEIAISKNWTPV  494

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   L+ +T+VHNWLG G+  + VA G +CI SNQ  WYLDHLD PWD  Y+
Sbjct  495  NWEETFNAFPESLNPRTIVHNWLGAGVCPKAVAKGFKCIFSNQGFWYLDHLDVPWDQVYT  554

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPD-DP  296
             EPL+ I+D   Q LV+GGEVCMWGE  D S+++QTIWPRAAAAAERLW+  + +   + 
Sbjct  555  AEPLEGISDASKQKLVIGGEVCMWGEITDTSNVQQTIWPRAAAAAERLWSRRDAISSGNI  614

Query  295  NKVA-GRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
            NK A  RL +FRCLLN RGVAAAP+     R  P  P SC+ Q
Sbjct  615  NKTALPRLHYFRCLLNGRGVAAAPVTNQYARSQPNGPASCYAQ  657



>ref|XP_006403480.1| hypothetical protein EUTSA_v10010264mg [Eutrema salsugineum]
 gb|ESQ44933.1| hypothetical protein EUTSA_v10010264mg [Eutrema salsugineum]
Length=547

 Score =   244 bits (624),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++F HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  325  KIFPFEFFHLGGDEVNTDCWKNTTHVKEWLQDRNFTTKDAYKYFVLRAQQIAISKNWTPV  384

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  KTVV NWL   + Q+ VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  385  NWEETFSSFGKDLDPKTVVQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWDEVYN  444

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  445  TEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  504

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  505  TLNALPRLHYFRCLLNNRGVPAAPVDNWYARRPPYGPGSCYAQ  547



>ref|XP_007220020.1| hypothetical protein PRUPE_ppa003880mg [Prunus persica]
 gb|EMJ21219.1| hypothetical protein PRUPE_ppa003880mg [Prunus persica]
Length=542

 Score =   244 bits (623),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW+ST  +++WL+  +   + AYQYFVL+AQ+IA+S  +  +
Sbjct  320  KIFPFELFHLGGDEVNTTCWSSTRHVKQWLEQHNMTTKDAYQYFVLKAQEIAISKNWTPV  379

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL+ KTVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  380  NWEETFNTFPTKLNPKTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWEDAYN  439

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I D   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E       
Sbjct  440  AEPLEGIDDVSQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRREATSARNG  499

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  500  NLTALPRLHYFRCLLNRRGVQAAPVTNLIARSPPIWSGSCYDQ  542



>ref|XP_009139188.1| PREDICTED: beta-hexosaminidase 1 [Brassica rapa]
Length=550

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++F HLGGDEVNT CW +T  +++WL  R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  328  KIFPFEFFHLGGDEVNTDCWKNTTHVKEWLHGRNFTSKDAYKYFVLRAQQIAISKNWTPV  387

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TVV NWL   + Q+ VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  388  NWEETFSSFGKDLDPRTVVQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWDEVYN  447

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAA+ER+W++ E +     
Sbjct  448  TEPLNGIHDPSQQKLVIGGEVCMWGETADTSVVLQTIWPRAAAASERMWSTREAVSKGNI  507

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  508  TLTALPRLHYFRCLLNNRGVPAAPVDNWYARRPPSGPGSCYAQ  550



>gb|KHN27204.1| Beta-hexosaminidase subunit B2 [Glycine soja]
Length=481

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW+ST  +++WL++ +   + AYQYFVL+AQ++A+S  +  +
Sbjct  260  KIFPFELFHLGGDEVNTDCWSSTSHVKEWLQSHNMTTRDAYQYFVLKAQEMAVSKNWSPV  319

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL   T+VHNWLG G+  +VVA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  320  NWEETFNTFPSKLHPNTIVHNWLGPGVCPKVVAKGFRCIYSNQGVWYLDHLDVPWDEVYT  379

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I     Q LV+GGEVCMWGE  D S+++QTIWPRAAAAAERLW+  ++   +  
Sbjct  380  TEPLQGIHIASEQELVIGGEVCMWGETADTSNVQQTIWPRAAAAAERLWSQRDSTSQNIT  439

Query  292  KVA-GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +A  RL +FRCLLN+RGV AAP+     R AP  PGSC+ Q
Sbjct  440  LIALPRLQNFRCLLNRRGVPAAPVTNYYARRAPVGPGSCYDQ  481



>ref|XP_004492083.1| PREDICTED: beta-hexosaminidase 1-like [Cicer arietinum]
Length=560

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW++T  + +WL+  +   + AY+YFVL+AQ+IALS  +  +
Sbjct  338  KIFPFELFHLGGDEVNTDCWSNTSHVHEWLQKHNMTTKGAYEYFVLKAQEIALSKNWTPV  397

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL  +TVVHNWLG G+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  398  NWEETFNTFPTKLHPETVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDKVYT  457

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT--SSENLPDD  299
             EPL+ I     Q LV+GGEVCMWGE  D SD++QTIWPRAAAAAERLW+   S +  D 
Sbjct  458  AEPLEGIHKDSEQKLVIGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSPRDSTSAKDI  517

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
                  RL HFRCLLN+RGVAAAP+     R AP   GSC+ Q
Sbjct  518  TLTALPRLQHFRCLLNRRGVAAAPVTNFYARTAPVGTGSCYDQ  560



>ref|XP_003552672.1| PREDICTED: beta-hexosaminidase 1-like [Glycine max]
Length=565

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 159/222 (72%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            K+F ++  HLGGDEVNT CW+ST  +++WL++ +   + AYQYFVL+AQ++A+S  +  +
Sbjct  344  KLFPFELFHLGGDEVNTDCWSSTSHVKEWLQSHNMTTRDAYQYFVLKAQEMAVSKNWSPV  403

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL  KT+VHNWLG G+  +VVA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  404  NWEETFNTFPSKLHPKTIVHNWLGPGVCPKVVAKGFRCIYSNQGVWYLDHLDVPWDEVYT  463

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I     Q LV+GGEVCMWGE  D S+++QTIWPRAAAAAERLW+  ++   +  
Sbjct  464  AEPLQGIHTASEQELVIGGEVCMWGETADTSNVQQTIWPRAAAAAERLWSQRDSTSQNIT  523

Query  292  KVA-GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +A  RL +FRCLLN+RGV AAP+     R AP  PGSC+ Q
Sbjct  524  LIALPRLQNFRCLLNRRGVPAAPVTNYYARRAPVGPGSCYEQ  565



>gb|AFP90754.1| beta-hexosaminidase 1 [Prunus persica]
Length=562

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNTTCW+ST  +++WL+  +   + AYQYFVL+AQ+IA+S  +  +
Sbjct  340  KIFPFELFHLGGDEVNTTCWSSTRHVKQWLEQHNMTTKDAYQYFVLKAQEIAISKNWTPV  399

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL+ KTVVHNWLG G+    VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  400  NWEETFNTFPTKLNPKTVVHNWLGPGVCPNAVAKGFRCIFSNQGVWYLDHLDVPWEDAYN  459

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I D   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E       
Sbjct  460  AEPLEGIDDVSQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRREATSARNG  519

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN+RGV AAP+     R  P   GSC+ Q
Sbjct  520  NLTALPRLHYFRCLLNRRGVQAAPVTNLIARSPPIWSGSCYDQ  562



>emb|CDX76112.1| BnaA04g03760D [Brassica napus]
Length=550

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++F HLGGDEVNT CW +T  +++WL  R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  328  KIFPFEFFHLGGDEVNTDCWKNTTHVKEWLHGRNFTSKDAYKYFVLRAQQIAISKNWTPV  387

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TVV NWL   + Q+ VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  388  NWEETFSSFGKDLDPRTVVQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWDEVYN  447

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAA+ER+W++ E +     
Sbjct  448  TEPLNGIHDPSQQKLVIGGEVCMWGETADTSVVLQTIWPRAAAASERMWSTREAVSKGNI  507

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  508  TLTALPRLHYFRCLLNNRGVPAAPVDNWYARRPPSGPGSCYAQ  550



>gb|KEH44495.1| glycoside hydrolase family 20 domain protein [Medicago truncatula]
Length=536

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CWT+T ++ KWL+        AYQYFVL+AQ +A+S  +  +
Sbjct  314  KIFPFELFHLGGDEVNTDCWTNTTQVNKWLQNHKMAANDAYQYFVLKAQNMAISKNWSPV  373

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL  +TVVHNWLG G+  +VVA GLRCI SNQ  WYLDH+D PWD  Y+
Sbjct  374  NWEETFNTFPTKLHPRTVVHNWLGPGVCPKVVAKGLRCIFSNQGVWYLDHVDVPWDVVYN  433

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPL+ I +   Q LVLGGEVCMW E  D SD++QTIWPRAAAAAERLW+  +     + 
Sbjct  434  AEPLEGIHEASEQKLVLGGEVCMWAERADTSDVQQTIWPRAAAAAERLWSERQYTSGRNS  493

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN+RGV AAP+     R AP+ PGSC  Q
Sbjct  494  NSTALSRLQYFRCLLNRRGVPAAPVTNFYARTAPDGPGSCFEQ  536



>ref|XP_010516090.1| PREDICTED: beta-hexosaminidase 1 [Camelina sativa]
Length=543

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  321  KIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  380

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TVVHNWL   + Q+ VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  381  NWEETFSSFGKYLDPRTVVHNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWDEVYN  440

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I +  HQ LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  441  TEPLHGINETSHQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  500

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  501  TLTALPRLRYFRCLLNNRGVPAAPVDNFYARRPPSGPGSCYAQ  543



>ref|XP_010427290.1| PREDICTED: beta-hexosaminidase 1-like [Camelina sativa]
Length=544

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  322  KIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  381

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TVVHNWL   + Q+ VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  382  NWEETFSSFGKYLDPRTVVHNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWDEVYN  441

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I +  HQ LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  442  TEPLHGINETSHQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  501

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  502  TLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPSGPGSCYAQ  544



>ref|XP_002440479.1| hypothetical protein SORBIDRAFT_09g001670 [Sorghum bicolor]
 gb|EES18909.1| hypothetical protein SORBIDRAFT_09g001670 [Sorghum bicolor]
Length=546

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW +TP + +WL   +   ++AY+YFVL+AQ++A+   +  +
Sbjct  324  KIFPFGLFHLGGDEVYTGCWNTTPHVRQWLNEHNMTTKEAYKYFVLKAQQLAIKLNWIPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F   L+  TVVHNWLG G+  +VVA G +CI+SNQ  WYLDHLD PW+  YS
Sbjct  384  NWEETFNSFAENLNPLTVVHNWLGPGVCPKVVAKGFKCIMSNQGVWYLDHLDVPWEDVYS  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPLD I+D   Q LVLGGEVCMWGE  D SD+ QTIWPRAAAAAERLW+  E +   D 
Sbjct  444  GEPLDGISDKDQQKLVLGGEVCMWGETADTSDVLQTIWPRAAAAAERLWSQLEAITAQDV  503

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RG+AAAP+     R  P  PGSC +Q
Sbjct  504  ETTVLSRLHYFRCLLNHRGIAAAPVTNYYARRPPIGPGSCFVQ  546



>ref|XP_003518662.1| PREDICTED: beta-hexosaminidase 1-like [Glycine max]
Length=555

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW+ST  +++WL++ +   + AYQYFVL+AQ++A+S  +  +
Sbjct  334  KIFPFELFHLGGDEVNTDCWSSTSHVKEWLQSHNMTTRDAYQYFVLKAQEMAVSKNWSPV  393

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL   T+VHNWLG G+  +VVA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  394  NWEETFNTFPSKLHPNTIVHNWLGPGVCPKVVAKGFRCIYSNQGVWYLDHLDVPWDEVYT  453

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I     Q LV+GGEVCMWGE  D S+++QTIWPRAAAAAERLW+  ++   +  
Sbjct  454  TEPLQGIHIASEQELVIGGEVCMWGETADTSNVQQTIWPRAAAAAERLWSQRDSTSQNIT  513

Query  292  KVA-GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +A  RL +FRCLLN+RGV AAP+     R AP  PGSC+ Q
Sbjct  514  LIALPRLLNFRCLLNRRGVPAAPVTNYYARRAPVGPGSCYDQ  555



>ref|XP_002876291.1| glycosyl hydrolase family 20 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52550.1| glycosyl hydrolase family 20 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=544

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  322  KIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  381

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TV+ NWL   + Q+ VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  382  NWEETFSSFGKDLDPRTVIQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWDEVYN  441

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  442  TEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  501

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  502  TLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPSGPGSCYAQ  544



>gb|AAM61367.1| beta-N-acetylhexosaminidase-like protein [Arabidopsis thaliana]
 gb|AAN41320.1| putative beta-N-acetylhexosaminidase [Arabidopsis thaliana]
Length=445

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  223  KIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  282

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TV+ NWL   + Q+ VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  283  NWEETFSSFGKDLDPRTVIQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWEEVYN  342

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  343  TEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  402

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  403  TLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPLGPGSCYAQ  445



>ref|XP_006290865.1| hypothetical protein CARUB_v10016974mg [Capsella rubella]
 gb|EOA23763.1| hypothetical protein CARUB_v10016974mg [Capsella rubella]
Length=540

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 152/223 (68%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  318  KIFPFELFHLGGDEVNTGCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  377

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TVV NWL   + +   A G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  378  NWEETFSSFGKDLDPRTVVQNWLVSDICKNATAKGFRCIFSNQGYWYLDHLDVPWDEVYN  437

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPL  I D  HQ LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +   + 
Sbjct  438  TEPLHGINDHSHQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  497

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  498  TLTVLPRLHYFRCLLNNRGVPAAPVDNFYARRPPSGPGSCYAQ  540



>ref|XP_004960487.1| PREDICTED: beta-hexosaminidase 1-like [Setaria italica]
Length=541

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 153/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW +TP + +WL  R+   + AY+YFVL+AQ++A+   +  +
Sbjct  319  KIFPFGLFHLGGDEVYTGCWNATPHVRQWLNERNMTTKDAYKYFVLKAQELAIKLNWIPV  378

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F   L+  TVVHNWLG G+  +VVA G RCI+SNQ  WYLDHLD PW+  YS
Sbjct  379  NWEETFNSFKENLNPLTVVHNWLGPGVCPKVVAKGFRCIMSNQGVWYLDHLDVPWENVYS  438

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPL  I+D   Q LVLGGEVCMWGE  D SD+ QTIWPRAAAAAERLW+  E +   D 
Sbjct  439  GEPLAGISDKDQQKLVLGGEVCMWGETADTSDVLQTIWPRAAAAAERLWSQLEAISAQDV  498

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RG+AAAP+     R  P  PGSC +Q
Sbjct  499  ETTVLSRLHYFRCLLNHRGIAAAPVTNYYARRPPIGPGSCFVQ  541



>ref|XP_002316315.1| hypothetical protein POPTR_0010s21790g [Populus trichocarpa]
 gb|EEF02486.1| hypothetical protein POPTR_0010s21790g [Populus trichocarpa]
Length=531

 Score =   241 bits (616),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 153/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEVNT CW ST  +++WL   +   ++AYQYFVL+AQ+IA+S G+  +
Sbjct  309  KIFPFGLFHLGGDEVNTDCWNSTSHVKQWLLDHNMTTKEAYQYFVLRAQEIAISKGWTPV  368

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F + L+ KT+VHNWLGGG+  + VA G RCI SNQ  WYLDHLD PW   Y 
Sbjct  369  NWEETFNTFASNLNPKTIVHNWLGGGVCAKAVAKGFRCIFSNQGFWYLDHLDVPWYEVYK  428

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I D   Q LVLGGEVCMW E  D S ++QTIWPRAAAAAERLW++ E +     
Sbjct  429  AEPLEGINDTSMQELVLGGEVCMWSETADTSVVQQTIWPRAAAAAERLWSNRETISSGNI  488

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN+RGV AAP+     R  P  PGSC+ Q
Sbjct  489  TLTALPRLHYFRCLLNRRGVQAAPVTNYYARQPPSGPGSCYEQ  531



>ref|XP_006654923.1| PREDICTED: beta-hexosaminidase 1-like [Oryza brachyantha]
Length=546

 Score =   242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW +TP + +WL   +   + AY+YFVL+AQ+IA++  +  +
Sbjct  324  KIFPFGLFHLGGDEVYTGCWNTTPHVRQWLHEHNMTTKDAYKYFVLKAQEIAINLNWIPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F   L+  TVVHNWLG G+  +VV  G RCI+SNQ  WYLDHLD PW+ FY+
Sbjct  384  NWEETFNSFKENLNPLTVVHNWLGPGVCPKVVEKGFRCIMSNQGVWYLDHLDVPWEDFYT  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
            +EPL  I +   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAER+W+  E +   D 
Sbjct  444  SEPLAGINNTAQQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERMWSQLEAISAQDL  503

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RG+ AAP+  S  R  P  PGSC +Q
Sbjct  504  ETTVLARLHYFRCLLNHRGITAAPVTNSYARRPPIGPGSCFIQ  546



>ref|NP_001147583.1| LOC100281192 precursor [Zea mays]
 gb|ACG27987.1| beta-hexosaminidase beta chain precursor [Zea mays]
 gb|AFW74889.1| beta-hexosaminidase beta chain [Zea mays]
Length=545

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 152/223 (68%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW +TP + +W+  R    + AY+YFVL+AQ++A+   +  +
Sbjct  323  KIFPFGLFHLGGDEVYTGCWNTTPHVRQWMDERKMTTKDAYKYFVLKAQELAIKLNWTPV  382

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F   L+  TVVHNWLG G+  +VVA G RCI+SNQ  WYLDHLD PW+  YS
Sbjct  383  NWEETFNSFEENLNPLTVVHNWLGPGVCPKVVAKGFRCIMSNQGVWYLDHLDVPWEDVYS  442

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPL  I+D + Q LVLGGEVCMWGE  D SD+ QTIWPRAAAAAERLW+  E +   D 
Sbjct  443  GEPLAGISDREQQKLVLGGEVCMWGETADTSDVLQTIWPRAAAAAERLWSQLEAISAQDV  502

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               V  RL  FRCLLN RGVAAAP+     R  P  PGSC +Q
Sbjct  503  ETTVLSRLHRFRCLLNHRGVAAAPVTNYYARRPPVGPGSCFVQ  545



>ref|XP_004497309.1| PREDICTED: beta-hexosaminidase 1-like [Cicer arietinum]
Length=538

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEV+T CWT+T  + KWL+  +     AY++FVL+AQ +ALS  +  +
Sbjct  316  KIFPFELFHLGGDEVHTGCWTNTSHVNKWLENLNMTANDAYEHFVLRAQNMALSKNWSPV  375

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F  KL  +TVVHNWLG G+  +VVA GLRCI SNQ  WYLDHLD PWD  Y+
Sbjct  376  NWEETFNTFPTKLHPRTVVHNWLGPGVCPRVVAKGLRCIFSNQGVWYLDHLDVPWDEVYN  435

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  ++     +
Sbjct  436  AEPLEGIHKASEQKLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSERQSTSTGKS  495

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
                  RL +FRCLLN+RGV AAP+    GR AP  PGSC  Q
Sbjct  496  DSTALLRLQYFRCLLNRRGVPAAPVTNFYGRTAPIGPGSCFDQ  538



>ref|XP_002282535.1| PREDICTED: beta-hexosaminidase 1 [Vitis vinifera]
 emb|CBI31745.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 152/223 (68%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW STP +++WL+  +   ++AYQYFVL+AQ+IA+S  +  +
Sbjct  319  KIFPFELFHLGGDEVNTDCWNSTPHVQQWLQDHNMTPKEAYQYFVLRAQEIAISKNWAPV  378

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   L+ +TV+HNWLG G+  + VA G RCI SNQ  WYLDHLD PWDGFY+
Sbjct  379  NWEETFNTFATNLNPRTVIHNWLGPGVCPKAVAKGFRCIYSNQGVWYLDHLDVPWDGFYN  438

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LVLGGEVCMW E  D S++ QTIWPRAAAAAERLW+  E       
Sbjct  439  AEPLEGINSASEQELVLGGEVCMWSEVADTSNVLQTIWPRAAAAAERLWSKREATSGKNI  498

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             +    RL ++RCLL +RGV A P+     R  P  PGSC+ Q
Sbjct  499  TLTALPRLHYYRCLLTRRGVEADPVTNKYARQPPNGPGSCYEQ  541



>ref|XP_010504376.1| PREDICTED: beta-hexosaminidase 1-like [Camelina sativa]
Length=543

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 153/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  321  KIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  380

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TVVHNWL   + Q+ VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  381  NWEETFSSFGKYLDPRTVVHNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWDEVYN  440

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL  I +   Q LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  441  TEPLHGINETSQQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  500

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  501  TLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPSGPGSCYAQ  543



>ref|NP_567017.2| beta-hexosaminidase 1 [Arabidopsis thaliana]
 sp|A7WM73.1|HEXO1_ARATH RecName: Full=Beta-hexosaminidase 1; AltName: Full=Beta-GlcNAcase 
1; AltName: Full=Beta-N-acetylhexosaminidase 1; AltName: 
Full=Beta-hexosaminidase 2; Short=AtHEX2; AltName: Full=N-acetyl-beta-glucosaminidase 
1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAM35467.1| beta-N-acetylhexosaminidase [Arabidopsis thaliana]
 gb|AEE79360.1| beta-hexosaminidase 1 [Arabidopsis thaliana]
Length=541

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  319  KIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  378

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TV+ NWL   + Q+ VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  379  NWEETFSSFGKDLDPRTVIQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWEEVYN  438

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  439  TEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  498

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  499  TLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPLGPGSCYAQ  541



>ref|XP_008647788.1| PREDICTED: LOC100281192 isoform X1 [Zea mays]
Length=596

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 152/223 (68%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW +TP + +W+  R    + AY+YFVL+AQ++A+   +  +
Sbjct  374  KIFPFGLFHLGGDEVYTGCWNTTPHVRQWMDERKMTTKDAYKYFVLKAQELAIKLNWTPV  433

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F   L+  TVVHNWLG G+  +VVA G RCI+SNQ  WYLDHLD PW+  YS
Sbjct  434  NWEETFNSFEENLNPLTVVHNWLGPGVCPKVVAKGFRCIMSNQGVWYLDHLDVPWEDVYS  493

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPL  I+D + Q LVLGGEVCMWGE  D SD+ QTIWPRAAAAAERLW+  E +   D 
Sbjct  494  GEPLAGISDREQQKLVLGGEVCMWGETADTSDVLQTIWPRAAAAAERLWSQLEAISAQDV  553

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               V  RL  FRCLLN RGVAAAP+     R  P  PGSC +Q
Sbjct  554  ETTVLSRLHRFRCLLNHRGVAAAPVTNYYARRPPVGPGSCFVQ  596



>emb|CAB75760.1| beta-N-acetylhexosaminidase-like protein [Arabidopsis thaliana]
Length=557

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++WL+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  335  KIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  394

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TV+ NWL   + Q+ VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  395  NWEETFSSFGKDLDPRTVIQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWEEVYN  454

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  455  TEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  514

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  515  TLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPLGPGSCYAQ  557



>ref|XP_012072944.1| PREDICTED: beta-hexosaminidase 1 [Jatropha curcas]
 gb|KDP37399.1| hypothetical protein JCGZ_08410 [Jatropha curcas]
Length=538

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 153/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEVNT CW +T  +++WL+  +   + AYQYFVL+AQ+IA+S G+  +
Sbjct  316  KIFPFGLFHLGGDEVNTDCWNTTLHVKEWLEDHNLTTKDAYQYFVLRAQEIAISKGWNPV  375

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL  +T+VHNWLGGG+  + VA G RCI SNQ  WYLDHLD PW   Y 
Sbjct  376  NWEETFNAFASKLHPRTIVHNWLGGGVCPKAVAKGFRCIFSNQGFWYLDHLDVPWYDVYK  435

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I     Q LVLGGEVCMWGE  DASDI+QTIWPRAAAAAER+W+  E +     
Sbjct  436  AEPLEGINIASEQKLVLGGEVCMWGETADASDIQQTIWPRAAAAAERMWSRREAISSGNI  495

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    R  +FRCLLN+RGV AAP+     R  P  PGSC+ Q
Sbjct  496  TLTALPRFHYFRCLLNRRGVQAAPVKNFYARQPPTGPGSCYEQ  538



>ref|XP_004147704.1| PREDICTED: beta-hexosaminidase 1 [Cucumis sativus]
 gb|KGN50514.1| hypothetical protein Csa_5G180280 [Cucumis sativus]
Length=545

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 157/222 (71%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW + P +++WL  ++   + AY+YFVL+AQ+IA+S  +  +
Sbjct  324  KIFPFELFHLGGDEVNTDCWETVPHVKQWLLDQNMTTKDAYEYFVLRAQEIAISKNWTPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF NF   L+ +T+VHNWL GG+  + VA G RCI S+Q  WYLDHLD PWD  Y 
Sbjct  384  NWEETFINFEKGLNPRTIVHNWLRGGICPKAVADGFRCIFSDQGVWYLDHLDVPWDRAYH  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             +PL+ I+DP  Q L++GGEVCMWGE  DAS++ QTIWPRAA AAERLW+ +E +  +  
Sbjct  444  ADPLEGISDPSQQKLIIGGEVCMWGETADASNVMQTIWPRAATAAERLWSKNETVSGNIT  503

Query  292  -KVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              V  RL++FRCLLN+RGV AAP+     R  P  PGSC+ Q
Sbjct  504  LSVLPRLSYFRCLLNRRGVEAAPVKNFYARRPPTGPGSCYDQ  545



>ref|XP_010253321.1| PREDICTED: beta-hexosaminidase 1 isoform X1 [Nelumbo nucifera]
 ref|XP_010253322.1| PREDICTED: beta-hexosaminidase 1 isoform X2 [Nelumbo nucifera]
Length=638

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 160/223 (72%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            +IF ++  HLGGDEVNT CW+ST  +++WL+  +  G+ AYQYFVL+AQ++A+   +  +
Sbjct  416  QIFPFELFHLGGDEVNTDCWSSTLHVKEWLQEHNMTGKDAYQYFVLKAQEMAIVRNWIPV  475

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F ++L+ +TVVHNWLG G+  +VVA GLRCI SNQ  WYLDHLD  W+ FY+
Sbjct  476  NWEETFNTFKDRLNPQTVVHNWLGPGVCPKVVANGLRCIYSNQGVWYLDHLDITWESFYN  535

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
            +EPL+ I D   Q LVLGGEVCMWGE  D SD++QTIWPRAAAAAERLW+  E +   + 
Sbjct  536  SEPLEGINDTLEQDLVLGGEVCMWGETADTSDVQQTIWPRAAAAAERLWSRREAISAGNI  595

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
               V  RL +FRCLLN+RGV AAP+     R  P  P SC+ Q
Sbjct  596  SLTVLPRLHYFRCLLNRRGVPAAPVTNEYARSPPIGPASCYDQ  638



>ref|XP_008461628.1| PREDICTED: beta-hexosaminidase 1 [Cucumis melo]
Length=545

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 157/222 (71%), Gaps = 2/222 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW + P +++WL  ++   + AY+YFVL+AQ+IA+S  +  +
Sbjct  324  KIFPFELFHLGGDEVNTDCWETVPHVKQWLLDQNMTTKDAYEYFVLRAQEIAISKNWTPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF NF   L+ +T+VHNWL GG+  + VA G RCI S+Q  WYLDHLD PWD  Y 
Sbjct  384  NWEETFINFEKGLNPRTIVHNWLRGGICPKAVADGFRCIFSDQGVWYLDHLDVPWDRAYH  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             +PL+ I+DP  Q L++GGEVCMWGE  DAS++ QTIWPRAA AAERLW+ +E +  +  
Sbjct  444  ADPLEGISDPSQQKLIIGGEVCMWGETADASNVLQTIWPRAATAAERLWSKNETVSGNIT  503

Query  292  -KVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
              V  RL++FRCLLN+RG+ AAP+     R  P  PGSC+ Q
Sbjct  504  LSVLPRLSYFRCLLNRRGIEAAPVKNFYARRPPTGPGSCYDQ  545



>gb|KEH21878.1| glycoside hydrolase family 20 domain protein [Medicago truncatula]
Length=558

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEV+T CWT+T  +++WL++ +   + AY+YFVL+AQ IALS  +  +
Sbjct  336  KIFPFELFHLGGDEVHTDCWTNTSHVKEWLQSHNMTTKDAYEYFVLKAQDIALSKKWTPV  395

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL  +TVVHNWL  G+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  396  NWEETFNTFPSKLHPETVVHNWLVSGVCAKAVAKGFRCIFSNQGVWYLDHLDVPWDEVYT  455

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             +PL+ I     + L+LGGEVCMWGE  DAS+++QTIWPRAAAAAER+W+  +       
Sbjct  456  ADPLEFIHKESEEKLILGGEVCMWGETADASNVQQTIWPRAAAAAERMWSERDFTSTRNA  515

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL HFRCLLN+RGV AAP+     R AP+  GSC+ Q
Sbjct  516  TLTALPRLQHFRCLLNRRGVPAAPVTNYYARRAPDGTGSCYDQ  558



>ref|XP_011027114.1| PREDICTED: beta-hexosaminidase 1 [Populus euphratica]
Length=531

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 150/223 (67%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEVNT CW ST  +++WL   +   + AYQYFVL+AQ+IA+S G+  +
Sbjct  309  KIFPFGLFHLGGDEVNTDCWKSTSHVKQWLLDHNMTTKDAYQYFVLRAQEIAISKGWTPV  368

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F + L+ +T+VHNWLGGG+  + VA G RCI SNQ  WYLDHLD PW   Y 
Sbjct  369  NWEETFNTFASNLNPRTIVHNWLGGGVCAKAVAKGFRCIFSNQGFWYLDHLDVPWYEVYK  428

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I D   Q LVLGGEVCMW E  D S ++QTIWPRAAAAAERLW++ E +     
Sbjct  429  AEPLEGINDTSMQELVLGGEVCMWSETADTSVVQQTIWPRAAAAAERLWSNRETISSGNI  488

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PG C+ Q
Sbjct  489  TLTALPRLHYFRCLLNSRGVQAAPVTNYYARQPPRGPGPCYDQ  531



>gb|KJB73732.1| hypothetical protein B456_011G246500 [Gossypium raimondii]
Length=544

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 152/221 (69%), Gaps = 1/221 (0%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVN  CW +TP +++WLK  +   + AY+YFVL+AQ+IA+S  +  +
Sbjct  324  KIFPFELFHLGGDEVNIGCWNNTPHVKQWLKDNNMKPKDAYKYFVLKAQEIAISKNWTPV  383

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   L+ +TVVHNWLG G+  + VA G +CI SN   WYLDHLD PW+  Y+
Sbjct  384  NWEETFNAFAGSLNPQTVVHNWLGPGVCPKAVAKGFKCIFSNSGVWYLDHLDVPWEQIYN  443

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I +   Q LVLGGEVCMW E +D S+++QTIWPRAAAAAERLW++   L    +
Sbjct  444  AEPLEGIDNESKQKLVLGGEVCMWSETVDTSNVQQTIWPRAAAAAERLWSTKSALSAGND  503

Query  292  KVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             V  RL +FRCLL +RGV AAP+     R  P  P SC+ Q
Sbjct  504  TVLHRLHYFRCLLQRRGVQAAPVTNYYARQPPAGPDSCYWQ  544



>dbj|BAE99290.1| beta-N-acetylhexosaminidase -like protein [Arabidopsis thaliana]
Length=541

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 153/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW +T  +++ L+ R+F  + AY+YFVL+AQ+IA+S  +  +
Sbjct  319  KIFPFELFHLGGDEVNTDCWKNTTHVKERLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV  378

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETF++FG  L  +TV+ NWL   + Q+ VA G RCI SNQ  WYLDHLD PW+  Y+
Sbjct  379  NWEETFSSFGKDLDPRTVIQNWLVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWEEVYN  438

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EPL+ I DP  Q LV+GGEVCMWGE  D S + QTIWPRAAAAAER+W++ E +     
Sbjct  439  TEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWPRAAAAAERMWSTREAVSKGNI  498

Query  292  KVAG--RLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
             +    RL +FRCLLN RGV AAP+     R  P  PGSC+ Q
Sbjct  499  TLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPLGPGSCYAQ  541



>gb|AFK39607.1| unknown [Medicago truncatula]
Length=558

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEV+T CWT+T  +++WL++ +   + AY+YFVL+AQ IALS  +  +
Sbjct  336  KIFPFELFHLGGDEVHTDCWTNTSHVKEWLQSHNMTTKDAYEYFVLKAQDIALSKKWTPV  395

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F +KL  +TVVHNWL  G+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  396  NWEETFNTFPSKLHPETVVHNWLVSGVCAKAVAKGFRCIFSNQGVWYLDHLDVPWDEVYT  455

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSE-NLPDDP  296
             +PL+ I     + L+LGGEVCMWGE  DAS+++QTIWPRAAAAAER+W+  +     + 
Sbjct  456  ADPLEFIHKESEEKLILGGEVCMWGETADASNVQQTIWPRAAAAAERMWSERDFTFTRNA  515

Query  295  NKVA-GRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               A  RL HFRCLLN+RGV AAP+     R AP+  GS + Q
Sbjct  516  TLTALPRLQHFRCLLNRRGVPAAPVTNYYARRAPDGTGSYYDQ  558



>ref|XP_008810522.1| PREDICTED: beta-hexosaminidase 1-like, partial [Phoenix dactylifera]
Length=212

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 145/208 (70%), Gaps = 9/208 (4%)
 Frame = -1

Query  778  CWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEIINWEETFNNFGNKLSRKTV  599
            CW STP +++WL+  +   + AYQYFVL+AQ+IA+  G+  +NWEETFN F  KL  +TV
Sbjct  8    CWYSTPHVKQWLQEHNMTTKDAYQYFVLRAQEIAIDLGWIPVNWEETFNAFKEKLDPQTV  67

Query  598  VHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLG  419
            +HNWLG G+  + VA G RCIVSNQ  WYLDHLD PW+ FY++EPLD I     Q LVLG
Sbjct  68   IHNWLGPGVCPKAVAKGFRCIVSNQGVWYLDHLDIPWEDFYNSEPLDGINSTLQQELVLG  127

Query  418  GEVCMWGENIDASDIEQTIWPRAAAAAERLW-----TSSENLPDDPNKVAGRLAHFRCLL  254
            GEVCMWGE  D S ++QTIWPRAAAAAERLW     TS+ NL    + V  RL +FRCLL
Sbjct  128  GEVCMWGETADTSVVQQTIWPRAAAAAERLWSPLDATSAGNL---NSTVLPRLHYFRCLL  184

Query  253  NQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
            N RGVAAAP+  S  R  P  PGSC  Q
Sbjct  185  NHRGVAAAPVNNSLARQPPIGPGSCFAQ  212



>ref|XP_004347426.1| beta-hexosaminidase subunit beta [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE93970.1| beta-hexosaminidase subunit beta [Capsaspora owczarzaki ATCC 
30864]
Length=525

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 142/223 (64%), Gaps = 3/223 (1%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            ++ +F    +H GGDEV+ TCWT TPRI  W+ ++++    AY YF+     +A+  G  
Sbjct  305  YAGLFPDDMIHFGGDEVDPTCWTQTPRIVNWMNSKNYTTDDAYMYFIETVHSMAIKRGRN  364

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             +NWEE F +FG+ L   T+VH WL      QVVAAG R I+SNQD WYLDHL   W  F
Sbjct  365  PVNWEEVFLHFGSSLDNDTIVHIWLNHDTLAQVVAAGYRGILSNQDVWYLDHLGTTWQQF  424

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEP + I DP  Q LVLGGEVCMWGE +D SDI  T+WPRAAAAAERLW  S+   + 
Sbjct  425  YLNEPHEGIDDPNQQKLVLGGEVCMWGETVDTSDIFNTVWPRAAAAAERLW--SDRQVNS  482

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
             N    RL +FRCLLN RGV AAP+  +  R  P  PG C++Q
Sbjct  483  TNLFEPRLLNFRCLLNLRGVPAAPVENAQARTGPPGPGGCYVQ  525



>ref|XP_002982865.1| hypothetical protein SELMODRAFT_117332, partial [Selaginella 
moellendorffii]
 gb|EFJ16110.1| hypothetical protein SELMODRAFT_117332, partial [Selaginella 
moellendorffii]
Length=406

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 149/232 (64%), Gaps = 14/232 (6%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
             SK+F ++ +H+GGDEVNT CW  T  +  WL+  +    Q Y++FVLQ QK+AL HGY 
Sbjct  174  LSKVFPFELLHIGGDEVNTRCWEITEPVNDWLRKHNLTPSQGYEFFVLQVQKLALKHGYL  233

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             +NW+E F  FG  LSRKT+VHNW G  +    V++GL+ IVS Q  WYLDH+D PW+ F
Sbjct  234  PVNWQEPFEKFGPSLSRKTIVHNWWGTQIPPNTVSSGLKSIVSEQFSWYLDHIDIPWEEF  293

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPD-  302
            YS EP DNI   K Q L++GGEVCMWGE +DA++I+Q IWPRAAAAA +L  +S  L D 
Sbjct  294  YSKEPYDNIASHKEQQLIIGGEVCMWGEKVDAANIQQRIWPRAAAAAGKL--ASLYLLDI  351

Query  301  -----------DPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCH  179
                        P   A RL  FR LLN+RG+AA+P+     G+ + P S H
Sbjct  352  FFLANNFYFGLGPKNAAPRLEFFRSLLNERGIAASPVKSKEEGSSKPPDSPH  403



>gb|KDO67769.1| hypothetical protein CISIN_1g0088211mg, partial [Citrus sinensis]
Length=494

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF ++  HLGGDEVNT CW+STP ++KWL+      ++AYQYFVL AQKIA+S  +  +
Sbjct  330  KIFPFELFHLGGDEVNTDCWSSTPHVKKWLRDHKLTAKEAYQYFVLTAQKIAISKNWTPV  389

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN+F + L+ +TVVHNWLGGG+  + VA G RCI SNQ  WYLDHLD PWD  Y+
Sbjct  390  NWEETFNSFASNLNPRTVVHNWLGGGVCPKAVAKGFRCIYSNQGFWYLDHLDVPWDEVYT  449

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAA  338
             EPL+ I+DP +Q LVLGGEVCMWGE  D SDI QTIWPRAAAAA
Sbjct  450  AEPLEGISDPSNQELVLGGEVCMWGETADTSDIHQTIWPRAAAAA  494



>ref|XP_002531964.1| beta-hexosaminidase, putative [Ricinus communis]
 gb|EEF30400.1| beta-hexosaminidase, putative [Ricinus communis]
Length=211

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 140/198 (71%), Gaps = 3/198 (2%)
 Frame = -1

Query  757  IEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEIINWEETFNNFGNKLSRKTVVHNWlgg  578
            +E+ L+  +   + AY+YFVL+AQ+IA+S G+  +NWEETFN F + L  +T+VHNWLGG
Sbjct  14   LEELLRDHNLTTKDAYKYFVLRAQEIAISKGWTPVNWEETFNTFASSLHPRTIVHNWLGG  73

Query  577  glaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWG  398
            G+  + VA G RCI SNQ  WYLDHLD PW   Y+ EPL+ I +   Q LVLGGEVCMWG
Sbjct  74   GVCAKAVAKGFRCIFSNQGFWYLDHLDVPWYEVYNAEPLEGIDNASEQELVLGGEVCMWG  133

Query  397  ENIDASDIEQTIWPRAAAAAERLWTSSENLP-DDPNKVA-GRLAHFRCLLNQRGVAAAPL  224
            E  D SD++QTIWPRAAAAAERLW+  E++   + N+ A  RL +FRCLLN+RGV AAP+
Sbjct  134  ETADTSDVQQTIWPRAAAAAERLWSRRESISLRNINETALPRLQYFRCLLNRRGVPAAPV  193

Query  223  VG-SGRGAPEQPGSCHLQ  173
                 R  P  PGSC+ Q
Sbjct  194  TNFYARRPPTGPGSCYEQ  211



>ref|XP_009388075.1| PREDICTED: beta-hexosaminidase 3-like [Musa acuminata subsp. 
malaccensis]
Length=137

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  718  QAYQYFVLQAQKIALSHGYEIINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRC  539
            Q Y+YFVL+AQKIALSHGYE+INWEETFNNFG++LS KTVVHNWLGGG+AQ+VVAAGLRC
Sbjct  5    QGYKYFVLRAQKIALSHGYEVINWEETFNNFGSQLSPKTVVHNWLGGGVAQKVVAAGLRC  64

Query  538  IVSNQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIW  359
            IVSNQD+WYLDHLD PW  FY NEPL NI+ P+ Q LV+GGEVCMWGE+IDASDIEQTIW
Sbjct  65   IVSNQDKWYLDHLDVPWQKFYMNEPLTNISTPEQQKLVIGGEVCMWGESIDASDIEQTIW  124

Query  358  PRAAAAA  338
            PRAAAAA
Sbjct  125  PRAAAAA  131



>gb|EEC71936.1| hypothetical protein OsI_04746 [Oryza sativa Indica Group]
Length=392

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSK+FK+KFVHLGGDEVNT+CWT+TP I+KWL     +   AY+YFVL++QK+A+SHGY+
Sbjct  241  FSKVFKFKFVHLGGDEVNTSCWTATPHIKKWLDDNQMNVSDAYRYFVLRSQKLAISHGYD  300

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            +INWEETFNNFG+KL R+TVVHNWLG  +A +VVAAGLRCIVSNQD+WYLDHLDA W+GF
Sbjct  301  VINWEETFNNFGDKLDRRTVVHNWLGEDVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGF  360

Query  478  YSNEPLDNITDPKHQALVLGG  416
            Y+NEPL  I DP+ Q+LV+GG
Sbjct  361  YTNEPLKGIDDPEQQSLVIGG  381



>ref|XP_009383360.1| PREDICTED: beta-hexosaminidase 3-like [Musa acuminata subsp. 
malaccensis]
Length=140

 Score =   196 bits (498),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  541  CIVSNQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTI  362
            CIVSNQD+WYLDHLD PW  FY NEPL NI+ P+ Q LV+GGEVCMWGE+IDASDIEQTI
Sbjct  18   CIVSNQDKWYLDHLDVPWQKFYVNEPLTNISTPEQQKLVIGGEVCMWGESIDASDIEQTI  77

Query  361  WPRAAAAAERLWTSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSC  182
            WPRAAAAAERLWT  + L  DP +  GRLA FRCLLNQRGVAAAP+ G GR AP  PGSC
Sbjct  78   WPRAAAAAERLWTPLDKLAKDPRQATGRLARFRCLLNQRGVAAAPVAGPGRTAPLDPGSC  137

Query  181  HLQ  173
            + Q
Sbjct  138  YKQ  140



>ref|XP_010040776.1| PREDICTED: LOW QUALITY PROTEIN: beta-hexosaminidase 1-like, partial 
[Eucalyptus grandis]
Length=330

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            K F ++  HLGGDEVNT CWTSTP + +WL+  +  G+ AY+YFVL+AQ+IA+S  +  +
Sbjct  163  KNFPFELFHLGGDEVNTDCWTSTPHVNQWLQNHNMTGKDAYKYFVLKAQEIAISKNWTPV  222

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   ++ +T+VHNWLG G   + VA G +CI S++  WYLDHLD PWD  Y+
Sbjct  223  NWEETFNAFPQSINPRTIVHNWLGPGXCPKAVAKGFKCIFSSRGVWYLDHLDVPWDQVYT  282

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERL  329
             E L+ I+D   Q LV+GGEVCMWGE  D S+++Q IWPRAAAAAERL
Sbjct  283  AELLEGISDASKQKLVIGGEVCMWGETADTSNVQQMIWPRAAAAAERL  330



>gb|KCW44937.1| hypothetical protein EUGRSUZ_L01476 [Eucalyptus grandis]
Length=269

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            K F ++  HLGGDEVNT CWTSTP + +WL+  +  G+ AY+YFVL+AQ+IA+S  +  +
Sbjct  106  KNFPFELFHLGGDEVNTDCWTSTPHVNQWLQNHNMTGKDAYKYFVLKAQEIAISKNWTPV  165

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NWEETFN F   ++ +T+VHNW    L  + VA G +CI S++  WYLDHLD PWD  Y+
Sbjct  166  NWEETFNAFPQSINPRTIVHNW----LCPKAVAKGFKCIFSSRGVWYLDHLDVPWDQVYT  221

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERL  329
             E L+ I+D   Q LV+GGEVCMWGE  D S+++Q IWPRAAAAAERL
Sbjct  222  AELLEGISDASKQKLVIGGEVCMWGETADTSNVQQMIWPRAAAAAERL  269



>ref|XP_002990966.1| hypothetical protein SELMODRAFT_429306 [Selaginella moellendorffii]
 gb|EFJ08010.1| hypothetical protein SELMODRAFT_429306 [Selaginella moellendorffii]
Length=552

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 127/205 (62%), Gaps = 21/205 (10%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
             SK+F ++ +H+GGDEV+T+CW        WL   +F   +AY++FVLQ QK+A+ HGY 
Sbjct  338  LSKVFPFELLHIGGDEVDTSCWQIARPTNNWLVEHNFTAAEAYEFFVLQVQKLAMKHGYV  397

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             +NW+E F  FG  LSRKT+VHNW G  +A  VV +GL+CIVS Q  WYLDH++ PW+ F
Sbjct  398  PVNWQEPFEKFGQSLSRKTIVHNWWGPQIAPDVVESGLKCIVSEQSSWYLDHIEIPWEKF  457

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YS EP DNIT    Q L++GGEVCMW                     ERLW+ S+     
Sbjct  458  YSKEPFDNITSEIEQELIIGGEVCMW---------------------ERLWSPSKVTSLG  496

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPL  224
            P   A RL  FR LLN+RG+AA+PL
Sbjct  497  PENAAPRLEFFRSLLNERGIAASPL  521



>ref|XP_002982864.1| hypothetical protein SELMODRAFT_422139 [Selaginella moellendorffii]
 gb|EFJ16109.1| hypothetical protein SELMODRAFT_422139 [Selaginella moellendorffii]
Length=541

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 129/214 (60%), Gaps = 21/214 (10%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            ++F ++ +H+GGDEV+T+CW        WL   +F   +AY++FVLQ QK+A+ HGY  +
Sbjct  329  EVFPFELLHIGGDEVDTSCWQIARPTNNWLVEHNFTAAEAYEFFVLQVQKLAMKHGYVPV  388

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NW+E F  FG  LSRKT+VHNW G  +A  VV +GL+CIVS Q  WYLDH++ PW+ FYS
Sbjct  389  NWQEPFEKFGQSLSRKTIVHNWWGPQIAPDVVESGLKCIVSEQSSWYLDHIEIPWEKFYS  448

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPN  293
             EP DN+T    Q L++GGEVCMW                     ERLW+ S+     P 
Sbjct  449  KEPFDNVTSEIEQELIIGGEVCMW---------------------ERLWSPSKVTSLGPE  487

Query  292  KVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQP  191
              A RL  FR LLN+RG+AA+PL    R    QP
Sbjct  488  NAAPRLEFFRSLLNERGIAASPLHPQQRRDSLQP  521



>ref|XP_002982872.1| hypothetical protein SELMODRAFT_422155 [Selaginella moellendorffii]
 gb|EFJ16117.1| hypothetical protein SELMODRAFT_422155 [Selaginella moellendorffii]
Length=458

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 136/216 (63%), Gaps = 22/216 (10%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEV---------NTTCWTSTPRIEKWLKTRHF---------DGQQAYQ  707
            K F ++ +H+GGDE+         N   ++ +  IE    TR+F            QAY+
Sbjct  247  KAFPFELLHIGGDEIVGKAQSLFLNGLIFSKSNSIE----TRYFYDRLGKHNLTATQAYK  302

Query  706  YFVLQAQKIALSHGYEIINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSN  527
            +FVL+ QK+A+ HGY  ++W+E F NFG+ L + T++ NWLG  +A  VV +GL+CI+S 
Sbjct  303  FFVLEVQKLAMKHGYVPVSWQEAFQNFGSSLPKNTIIQNWLGSAIAPSVVKSGLKCIISE  362

Query  526  QDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAA  347
            Q  WYLDH +  W+ FY+ EP D+ITD + Q L+LGGEVCMWGE +D S+I Q IWPRAA
Sbjct  363  QASWYLDHFEVTWEQFYNKEPYDSITDGREQQLILGGEVCMWGEKVDGSNIHQIIWPRAA  422

Query  346  AAAERLWTSSENLPDDPNKVAGRLAHFRCLLNQRGV  239
            AAAE+ W+        P+K   R+  FR LLN+RG+
Sbjct  423  AAAEKFWSPFSVTNLGPHKAGDRMETFRRLLNERGI  458



>emb|CBK19885.2| unnamed protein product [Blastocystis hominis]
Length=512

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 134/220 (61%), Gaps = 4/220 (2%)
 Frame = -1

Query  829  IFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEIIN  650
            IF   + H+GGDEV+T+CW +T  I +W+K  +      Y+YFV + Q++ L +    I 
Sbjct  296  IFFDNYFHMGGDEVDTSCWKTTVHIIEWMKKNNLTDHDTYKYFVQKVQQMVLKNHRNGIY  355

Query  649  WEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSN  470
            WEE + NF  +L ++T++  W+     + VVA G + I+S+    YLDHLD  W   Y++
Sbjct  356  WEEVWLNFRTQLDKETIIQTWMNKKTMKDVVANGYKVIISDPHT-YLDHLDETWKALYND  414

Query  469  EPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNK  290
            EP +    P+ QALVLGGE CMW E +D SD+  T+WPRA A AER W+  E   +D   
Sbjct  415  EPFEFTDVPEEQALVLGGEACMWAETVDVSDLYNTVWPRAGAFAERYWSPKEV--NDVEA  472

Query  289  VAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
               R+ +FRCLLN RGV AAP+  + GR AP  PGSC+ Q
Sbjct  473  AHDRMRYFRCLLNHRGVPAAPVDNAKGRSAPPNPGSCYYQ  512



>ref|WP_028831726.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=476

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 132/228 (58%), Gaps = 12/228 (5%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEI  656
            S +F   F+HLGGDEVNT CWTSTP ++ WL        Q Y YFV +   +A+S G   
Sbjct  252  SGLFPDNFIHLGGDEVNTACWTSTPAVKSWLDAHGMTPDQGYAYFVKKVADVAISQGRRP  311

Query  655  INWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVS---NQDRWYLDHLDAPWD  485
            I W E F++F  +L +  +VH W       +VVA G   +++   +   WYLD+L+  W 
Sbjct  312  IQWSEVFDHFKTELPKDVIVHIWKSVTNVTEVVADGYNVLLNVGYDAKSWYLDNLNVNWT  371

Query  484  GFYSNEPLDNITD---PKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSE  314
              Y NEP + + D   PK    +LGG   MWGE +D SDI QT++PR AA AERLW S  
Sbjct  372  AVYLNEPCEKVPDDLCPK----ILGGHGEMWGETVDTSDIAQTVYPRMAAIAERLW-SPR  426

Query  313  NLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
            ++  +      R+ +FRCLLN+RG+AAAP+   + R AP  PGSC  Q
Sbjct  427  SVVGNLTDARPRIKYFRCLLNRRGIAAAPVSNPNARSAPIGPGSCFQQ  474



>ref|XP_002990975.1| hypothetical protein SELMODRAFT_429321 [Selaginella moellendorffii]
 gb|EFJ08019.1| hypothetical protein SELMODRAFT_429321 [Selaginella moellendorffii]
Length=471

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 131/203 (65%), Gaps = 14/203 (7%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEV---------NTTCWTSTPRIE-KWLKTR----HFDGQQAYQYFVL  695
            K F ++ +H+GGDE+         N   ++ +  IE ++L  R    +    QAY++FVL
Sbjct  247  KAFPFELLHIGGDEIVGKAQSLFLNGLIFSKSNSIETRYLYDRLGKHNLTATQAYKFFVL  306

Query  694  QAQKIALSHGYEIINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRW  515
            + QK+A+ HGY  ++W+E F NFG+ L + T++ NWLG  +A  VV +GL+CI+S Q  W
Sbjct  307  EVQKLAMKHGYVPVSWQEAFQNFGSSLPKNTIIQNWLGSAIAPSVVKSGLKCIISEQASW  366

Query  514  YLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAE  335
            YLDH +  W+ FY+ EP D+ITD + Q L+LGGEVCMWGE +DAS+I Q IWPRAAAAAE
Sbjct  367  YLDHFEVTWEQFYNKEPYDSITDGREQQLILGGEVCMWGEKVDASNIHQIIWPRAAAAAE  426

Query  334  RLWTSSENLPDDPNKVAGRLAHF  266
            +LW+        P+K   +L + 
Sbjct  427  KLWSPFSVTNLGPHKAVDKLQYM  449



>ref|XP_010096667.1| Beta-hexosaminidase subunit [Morus notabilis]
 gb|EXB65335.1| Beta-hexosaminidase subunit [Morus notabilis]
Length=252

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 111/161 (69%), Gaps = 3/161 (2%)
 Frame = -1

Query  646  EETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSNE  467
            EETFNNF   L  +T+VHNWLG G+  +VVA G RCI SNQ  WYLDHLD PW+ FY+ E
Sbjct  92   EETFNNFPENLHPRTIVHNWLGPGVCPKVVAKGFRCIFSNQGVWYLDHLDVPWNEFYTAE  151

Query  466  PLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNKV  287
            PL+ I +   Q LVLGGEVCMWGE  D S+++QTIWPRAAAAAERLW+S E +      V
Sbjct  152  PLEGIDNASVQKLVLGGEVCMWGETADTSNVQQTIWPRAAAAAERLWSSREAISSGNINV  211

Query  286  AG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
                RL +FRCLLN+RGV AAP+     R  P  PGSC  Q
Sbjct  212  TALPRLHYFRCLLNRRGVQAAPVTNEYARTPPSGPGSCFEQ  252



>ref|XP_001745279.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89857.1| predicted protein [Monosiga brevicollis MX1]
Length=401

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 126/222 (57%), Gaps = 6/222 (3%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEI  656
            + +F    +HLGGDEVNT CW S   I KWL  +       Y YFV +AQ IA  +G ++
Sbjct  185  AGLFPDNVMHLGGDEVNTDCWASNADISKWLSDQGLTLDGGYAYFVKRAQAIAHGYGRDV  244

Query  655  INWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFY  476
            + WEE +++FG +L + T++H WLG   A   +      + +     YLD LD  W   Y
Sbjct  245  VGWEEIWDHFGTQLDKSTIIHQWLGARHASLNLLRPAGALTAGIG--YLDGLDVTWQTMY  302

Query  475  SNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDP  296
              EP   +TD    ALVLGG   MWGE +D SD  QT+WPR AA AERLW+  E    + 
Sbjct  303  EQEPCTGMTD-DQCALVLGGGGEMWGETVDFSDWHQTVWPRMAAVAERLWSPRELT--NA  359

Query  295  NKVAGRLAHFRCLLNQRGVAAAPLVGSG-RGAPEQPGSCHLQ  173
            +  + RL  +RCLLN R +AAAP   SG R AP  PGSC+ Q
Sbjct  360  DDASTRLVAYRCLLNHRAIAAAPSTNSGARTAPSGPGSCYDQ  401



>ref|XP_004994812.1| hypothetical protein PTSG_03917 [Salpingoeca rosetta]
 gb|EGD83308.1| hypothetical protein PTSG_03917 [Salpingoeca rosetta]
Length=603

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 124/223 (56%), Gaps = 4/223 (2%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEI  656
            S +F    +HLGGDEVNT CW+ +P I KW++        AY YFV + Q IA  +G ++
Sbjct  383  SGLFPDNLMHLGGDEVNTKCWSESPTISKWMQDHGLTPDGAYAYFVNRTQAIARGYGRDV  442

Query  655  INWEETFNNFGNKLSRKTVVHNWl-ggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
            I WEE +++FG  L + T++H WL    +A     AG R + S    WYLD L   W   
Sbjct  443  IGWEEIWDHFGTSLDKSTIIHQWLPKSSIAINATKAGYRVLWSTDGAWYLDGLSVTWQEM  502

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y  EP   I D     LVLGG  CMWGE +D SDI+QTIWPR AA AERLW+    +   
Sbjct  503  YEQEPCTGIDDHLCDTLVLGGGGCMWGETVDTSDIQQTIWPRMAAIAERLWSPRSVI--S  560

Query  298  PNKVAGRLAHFRCLLNQRGV-AAAPLVGSGRGAPEQPGSCHLQ  173
              +   R   FRCLLN+RG+ AA     + R AP  PG C  Q
Sbjct  561  AAQADARFRSFRCLLNRRGIAAAPANNPTAREAPPHPGGCLEQ  603



>ref|XP_007009544.1| Beta-hexosaminidase 1 isoform 3 [Theobroma cacao]
 gb|EOY18354.1| Beta-hexosaminidase 1 isoform 3 [Theobroma cacao]
Length=433

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 119/182 (65%), Gaps = 5/182 (3%)
 Frame = -1

Query  709  QYFVLQAQKIALSHGYEIINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVS  530
            +Y V  A +I  S G+  +NWEETFN F + L+ +TVVHNWLG G+  + VA G RCI S
Sbjct  254  RYTVEDASEI--SKGWTPVNWEETFNAFASNLNPQTVVHNWLGPGVCPKAVAKGFRCIFS  311

Query  529  NQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRA  350
            NQ  WYLDHLD PWD  Y+ EPL+ I +   Q LVLGGEVCMW E  D S+++QTIWPRA
Sbjct  312  NQGVWYLDHLDVPWDQVYNAEPLEGINNVSEQNLVLGGEVCMWCEMADTSNVQQTIWPRA  371

Query  349  AAAAERLWTSSENLPDDPNKVAG--RLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCH  179
            AAAAERLW+  E +      +    R  +FRCLLN+RGV AAP      R  P  PGSC+
Sbjct  372  AAAAERLWSKREPVSARNITLTALPRYQYFRCLLNRRGVQAAPATNKYARSPPNGPGSCY  431

Query  178  LQ  173
             Q
Sbjct  432  EQ  433



>emb|CBK22342.2| unnamed protein product [Blastocystis hominis]
Length=563

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 129/222 (58%), Gaps = 7/222 (3%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEI  656
            S +F  +F HLGGDEVNT CWTSTPRI +W+K + F     Y+Y V +A ++        
Sbjct  344  SGLFFDEFFHLGGDEVNTQCWTSTPRIAQWMKEKGFSTTDTYKYTVDRAHQMVFGVNRTA  403

Query  655  INWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFY  476
            +NWEE   +    +  + ++H WL       +V  G R IVS   RWYLD LD  WD FY
Sbjct  404  VNWEEVATHLSG-VDPRAIMHVWLMSTSVNSIVQKGYRVIVSR--RWYLDDLDNTWDIFY  460

Query  475  SNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDP  296
            SN+    +   +++  +LGGE CMW E +D SD   T+WPRAA  +E+LWT  + L  D 
Sbjct  461  SNDIASGVPQ-ENRGKILGGEACMWAETVDTSDWFNTVWPRAAGVSEQLWTPEDKL--DV  517

Query  295  NKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
            +    R+  FRCLLN+RG+ AAP++   GR AP   G C+ Q
Sbjct  518  DAALNRIIWFRCLLNRRGIEAAPVLNLKGRAAPLGQGGCYWQ  559



>ref|XP_002990967.1| hypothetical protein SELMODRAFT_429308 [Selaginella moellendorffii]
 gb|EFJ08011.1| hypothetical protein SELMODRAFT_429308 [Selaginella moellendorffii]
Length=516

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 122/220 (55%), Gaps = 27/220 (12%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
             SK+F ++ +H+GGDEVNT CW  T  +  WL+  +      Y++FVL+ QK+AL HGY 
Sbjct  321  LSKVFPFELLHIGGDEVNTRCWEITQPVNDWLRKHNLTPSLGYEFFVLEVQKLALKHGYL  380

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             +NW+E F  FG  LSRKT+VHNW G  +    V++GL+ IVS Q  WYLDH+D PW  F
Sbjct  381  PVNWQEPFEKFGPSLSRKTIVHNWWGTQIPPNTVSSGLKSIVSEQFSWYLDHIDIPWQEF  440

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            YS EP DNI+  K Q L++G                           ERLW+        
Sbjct  441  YSKEPYDNISSHKEQQLIIG---------------------------ERLWSPFTVTDLG  473

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCH  179
            P   A RL  FR LLN+RG+AA+P+     G+ + P S H
Sbjct  474  PKNAAPRLEFFRILLNERGIAASPVKSKEEGSSKPPDSPH  513



>gb|ETO34651.1| beta-hexosaminidase [Reticulomyxa filosa]
Length=198

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 125/197 (63%), Gaps = 8/197 (4%)
 Frame = -1

Query  745  LKTRHFDGQQAYQYFVLQAQKIAL-SHGYEIINWEETFNNFGNKLSRK-TVVHNWlgggl  572
            +   +F  +QAY YFV +A  IA   +G ++INW E FNNF N L+R  TV+  W     
Sbjct  1    MAANNFTTEQAYGYFVERAMDIAYYKYGLQVINWVEVFNNFNNTLNRNVTVIEVWKSKEF  60

Query  571  aqqvvaagL---RCIVSNQDRWYLDHLDAPWDGFYSNEPLDNITDPKHQALVLGGEVCMW  401
               + AA     R I+++ D WYLDHL   WD  Y NEP  +I++   QALVLGGE CMW
Sbjct  61   ILMLAAAVEMGFRAILADDDLWYLDHLTVTWDEMYMNEPFADISNKTQQALVLGGEGCMW  120

Query  400  GENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLV  221
            GE +D SDIEQT+WPRA+A AERLW+ +    ++ NK   R+ +FRCL+N+RG+AAAP+ 
Sbjct  121  GETVDVSDIEQTVWPRASAIAERLWSPA--YVNNTNKALPRIEYFRCLMNERGIAAAPVN  178

Query  220  GS-GRGAPEQPGSCHLQ  173
                R AP  PGSC+ Q
Sbjct  179  NPIAREAPPGPGSCYDQ  195



>ref|XP_009038483.1| hypothetical protein AURANDRAFT_28648 [Aureococcus anophagefferens]
 gb|EGB06733.1| hypothetical protein AURANDRAFT_28648 [Aureococcus anophagefferens]
Length=505

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 120/223 (54%), Gaps = 4/223 (2%)
 Frame = -1

Query  829  IFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEIIN  650
            +F   FVHLGGDEVNT CW STP +  WLK R+      Y +FV     +A++     + 
Sbjct  281  LFPDGFVHLGGDEVNTACWESTPSVAAWLKARNLTADGGYAHFVKTVADLAIAKKRRPVQ  340

Query  649  WEETFNNFGNKLSRKTVVHNWlggglaqqvvaa---gLRCIVSNQDRWYLDHLDAPWDGF  479
            W E +++F   L R  V+H W        VVAA    +R +  +   WYLD+L+      
Sbjct  341  WSEVWDHFKTDLPRDVVIHVWKSVTNVADVVAAGYDVIRNVGYDATSWYLDNLNVNSSAV  400

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y NEP D I      A VLGG   MWGE +DASDI+ T+WPR  A AE+LW+        
Sbjct  401  YGNEPCDGIPADLCAAHVLGGHGEMWGETVDASDIDGTVWPRLGAIAEKLWSPEAATIPT  460

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGS-GRGAPEQPGSCHLQ  173
            P  +  RLA FRC LN RGV AAP+  +  R AP  PGSC  Q
Sbjct  461  PADMLPRLAEFRCRLNARGVRAAPVYNAEARSAPPGPGSCLKQ  503



>gb|EMT33327.1| Beta-hexosaminidase subunit B2 [Aegilops tauschii]
Length=415

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 115/223 (52%), Gaps = 38/223 (17%)
 Frame = -1

Query  832  KIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEII  653
            KIF +   HLGGDEV T CW  TP +++WL  R+   + AY+YFVL+AQ+IA+   +  +
Sbjct  228  KIFPFGLFHLGGDEVYTGCWNLTPHVKQWLDERNMTTKDAYKYFVLKAQEIAIDLNWIPV  287

Query  652  NWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYS  473
            NW       G  +  K V                 LRCI+SNQ  WYLDHLD PW+  Y+
Sbjct  288  NW------LGPGVCPKVVAKG--------------LRCIMSNQGVWYLDHLDVPWEQVYT  327

Query  472  NEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLP--DD  299
             EPL  I D   Q LVLGGE  M                R    AER+W+  E +   D 
Sbjct  328  AEPLAGIDDTAQQKLVLGGEELMC---------------RYQNNAERMWSQLEAISAQDL  372

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVG-SGRGAPEQPGSCHLQ  173
               V  RL +FRCLLN RG+AAAP+     R  P  PGSC +Q
Sbjct  373  ETTVLARLHYFRCLLNHRGIAAAPVTNFYARRPPIGPGSCFVQ  415



>gb|EFA84209.1| beta-N-acetylhexosaminidase [Polysphondylium pallidum PN500]
Length=950

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 123/217 (57%), Gaps = 6/217 (3%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDG-QQAYQYFVLQAQKIALSHGYE  659
            S +F  +  H+GGDEV   CW ++ +  KW++  +F+  +QA QYF        LS    
Sbjct  319  SNLFTDQLFHIGGDEVVYECWENSEQFSKWMRDNNFNSYEQALQYFEQIIHDKVLSTKRY  378

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGF  479
             + WE+TF  FG++L++  +V  +      Q  V AG R I SN   WYLD L  PW  F
Sbjct  379  PVVWEDTFLMFGDQLNKDVIVQIYHQLTTLQDAVKAGHRAIASNAWNWYLDILYTPWQKF  438

Query  478  YSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDD  299
            Y N+   NITD +    VLGGEV +W E +D+SDI   IWP+AAAAAERLW+ +    DD
Sbjct  439  YLNDITVNITDSEEIKRVLGGEVALWSEMMDSSDIFSKIWPKAAAAAERLWSDAS--VDD  496

Query  298  PNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPG  188
             ++V  RL  FRC +  RG+ +APL      +P  PG
Sbjct  497  VDEVVPRLERFRCHMIYRGIESAPL---NSTSPNGPG  530



>ref|XP_002990916.1| hypothetical protein SELMODRAFT_429325 [Selaginella moellendorffii]
 gb|EFJ07960.1| hypothetical protein SELMODRAFT_429325 [Selaginella moellendorffii]
Length=786

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEI  656
            + +F ++ +H+GGDEVNT CW  T  ++ WL+  +    Q Y +FVLQ Q++AL HGY  
Sbjct  306  TSVFPFELLHIGGDEVNTRCWEFTEPVKDWLRKHNLTPSQGYGFFVLQVQRLALKHGYVP  365

Query  655  INWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFY  476
            +NW+E F  FG  LSRKT+VHNW G  +    V++GL+ IVS Q  WYL H+D PW+ FY
Sbjct  366  VNWQEPFEKFGPSLSRKTIVHNWWGTQIPPNTVSSGLKSIVSEQFSWYLHHIDIPWEEFY  425

Query  475  SNEPLDNITDPKHQALVLGGE  413
            S EP DNI   K Q L++GGE
Sbjct  426  SKEPYDNIASHKEQQLIIGGE  446



>gb|EYU39499.1| hypothetical protein MIMGU_mgv1a004365mg [Erythranthe guttata]
Length=393

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIFKYKF+HLGGDEV+T+CW  TP + KWL+    +  +AYQYFVL+AQKIALSHGYE
Sbjct  310  FSKIFKYKFIHLGGDEVDTSCWQLTPHVRKWLQKNGMNASEAYQYFVLRAQKIALSHGYE  369

Query  658  IINWEETFNNFGNKLSRKTVVHNW  587
            IINWEETFNNFG+KLSRKTVVHNW
Sbjct  370  IINWEETFNNFGSKLSRKTVVHNW  393



>gb|ETO08778.1| hypothetical protein RFI_28610 [Reticulomyxa filosa]
Length=207

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 118/209 (56%), Gaps = 10/209 (5%)
 Frame = -1

Query  796  DEVNTTCWTSTPRIEKWLKTRHF-DGQQAYQYFVLQAQKIALSHGYEIINWEETFNNFGN  620
            DEV   C+ +  +++ WLK  H  +G   Y+++  +A  IA  +    I W+E + NF  
Sbjct  2    DEVRFECYDNDEQVKAWLKKEHLSEGHDIYRWWADKATAIASKYKKRPIVWQEVYKNFET  61

Query  619  KLSRKTVVHNWlggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSNEPLDNIT--D  446
            K+ + TV+H W+G  L +     G   +VS+   WYLDHL   W  +Y+N   + I    
Sbjct  62   KVPKDTVIHLWMGKNLLRSAALNGYDILVSHG--WYLDHLKTAWQDYYNNNMFEGIEHES  119

Query  445  PKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNKVAGRLAHF  266
              ++  VLGGE CMW E+ID S ++ T+WP+AAAAAE LW++S N+    +    RL +F
Sbjct  120  EHYKKHVLGGEACMWSEHIDLSVLDATVWPKAAAAAENLWSTSRNI----DTAFDRLEYF  175

Query  265  RCLLNQRGVAAAPLVG-SGRGAPEQPGSC  182
            RCLL  RGV   PL   + R AP+ P SC
Sbjct  176  RCLLIGRGVGGGPLKHVNSREAPDSPHSC  204



>ref|XP_007478591.1| PREDICTED: beta-hexosaminidase subunit alpha [Monodelphis domestica]
Length=535

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 120/213 (56%), Gaps = 14/213 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDG-QQAYQYFVLQAQKIALSHGYE  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F   +Q   +++ +   I  S+   
Sbjct  317  SDVFPDFYLHLGGDEVDFTCWQSNPDIQAFMKEKGFQNYEQLESFYIQKLLNIVSSYRKG  376

Query  658  IINWEETFNNFGNKLSRKTVVHNWlgg------glaqqvvaagLRCIVSNQDRWYLDHLD  497
             I W+E F+N   KLS  TVVH W            + +  AG R ++S+   WYL+ + 
Sbjct  377  YIVWQEVFDN-DVKLSPDTVVHVWRETKPVPYAMEMKNITKAGYRVLLSSP--WYLNRIS  433

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   YS EPLD    P+ ++LV+GGE CMWGE +D +++   +WPRA A AERLW+
Sbjct  434  YGQDWQKIYSVEPLDFEGSPEQESLVIGGEACMWGEFVDMTNLTPRLWPRAGAVAERLWS  493

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            S     +D      RLA+FRC L +RGV A PL
Sbjct  494  SKSV--NDTKLAYARLANFRCELLRRGVQAQPL  524



>emb|CBK19718.2| unnamed protein product [Blastocystis hominis]
Length=1069

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 112/219 (51%), Gaps = 6/219 (3%)
 Frame = -1

Query  826  FKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYEIINW  647
            F  +  H+GGDEVNT CWT  PR+ +W+  R+     AY YFV +   +    G E I W
Sbjct  170  FPAEVFHMGGDEVNTECWTKVPRVAEWMAQRNLTANGAYGYFVNRMDALIRKRGRETIAW  229

Query  646  EETFNNFGNKLSRKTVVHNWl-ggglaqqvvaagLRCIVSNQDRWYLDHLDAPWDGFYSN  470
            EE F N    +    ++  WL  G   +++V AG R IVSN   WYL  L   WD +Y N
Sbjct  230  EEVFVNHRASIDPAMIIQLWLGDGERLREIVDAGFRVIVSNYKHWYLPQLWETWDYYYGN  289

Query  469  EPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSSENLPDDPNK  290
            +          +  V  GE       +DASD E TI PR+ AAAER+WT  E L  D  +
Sbjct  290  DLSTEARCACGERRVGMGET---RHTVDASDFENTIMPRSIAAAERMWTQPELL--DIER  344

Query  289  VAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQPGSCHLQ  173
               R  + RC  N+RGV AAP    GRG P  PGSC  Q
Sbjct  345  AKIRFPYARCEFNRRGVQAAPAFTEGRGVPIGPGSCMRQ  383



>ref|XP_004628811.1| PREDICTED: beta-hexosaminidase subunit alpha [Octodon degus]
Length=527

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 125/224 (56%), Gaps = 19/224 (8%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE-  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K + FD  +  + F +Q   + +   YE 
Sbjct  308  SSVFPDFYLHLGGDEVDFTCWRSNPDIQAFMKKKGFDDFRQLESFYIQ-MLLDIVSAYEK  366

Query  658  -IINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T+V  W            + V  AG R ++S    WYL+H+
Sbjct  367  GYVVWQEVFDN-KVKVRPDTIVQVWRDKKPVTYMEEVELVTKAGFRVLLSAP--WYLNHI  423

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
               A W   Y  EPLD    P+ +ALV+GGE CMWGE +D++++   +WPR    AERLW
Sbjct  424  TYGADWKDMYKVEPLDFEGSPEEKALVIGGEACMWGEWVDSTNLVPRLWPRGGVVAERLW  483

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQ  194
            +S  NL  + +    RL+HFRCLL +RGV A P+   G G  EQ
Sbjct  484  SS--NLTTNLDFAETRLSHFRCLLLRRGVQAEPI---GVGYCEQ  522



>ref|XP_005393661.1| PREDICTED: beta-hexosaminidase subunit alpha [Chinchilla lanigera]
Length=527

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 124/223 (56%), Gaps = 17/223 (8%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDG-QQAYQYFVLQAQKIALSHGYE  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K + FD  +Q   +++     I  ++   
Sbjct  308  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKKGFDDFRQLESFYIQNLLDIVSAYDKG  367

Query  658  IINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHLD  497
             + W+E F+N   K+   T+V  W            +QV  AG R ++S    WYL+H+ 
Sbjct  368  YVVWQEVFDN-KVKVRPDTIVQVWWNKKPISYMKEVEQVTKAGFRALLSAP--WYLNHIT  424

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  EPLD    PK +ALV+GGE CMWGE +D++++   +WPR  A AERLW+
Sbjct  425  YGPDWKDMYKVEPLDFEGSPKEKALVIGGEACMWGEWVDSTNLVPRLWPRGGAVAERLWS  484

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQ  194
            S  NL  D +    RL+HFRC L +RGV A P+   G G  EQ
Sbjct  485  S--NLTTDLDFAETRLSHFRCELLRRGVQAEPI---GIGYCEQ  522



>gb|KJB14662.1| hypothetical protein B456_002G136400 [Gossypium raimondii]
Length=419

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 74/108 (69%), Gaps = 24/108 (22%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            FSKIF +KFVHLGGDEVNT+CWT+TPRI  WLK    +  QAYQYFVL+AQ IALSHGYE
Sbjct  303  FSKIFNFKFVHLGGDEVNTSCWTTTPRIRNWLKKHGMNESQAYQYFVLRAQNIALSHGYE  362

Query  658  IINW------------------------EETFNNFGNKLSRKTVVHNW  587
            IINW                        EETFN+FGNKLSRKTVVHNW
Sbjct  363  IINWYSSYTSYLAKQQYYTSYSHIEHHREETFNDFGNKLSRKTVVHNW  410



>ref|XP_004855581.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X3 [Heterocephalus 
glaber]
Length=435

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 123/223 (55%), Gaps = 17/223 (8%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDG-QQAYQYFVLQAQKIALSHGYE  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K R FD  +Q   +++     I  ++   
Sbjct  216  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKRGFDDFRQLESFYIQMLLDIISAYNKG  275

Query  658  IINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHLD  497
             + W+E F+N   K+   T+V  W            + V  AG R ++S    WYL+ + 
Sbjct  276  YVVWQEVFDN-KVKVRPDTIVQVWREEKPVTYMQEVELVTKAGFRALLSAP--WYLNRIT  332

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y+ EPLD    P+ +ALV+GGE CMWGE +D++++   +WPR  A AERLW+
Sbjct  333  YGPDWKAMYNVEPLDFEGSPEQKALVIGGEACMWGEWVDSTNLVPRLWPRGGAVAERLWS  392

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQ  194
            S  NL  D +    RL+HFRC L +RGV A P+   G G  EQ
Sbjct  393  S--NLTTDLDFAYKRLSHFRCELLRRGVQAEPI---GVGYCEQ  430



>ref|XP_008149598.1| PREDICTED: beta-hexosaminidase subunit alpha [Eptesicus fuscus]
Length=529

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 118/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+  CW S P ++ ++K + F  D +Q   +++     I  ++G 
Sbjct  309  SSVFPDFYLHLGGDEVDFACWKSNPDVQAFMKKKGFGNDFKQLESFYIQTLLDIVSAYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlggglaqqvvaagL------RCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W        +    L      R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKVRPDTIIQVWREEAPVSYLKELALITEAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W+ FY  +PL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  426  SYGPDWEDFYKVDPLSFEGGPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            ++ E    DP+    RLAHFRC L +RGV A PL
Sbjct  486  SNKEV--TDPDFAFKRLAHFRCELLRRGVQAQPL  517



>gb|AAH21030.1| HEXA protein, partial [Homo sapiens]
Length=309

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  89   SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  148

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  149  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  205

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  206  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  265

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  266  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  297



>dbj|BAK63426.1| beta-hexosaminidase alpha chain precursor [Pan troglodytes]
Length=337

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  117  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  176

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  177  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  233

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  234  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  293

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  294  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  325



>ref|XP_006087896.1| PREDICTED: beta-hexosaminidase subunit alpha [Myotis lucifugus]
Length=529

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 118/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+  CW S P ++ ++K + F  D +Q   +++     I  ++G 
Sbjct  309  SSVFPDFYLHLGGDEVDFACWKSNPDVQAFMKKKGFGNDFKQLESFYIQTLLDIVSAYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W              +  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKVRPDTIIQVWREEVPVSYLKELALITEAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W+ FY  +PL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  426  SYGPDWEDFYRVDPLSFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  +  DP+    RLAHFRC L +RGV A PL
Sbjct  486  --SNKVVTDPDFAFKRLAHFRCELLRRGVQAQPL  517



>ref|XP_008629505.1| PREDICTED: beta-hexosaminidase subunit alpha [Corvus brachyrhynchos]
Length=336

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 116/213 (54%), Gaps = 14/213 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   F+HLGGDEV+ TCW S P I  ++K   F  D ++   +++ +   I  S G 
Sbjct  117  SAVFPDFFLHLGGDEVDFTCWKSNPEIRAFMKEMGFGEDYKKLESFYIQRLLHIVSSLGK  176

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlggglaqq-----vvaagLRCIVSNQDRWYLDHLD  497
              I W+E F+N   KL   T++H W    +        V  AG R ++S    WYL+ + 
Sbjct  177  GYIVWQEVFDN-DVKLRPDTIIHVWKENSMQYMNEMANVTRAGYRALLSAP--WYLNRIS  233

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW 
Sbjct  234  YGQDWIAAYKVEPLSFAGSPEQKALVMGGEACMWGEYVDVTNLTPRLWPRAGAVAERLW-  292

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            S+E + D  +  A RLA FRC L  RGV A PL
Sbjct  293  SNETVRDVEDAYA-RLAEFRCTLLGRGVQAQPL  324



>gb|EHB08675.1| Beta-hexosaminidase subunit alpha, partial [Heterocephalus glaber]
Length=495

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 123/223 (55%), Gaps = 17/223 (8%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDG-QQAYQYFVLQAQKIALSHGYE  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K R FD  +Q   +++     I  ++   
Sbjct  276  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKRGFDDFRQLESFYIQMLLDIISAYNKG  335

Query  658  IINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHLD  497
             + W+E F+N   K+   T+V  W            + V  AG R ++S    WYL+ + 
Sbjct  336  YVVWQEVFDN-KVKVRPDTIVQVWREEKPVTYMQEVELVTKAGFRALLSAP--WYLNRIT  392

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y+ EPLD    P+ +ALV+GGE CMWGE +D++++   +WPR  A AERLW+
Sbjct  393  YGPDWKAMYNVEPLDFEGSPEQKALVIGGEACMWGEWVDSTNLVPRLWPRGGAVAERLWS  452

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQ  194
            S  NL  D +    RL+HFRC L +RGV A P+   G G  EQ
Sbjct  453  S--NLTTDLDFAYKRLSHFRCELLRRGVQAEPI---GVGYCEQ  490



>gb|EPQ18046.1| Beta-hexosaminidase subunit alpha [Myotis brandtii]
Length=542

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 118/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+  CW S P ++ ++K + F  D +Q   +++     I  ++G 
Sbjct  322  SSVFPDFYLHLGGDEVDFACWKSNPDVQAFMKKKGFGNDFKQLESFYIQTLLDIVSAYGK  381

Query  661  EIINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W              +  AG R ++S    WYL+ +
Sbjct  382  GYVVWQEVFDN-KVKVRPDTIIQVWREEVPVSYLKELALITEAGFRALLSAP--WYLNRI  438

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W+ FY  +PL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  439  SYGPDWEDFYRVDPLSFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  498

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  +  DP+    RLAHFRC L +RGV A PL
Sbjct  499  --SNKVVTDPDFAFKRLAHFRCELLRRGVQAQPL  530



>ref|XP_005882901.1| PREDICTED: beta-hexosaminidase subunit alpha [Myotis brandtii]
Length=573

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 118/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+  CW S P ++ ++K + F  D +Q   +++     I  ++G 
Sbjct  353  SSVFPDFYLHLGGDEVDFACWKSNPDVQAFMKKKGFGNDFKQLESFYIQTLLDIVSAYGK  412

Query  661  EIINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W              +  AG R ++S    WYL+ +
Sbjct  413  GYVVWQEVFDN-KVKVRPDTIIQVWREEVPVSYLKELALITEAGFRALLSAP--WYLNRI  469

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W+ FY  +PL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  470  SYGPDWEDFYRVDPLSFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  529

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  +  DP+    RLAHFRC L +RGV A PL
Sbjct  530  --SNKVVTDPDFAFKRLAHFRCELLRRGVQAQPL  561



>ref|XP_004893525.1| PREDICTED: beta-hexosaminidase subunit alpha [Heterocephalus 
glaber]
 ref|XP_004855579.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X1 [Heterocephalus 
glaber]
 ref|XP_004855580.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X2 [Heterocephalus 
glaber]
Length=527

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 123/223 (55%), Gaps = 17/223 (8%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDG-QQAYQYFVLQAQKIALSHGYE  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K R FD  +Q   +++     I  ++   
Sbjct  308  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKRGFDDFRQLESFYIQMLLDIISAYNKG  367

Query  658  IINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHLD  497
             + W+E F+N   K+   T+V  W            + V  AG R ++S    WYL+ + 
Sbjct  368  YVVWQEVFDN-KVKVRPDTIVQVWREEKPVTYMQEVELVTKAGFRALLSAP--WYLNRIT  424

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y+ EPLD    P+ +ALV+GGE CMWGE +D++++   +WPR  A AERLW+
Sbjct  425  YGPDWKAMYNVEPLDFEGSPEQKALVIGGEACMWGEWVDSTNLVPRLWPRGGAVAERLWS  484

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQ  194
            S  NL  D +    RL+HFRC L +RGV A P+   G G  EQ
Sbjct  485  S--NLTTDLDFAYKRLSHFRCELLRRGVQAEPI---GVGYCEQ  522



>ref|XP_005316823.1| PREDICTED: beta-hexosaminidase subunit alpha [Ictidomys tridecemlineatus]
Length=527

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 117/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F  D +Q   +++     I  ++G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWRSNPDIQAFMKKKGFGDDFKQLESFYIQTLLDIVSAYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W              +  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWQEELPVNYMKELDLITKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPLD    P+ +ALV+GGE CMWGE +D++++   +WPRA A +ERLW
Sbjct  426  TYGPDWKDFYKVEPLDFKGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVSERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            + S     D      RL+HFRC L +RGV A PL
Sbjct  486  SKSSM--TDVKFAFQRLSHFRCELLRRGVQAQPL  517



>ref|XP_010625459.1| PREDICTED: beta-hexosaminidase subunit alpha [Fukomys damarensis]
Length=336

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 122/223 (55%), Gaps = 17/223 (8%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDG-QQAYQYFVLQAQKIALSHGYE  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K R FD  +Q   +++ +   I  ++   
Sbjct  117  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKRGFDDFRQLESFYIQKLLDIVSAYNKG  176

Query  658  IINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHLD  497
             + W+E F+N   K+   T+V  W            + V  AG R ++S    WYL+ + 
Sbjct  177  YVVWQEVFDN-KVKVRPDTIVQVWRAEKPVTYMQEMELVTKAGFRALLSAP--WYLNRIT  233

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  EPLD     + +ALV+GGE CMWGE +D++++   +WPR  A AERLW+
Sbjct  234  YGPDWKAMYRVEPLDFEGSLEQKALVIGGEACMWGEWVDSTNLVPRLWPRGGAVAERLWS  293

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGSGRGAPEQ  194
            S  NL  D +    RL+HFRC L +RGV A P+   G G  EQ
Sbjct  294  S--NLTTDLDFAYTRLSHFRCKLLRRGVQAEPI---GVGYCEQ  331



>ref|XP_003755208.1| PREDICTED: beta-hexosaminidase subunit alpha [Sarcophilus harrisii]
Length=569

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 117/213 (55%), Gaps = 14/213 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQ-KIALSHGYE  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K R FD  +  + F +Q    I  S+   
Sbjct  344  SSVFPDFYLHLGGDEVDFTCWRSNPDIKAFMKKRGFDRFEKLESFYIQKLLNIVSSYRKG  403

Query  658  IINWEETFNNFGNKLSRKTVVHNWlggg------laqqvvaagLRCIVSNQDRWYLDHLD  497
             + W+E F+N   KL+  TVVH W            Q V  AG R ++S    WYL+ + 
Sbjct  404  YMVWQEVFDN-NVKLNPDTVVHVWKERSPFPYALEMQNVTKAGFRALLSAP--WYLNRIS  460

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  +PLD    P+ ++LV+GGE CMWGE +D +++   +WPR  A AERLW+
Sbjct  461  YGQDWQEIYMVDPLDFKGSPEQKSLVIGGEACMWGEYVDETNLTPRLWPRGGAVAERLWS  520

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            S      D +    RLAHFRC L +RG+ A PL
Sbjct  521  SQSV--RDLDLAYNRLAHFRCELLRRGIQAQPL  551



>ref|XP_011947909.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X2 [Cercocebus 
atys]
Length=337

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  117  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  176

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  177  GYVVWQEVFDN-KVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAP--WYLNRI  233

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  234  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  293

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  294  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  325



>gb|KFO57282.1| Beta-hexosaminidase subunit alpha, partial [Corvus brachyrhynchos]
Length=434

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 116/213 (54%), Gaps = 14/213 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   F+HLGGDEV+ TCW S P I  ++K   F  D ++   +++ +   I  S G 
Sbjct  216  SAVFPDFFLHLGGDEVDFTCWKSNPEIRAFMKEMGFGEDYKKLESFYIQRLLHIVSSLGK  275

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlggglaqq-----vvaagLRCIVSNQDRWYLDHLD  497
              I W+E F+N   KL   T++H W    +        V  AG R ++S    WYL+ + 
Sbjct  276  GYIVWQEVFDN-DVKLRPDTIIHVWKENSMQYMNEMANVTRAGYRALLSAP--WYLNRIS  332

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW 
Sbjct  333  YGQDWIAAYKVEPLSFAGSPEQKALVMGGEACMWGEYVDVTNLTPRLWPRAGAVAERLW-  391

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            S+E + D  +  A RLA FRC L  RGV A PL
Sbjct  392  SNETVRDVEDAYA-RLAEFRCTLLGRGVQAQPL  423



>gb|AAH01138.2| HEXA protein, partial [Homo sapiens]
Length=409

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  189  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  248

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  249  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  305

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  306  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  365

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  366  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  397



>gb|KFQ33085.1| Beta-hexosaminidase subunit alpha, partial [Merops nubicus]
Length=434

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 113/213 (53%), Gaps = 14/213 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   F+HLGGDEV+ TCWTS P I  ++K   F  D ++   +++ +   I  S G 
Sbjct  216  SAVFPDFFLHLGGDEVDFTCWTSNPNIRAFMKEMGFGEDYKKLESFYIQRLLDIVSSLGK  275

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlgggl-----aqqvvaagLRCIVSNQDRWYLDHLD  497
              I W+E F+N G K+   T++H W             V  AG R ++S    WYL+ + 
Sbjct  276  GYIVWQEVFDN-GVKMRPDTIIHVWKESSTPYLQEMANVTKAGHRALLSAP--WYLNRIS  332

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  EPL+    P+ + LV+GGE CMWGE +D +++   +WPRA A AERLW 
Sbjct  333  YGQDWMAAYQVEPLEFEGSPEQKELVMGGEACMWGEYVDVTNLAPRLWPRAGAVAERLW-  391

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
             S+    D      RLA FRC L  RGV A PL
Sbjct  392  -SDATVRDLQDAYARLATFRCQLLGRGVQAQPL  423



>ref|XP_007118442.1| PREDICTED: beta-hexosaminidase subunit alpha [Physeter catodon]
Length=337

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 118/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F  D ++   +++ +   I  ++G 
Sbjct  117  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKKGFGEDFKKLESFYIQKLLDIVSAYGK  176

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   TV+  W            + V  AG R ++S    WYL+H+
Sbjct  177  GYVVWQEVFDN-KVKVQPDTVIQVWREEMPVRYMKEMELVTRAGFRALLSAP--WYLNHI  233

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W   Y  EPL     P+  ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  234  TYGPDWKKIYMVEPLAFEGSPEQNALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  293

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  +  + +    RLAHFRC L +RGV A PL
Sbjct  294  --SNKMVTNLDFAYKRLAHFRCELLRRGVQAQPL  325



>gb|AAA51827.1| N-acetyl-alpha-glucosaminidase prepro-polypeptide, partial [Homo 
sapiens]
Length=490

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  270  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  329

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  330  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  386

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  387  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  446

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  447  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  478



>gb|AAV34701.1| beta-hexosaminidase alpha-subunit [Oryctolagus cuniculus]
Length=490

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ +CW S P I+ ++K + F  D +Q   +++     I   +G 
Sbjct  270  SSVFPDFYLHLGGDEVDFSCWKSNPDIQDFMKKKGFGSDFKQLESFYIQTLLDIVSDYGR  329

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlggglaqqvva------agLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W        +        A  R ++S    WYL+ +
Sbjct  330  GYVVWQEVFDN-KVKVRPDTIIQVWREETPVPYMKELELITNASFRALLSAP--WYLNRI  386

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY+ EPL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  387  SYGPDWKNFYTVEPLAFQGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  446

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            +S   L  D      RL+HFRC L +RGV A PL
Sbjct  447  SS--ELMTDTEFAFQRLSHFRCELLRRGVQAQPL  478



>ref|XP_008942185.1| PREDICTED: beta-hexosaminidase subunit alpha, partial [Merops 
nubicus]
Length=445

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 113/213 (53%), Gaps = 14/213 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   F+HLGGDEV+ TCWTS P I  ++K   F  D ++   +++ +   I  S G 
Sbjct  226  SAVFPDFFLHLGGDEVDFTCWTSNPNIRAFMKEMGFGEDYKKLESFYIQRLLDIVSSLGK  285

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlgggl-----aqqvvaagLRCIVSNQDRWYLDHLD  497
              I W+E F+N G K+   T++H W             V  AG R ++S    WYL+ + 
Sbjct  286  GYIVWQEVFDN-GVKMRPDTIIHVWKESSTPYLQEMANVTKAGHRALLSAP--WYLNRIS  342

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  EPL+    P+ + LV+GGE CMWGE +D +++   +WPRA A AERLW 
Sbjct  343  YGQDWMAAYQVEPLEFEGSPEQKELVMGGEACMWGEYVDVTNLAPRLWPRAGAVAERLW-  401

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
             S+    D      RLA FRC L  RGV A PL
Sbjct  402  -SDATVRDLQDAYARLATFRCQLLGRGVQAQPL  433



>gb|AAD13932.1|1680052_1 lysosomal enzyme beta-N-acetylhexosaminidase A [Homo sapiens]
 gb|AAB00965.1| beta-hexosaminidase alpha chain [Homo sapiens]
 gb|AAH18927.1| Hexosaminidase A (alpha polypeptide) [Homo sapiens]
 gb|AAH84537.1| Hexosaminidase A (alpha polypeptide) [Homo sapiens]
 gb|EAW77902.1| hexosaminidase A (alpha polypeptide) [Homo sapiens]
 gb|ABM83622.1| hexosaminidase A (alpha polypeptide) [synthetic construct]
 gb|ABW03529.1| hexosaminidase A (alpha polypeptide) [synthetic construct]
 gb|AIC54536.1| HEXA, partial [synthetic construct]
Length=529

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_003818608.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X2 [Pan 
paniscus]
Length=529

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>pdb|2GK1|A Chain A, X-Ray Crystal Structure Of Ngt-Bound Hexa
 pdb|2GK1|C Chain C, X-Ray Crystal Structure Of Ngt-Bound Hexa
 pdb|2GK1|E Chain E, X-Ray Crystal Structure Of Ngt-Bound Hexa
 pdb|2GK1|G Chain G, X-Ray Crystal Structure Of Ngt-Bound Hexa
 pdb|2GJX|A Chain A, Crystallographic Structure Of Human Beta-Hexosaminidase 
A
 pdb|2GJX|D Chain D, Crystallographic Structure Of Human Beta-Hexosaminidase 
A
 pdb|2GJX|E Chain E, Crystallographic Structure Of Human Beta-Hexosaminidase 
A
 pdb|2GJX|H Chain H, Crystallographic Structure Of Human Beta-Hexosaminidase 
A
Length=507

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  287  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  346

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  347  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  403

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  404  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  463

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  464  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  495



>dbj|BAG62619.1| unnamed protein product [Homo sapiens]
Length=540

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  320  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  379

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  380  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  436

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  437  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  496

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  497  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  528



>ref|XP_010410730.1| PREDICTED: beta-hexosaminidase subunit alpha [Corvus cornix cornix]
Length=460

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 116/213 (54%), Gaps = 14/213 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   F+HLGGDEV+ TCW S P I  ++K   F  D ++   +++ +   I  S G 
Sbjct  241  SAVFPDFFLHLGGDEVDFTCWKSNPEIRAFMKEMGFGEDYKKLESFYIQRLLHIVSSLGK  300

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlggglaqq-----vvaagLRCIVSNQDRWYLDHLD  497
              I W+E F+N   KL   T++H W    +        V  AG R ++S    WYL+ + 
Sbjct  301  GYIVWQEVFDN-DVKLRPDTIIHVWKENSMQYMNEMANVTRAGYRALLSAP--WYLNRIS  357

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW 
Sbjct  358  YGQDWIAAYKVEPLSFAGSPEQKALVMGGEACMWGEYVDVTNLTPRLWPRAGALAERLW-  416

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            S+E + D  +  A RLA FRC L  RGV A PL
Sbjct  417  SNETVRDVEDAYA-RLAEFRCTLLGRGVQAQPL  448



>ref|XP_005917247.1| PREDICTED: beta-hexosaminidase subunit beta-like isoform X2 [Haplochromis 
burtoni]
Length=546

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 121/214 (57%), Gaps = 12/214 (6%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   +VHLGGDEV+ TCW S P I+K+++ +HF  D ++   +++ +   I  S   
Sbjct  329  STVFPDGYVHLGGDEVDFTCWKSNPDIQKFMEQQHFGDDYRKLESFYIQKLLDIVTSTKK  388

Query  661  EIINWEETFNNFGNKLSRKTVVHNWl---ggglaqqvvaagLRCIVSNQDRWYLDHLD--  497
              + W+E F+N G KL   TVVH W+          V AAG   I+S    WYLD++   
Sbjct  389  GYLIWQEVFDN-GVKLKPDTVVHVWIGGGSDKEMSTVTAAGYTTILSAP--WYLDYISYG  445

Query  496  APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSS  317
              W  +Y  EPL+     + + LV+GGE C+WGE +DA+++   +WPRA+A AERLW++ 
Sbjct  446  QDWQKYYKVEPLNFEGTDEQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSAK  505

Query  316  ENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGS  215
            +    D      RL+  RC + +RG+ A PL  S
Sbjct  506  DV--TDIGDAFNRLSLHRCRMVERGIPAEPLFSS  537



>emb|CAH10482.1| hypothetical protein [Homo sapiens]
Length=529

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_003267055.2| PREDICTED: beta-hexosaminidase subunit alpha [Nomascus leucogenys]
Length=530

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  310  SSVFPDLYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  369

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  370  GYVVWQEVFDN-KVKIRPDTIIQVWREDTPVNYMKELELVTKAGFRALLSAP--WYLNRI  426

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  427  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  486

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  487  --SNKLTSDQTFAYERLSHFRCELLRRGVQAQPL  518



>ref|XP_004056493.1| PREDICTED: beta-hexosaminidase subunit alpha isoform 1 [Gorilla 
gorilla gorilla]
Length=529

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_009383359.1| PREDICTED: beta-hexosaminidase 3-like [Musa acuminata subsp. 
malaccensis]
Length=423

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHFDGQQAYQYFVLQAQKIALSHGYE  659
            F+K+FK++FVHLGGDEVNT+CWT+TP I +WL     +  Q Y+YFVL+AQKIALSHGYE
Sbjct  311  FTKVFKFRFVHLGGDEVNTSCWTNTPHIIEWLNKHGMNESQGYKYFVLRAQKIALSHGYE  370

Query  658  IINWEETFNNFGNKLSRKTVVHNW  587
            +INWEETFNNF ++LS KTVVHNW
Sbjct  371  VINWEETFNNFRSQLSPKTVVHNW  394



>ref|XP_002717746.1| PREDICTED: beta-hexosaminidase subunit alpha [Oryctolagus cuniculus]
Length=529

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ +CW S P I+ ++K + F  D +Q   +++     I   +G 
Sbjct  309  SSVFPDFYLHLGGDEVDFSCWKSNPDIQDFMKKKGFGSDFKQLESFYIQTLLDIVSDYGR  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlggglaqqvva------agLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W        +        A  R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKVRPDTIIQVWREETPVPYMKELELITNASFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY+ EPL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  426  SYGPDWKNFYTVEPLAFQGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            +S   L  D      RL+HFRC L +RGV A PL
Sbjct  486  SS--ELMTDTEFAFQRLSHFRCELLRRGVQAQPL  517



>ref|XP_008071061.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X2 [Tarsius 
syrichta]
Length=337

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F  D +Q   +++     I  S+G 
Sbjct  117  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMKKKGFGDDFKQLESFYIQTLLDIVSSYGK  176

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlggglaqqv------vaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   TV+  W        +        AG R ++S    WYL+ +
Sbjct  177  GYVVWQEVFDN-KVKVRPDTVIQVWREETPVSYMKELELITKAGFRALLSAP--WYLNRI  233

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  234  SYGPDWKDFYLVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  293

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
            +S   L  D      RL++FRC L +RGV A PL
Sbjct  294  SS--QLSVDLQFAYLRLSYFRCELLRRGVQAQPL  325



>ref|NP_000511.2| beta-hexosaminidase subunit alpha preproprotein [Homo sapiens]
 sp|P06865.2|HEXA_HUMAN RecName: Full=Beta-hexosaminidase subunit alpha; AltName: Full=Beta-N-acetylhexosaminidase 
subunit alpha; Short=Hexosaminidase 
subunit A; AltName: Full=N-acetyl-beta-glucosaminidase 
subunit alpha; Flags: Precursor [Homo sapiens]
Length=529

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_004056494.1| PREDICTED: beta-hexosaminidase subunit alpha isoform 2 [Gorilla 
gorilla gorilla]
Length=540

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  320  SSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  379

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  380  GYVVWQEVFDN-KVKIRPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  436

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  437  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  496

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  497  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  528



>ref|XP_005720244.1| PREDICTED: beta-hexosaminidase subunit beta-like isoform X2 [Pundamilia 
nyererei]
Length=546

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 121/214 (57%), Gaps = 12/214 (6%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   +VHLGGDEV+ TCW S P I+K+++ +HF  D ++   +++ +   I  S   
Sbjct  329  STVFPDGYVHLGGDEVDFTCWKSNPDIQKFMEQQHFGDDYRKLESFYIQKLLDIVTSTKK  388

Query  661  EIINWEETFNNFGNKLSRKTVVHNWl---ggglaqqvvaagLRCIVSNQDRWYLDHLD--  497
              + W+E F+N G KL   TVVH W+          V AAG   I+S    WYLD++   
Sbjct  389  GYLIWQEVFDN-GVKLKPDTVVHVWIGGGSDKEMSNVTAAGYTTILSAP--WYLDYISYG  445

Query  496  APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSS  317
              W  +Y  EPL+     + + LV+GGE C+WGE +DA+++   +WPRA+A AERLW++ 
Sbjct  446  QDWQKYYKVEPLNFEGTDEQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSAK  505

Query  316  ENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGS  215
            +    D      RL+  RC + +RG+ A PL  S
Sbjct  506  DV--TDIGDAFNRLSLHRCRMVERGIPAEPLFSS  537



>ref|XP_006753040.1| PREDICTED: beta-hexosaminidase subunit alpha [Myotis davidii]
 gb|ELK38359.1| Beta-hexosaminidase subunit alpha [Myotis davidii]
Length=529

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 117/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+  CW S P ++ ++K + F  D +Q   +++     I  ++  
Sbjct  309  SSVFPDFYLHLGGDEVDFACWKSNPDVQAFMKKKGFGNDFKQLESFYIQTLLDIVSAYDK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W              +  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKVRPDTIIQVWREEVPVSYMKELALITEAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W+ FY  +PL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  426  SYGPDWENFYRVDPLSFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  +  DP+    RLAHFRC L +RGV A PL
Sbjct  486  --SNKVVTDPDFAFKRLAHFRCELLRRGVQAQPL  517



>ref|XP_003449709.1| PREDICTED: beta-hexosaminidase subunit beta-like isoform 1 [Oreochromis 
niloticus]
Length=546

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 123/215 (57%), Gaps = 12/215 (6%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHG  665
             S +F   ++HLGGDEV+ TCW S P I+K+++ +HF  D  +   +++ +   I  S  
Sbjct  328  ISTVFPDGYIHLGGDEVDFTCWKSNPDIQKFMEQQHFGEDYSKLESFYIQKLLDIVASTK  387

Query  664  YEIINWEETFNNFGNKLSRKTVVHNWl---ggglaqqvvaagLRCIVSNQDRWYLDHLD-  497
               + W+E F+N G KL   TVVH W+          V AAG   I+S    WYLD++  
Sbjct  388  KGYLVWQEVFDN-GVKLKPDTVVHVWIGGRSDKEMSNVTAAGYTTILSAP--WYLDYISY  444

Query  496  -APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTS  320
               W  +Y  EPL+     + + LV+GGE C+WGE +DA+++   +WPRA+A AERLW S
Sbjct  445  GQDWQKYYKVEPLNFEGTDEQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLW-S  503

Query  319  SENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGS  215
            ++N+  D +    RL+  RC + +RG+ A PL  S
Sbjct  504  AKNV-TDIDDAFNRLSLHRCRMVERGIPAEPLFSS  537



>ref|XP_007197822.1| PREDICTED: beta-hexosaminidase subunit alpha [Balaenoptera acutorostrata 
scammoni]
Length=529

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 118/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F  D ++   +++     I  ++G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKKGFGEDFKKLESFYIQTLLDIVSAYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   TV+  W            + V +AG R ++S    WYL+H+
Sbjct  369  GYVVWQEVFDN-KVKVQPDTVIQVWREEMPVRYMKEMELVTSAGFRALLSAP--WYLNHI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W   Y  EPL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  426  TYGPDWKKIYVVEPLAFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S     D +    RLAHFRC L +RGV A PL
Sbjct  486  --SNKTVTDLDFAYKRLAHFRCELLRRGVQAQPL  517



>ref|XP_007467925.1| PREDICTED: beta-hexosaminidase subunit alpha, partial [Lipotes 
vexillifer]
Length=450

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 119/214 (56%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F  D ++   +++     I  ++G 
Sbjct  230  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKKGFGEDFKKLESFYIQTLLDIVSAYGK  289

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   TV+  W            + V +AG R ++S    WYL+H+
Sbjct  290  GYVVWQEVFDN-KVKVQPDTVIQVWREEMPVRYMKEMELVTSAGFRALLSAP--WYLNHI  346

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W   Y  EPL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  347  TYGPDWKNIYMVEPLAFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  406

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  +  + +    RLAHFRC L +RGV A PL
Sbjct  407  --SNKMVTNLDFAYKRLAHFRCELLRRGVQAQPL  438



>ref|NP_001192280.1| beta-hexosaminidase subunit alpha precursor [Pongo abelii]
 sp|Q5RC84.1|HEXA_PONAB RecName: Full=Beta-hexosaminidase subunit alpha; AltName: Full=Beta-N-acetylhexosaminidase 
subunit alpha; Short=Hexosaminidase 
subunit A; AltName: Full=N-acetyl-beta-glucosaminidase 
subunit alpha; Flags: Precursor [Pongo abelii]
 emb|CAH90623.1| hypothetical protein [Pongo abelii]
Length=529

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_008323900.1| PREDICTED: beta-hexosaminidase subunit beta isoform X2 [Cynoglossus 
semilaevis]
Length=557

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 125/214 (58%), Gaps = 12/214 (6%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   +VHLGGDEV+ TCW S P ++K+++ + F  D ++   +++ +   I  S   
Sbjct  340  SSVFPDAYVHLGGDEVDFTCWKSNPDVKKFMEQQGFGDDYRKLESFYIQKLLDIVTSKEK  399

Query  661  EIINWEETFNNFGNKLSRKTVVHNWl---ggglaqqvvaagLRCIVSNQDRWYLDHLD--  497
              + W+E F+N G KL   TVVH W+        ++V  AG + I+S    WYLD++   
Sbjct  400  GYMIWQEVFDN-GVKLKPDTVVHVWIGGGANDEMKRVTTAGYKTILSAP--WYLDYISYG  456

Query  496  APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSS  317
              W  +Y  EPL+     + + LV+GGE C+WGE +DA+++   +WPRA+A AERLW S 
Sbjct  457  QDWQRYYKAEPLNFNGTDEQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLW-SD  515

Query  316  ENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGS  215
            +N+ D  +    RL+  RC L +RG+ A PL+ S
Sbjct  516  KNVTDISDAF-NRLSRHRCRLVERGIPAEPLISS  548



>ref|XP_010807183.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X2 [Bos 
taurus]
Length=337

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 117/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F  D ++   +++     I  ++G 
Sbjct  117  STVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKKGFGDDFKKLESFYIQTLLDIVSAYGK  176

Query  661  EIINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W              V  AG R ++S    WYL+H+
Sbjct  177  GYVVWQEVFDN-KVKVRPDTIIQVWREEIPVKYVKELALVTRAGFRALLSAP--WYLNHI  233

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W   Y  EPL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  234  TYGPDWKEIYLVEPLAFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  293

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  +  + +    RLAHFRC L +RGV A PL
Sbjct  294  --SNKMVSNLDFAFKRLAHFRCELLRRGVQAQPL  325



>ref|XP_006796907.1| PREDICTED: beta-hexosaminidase subunit beta-like isoform X2 [Neolamprologus 
brichardi]
Length=546

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 120/215 (56%), Gaps = 12/215 (6%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHG  665
             S +F   +VHLGGDEV+ TCW S P I+K+++ +HF  D ++   +++ +   I  S  
Sbjct  328  ISTVFPDGYVHLGGDEVDFTCWKSNPDIQKFMQQQHFGDDYRKLESFYIQKLLDIVTSTK  387

Query  664  YEIINWEETFNNFGNKLSRKTVVHNWl---ggglaqqvvaagLRCIVSNQDRWYLDHLD-  497
               + W+E F+N G KL   TVVH W+          V AAG   I+S    WYLD++  
Sbjct  388  KGYLIWQEVFDN-GVKLKPDTVVHVWIGGGSDKEMSNVTAAGYTTILSAP--WYLDYISY  444

Query  496  -APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTS  320
               W  +Y  EPL+     + + LV+GGE C+WGE +DA+++   +WPRA+A AERLW++
Sbjct  445  GQDWQKYYKVEPLNFEGTDEQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSA  504

Query  319  SENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGS  215
                  D      RL+  RC + +RG+ A PL  S
Sbjct  505  KSV--TDIGDAFNRLSLHRCRMVERGIPAEPLFSS  537



>ref|NP_001271667.1| uncharacterized protein LOC101925292 precursor [Macaca fascicularis]
 dbj|BAE87202.1| unnamed protein product [Macaca fascicularis]
Length=507

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  287  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  346

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  347  GYVVWQEVFDN-KVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAP--WYLNRI  403

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  404  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  463

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  464  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  495



>ref|XP_005369558.1| PREDICTED: beta-hexosaminidase subunit alpha [Microtus ochrogaster]
Length=528

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 123/225 (55%), Gaps = 15/225 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF-DGQQAYQYFVLQAQKIALSHGYE  659
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F D +Q   +++     I   +   
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWRSNPNIQAFMKKKGFTDFKQLESFYIQTLLDIVSDYDKG  368

Query  658  IINWEETFNNFGNKLSRKTVVHNW------lggglaqqvvaagLRCIVSNQDRWYLDHLD  497
             + W+E F+N   K+   T++  W            +Q+  AG R ++S    WYL+ + 
Sbjct  369  YVVWQEVFDN-KVKVRPDTIIQVWREEVPVEYMKEMEQITKAGFRALLSAP--WYLNRVK  425

Query  496  --APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWT  323
                W   Y  EPL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW+
Sbjct  426  YGPDWKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAIAERLWS  485

Query  322  SSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL-VGSGRGAPEQP  191
            S  NL  D +    RL+HFRC L +RGV A P+ +G      EQP
Sbjct  486  S--NLTTDMDFAFNRLSHFRCELLRRGVQAQPISIGYCEQEFEQP  528



>ref|NP_001248458.1| beta-hexosaminidase subunit alpha precursor [Macaca mulatta]
 ref|XP_011749131.1| PREDICTED: beta-hexosaminidase subunit alpha [Macaca nemestrina]
 dbj|BAE01310.1| unnamed protein product [Macaca fascicularis]
Length=529

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_010363113.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X4 [Rhinopithecus 
roxellana]
Length=529

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWREEVPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_002753354.2| PREDICTED: beta-hexosaminidase subunit alpha [Callithrix jacchus]
Length=597

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 117/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F  D +Q   +++     I  S+G 
Sbjct  377  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMKKKGFGEDFKQLESFYIQTLLDIVSSYGK  436

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  437  GYVVWQEVFDN-KVKVRPDTIIQVWREETPVNYTKELELVTKAGFRALLSAP--WYLNRI  493

Query  499  --DAPWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
              +  W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  494  SYNPDWKEFYLVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  553

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  554  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  585



>ref|XP_011833992.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X2 [Mandrillus 
leucophaeus]
 ref|XP_011947908.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X1 [Cercocebus 
atys]
Length=529

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_003901203.1| PREDICTED: beta-hexosaminidase subunit alpha [Papio anubis]
Length=529

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_011809216.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X2 [Colobus 
angolensis palliatus]
Length=529

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWREEVPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>ref|XP_007548936.1| PREDICTED: beta-hexosaminidase subunit beta isoform X1 [Poecilia 
formosa]
Length=548

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 121/217 (56%), Gaps = 14/217 (6%)
 Frame = -1

Query  838  FSKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHG  665
             S++F   ++HLGGDEV+  CW S P I+K+++ + F  D ++   +++ +   I  +  
Sbjct  328  ISEVFPDAYIHLGGDEVSFACWQSNPDIQKFMEQQGFGKDYRKLESFYIQKLLDIVAATN  387

Query  664  YEIINWEETFNNFGNKLSRKTVVHNW-----lggglaqqvvaagLRCIVSNQDRWYLDHL  500
               I W+E F+N G KL   T++H W            ++ +AG + ++S    WYL+H+
Sbjct  388  KGYIIWQEVFDN-GVKLKPDTLIHIWKGTPAAYQSEMARITSAGFKTLLSAP--WYLNHI  444

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W GFY  +P D     + + LV+GGE CMWGE +DA+++   +WPRA+A AERLW
Sbjct  445  TYGQDWPGFYKADPQDFQGTEEQKKLVIGGEACMWGEYVDATNLTPRLWPRASAVAERLW  504

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGS  215
            ++ E    D      RL+  RC L +RG+ A PL  S
Sbjct  505  SAKEV--TDTGDAFSRLSLHRCRLVERGIPAEPLTPS  539



>ref|XP_010363112.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X3 [Rhinopithecus 
roxellana]
Length=540

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  320  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  379

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  380  GYVVWQEVFDN-KVKIRPDTIIQVWREEVPVNYMKELELVTKAGFRALLSAP--WYLNRI  436

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  437  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  496

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  497  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  528



>ref|XP_008293712.1| PREDICTED: beta-hexosaminidase subunit beta isoform X2 [Stegastes 
partitus]
Length=544

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 120/214 (56%), Gaps = 12/214 (6%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   +VHLGGDEV+ TCW S P I++++  + F  D  +   +++ +   I  +   
Sbjct  327  STVFPDGYVHLGGDEVDFTCWKSNPDIQRFMDAQGFGQDYSKLESFYIQKLLDIVTTTKK  386

Query  661  EIINWEETFNNFGNKLSRKTVVHNWl---ggglaqqvvaagLRCIVSNQDRWYLDHLDAP  491
              + W+E F+N G KL   TVVH W+         +V AAG   I+S    WYLD++   
Sbjct  387  GYMIWQEVFDN-GVKLKPDTVVHVWIGGGSNEEMGKVTAAGYTTILSAP--WYLDYISYA  443

Query  490  --WDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLWTSS  317
              W  +Y  EPL+     K +ALV+GGE C+WGE +DA+++   +WPRA+A  ERLW+S 
Sbjct  444  QDWQKYYKVEPLNFNGTEKQKALVIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSK  503

Query  316  ENLPDDPNKVAGRLAHFRCLLNQRGVAAAPLVGS  215
            +    D N    RL+  RC + +RG+ A PL  S
Sbjct  504  DVT--DINDAFNRLSAHRCRMVERGIPAEPLFSS  535



>ref|XP_004276318.1| PREDICTED: LOW QUALITY PROTEIN: beta-hexosaminidase subunit alpha 
[Orcinus orca]
Length=532

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 119/214 (56%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ ++K + F  D ++   +++     I  ++G 
Sbjct  312  SSVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKKGFGEDFKKLESFYIQTLLDIVSAYGK  371

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlggg------laqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   TV+  W            + V +AG R ++S    WYL+H+
Sbjct  372  GYVVWQEVFDN-KVKVQPDTVIQVWREKMPVRYTKEMELVTSAGFRALLSAP--WYLNHI  428

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W   Y  EPL     P+ +ALV+GGE CMWGE +D++++   +WPRA A AERLW
Sbjct  429  TYGPDWKNIYMVEPLAFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLW  488

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  +  + +    RLAHFRC L +RGV A PL
Sbjct  489  --SNKMLTNLDFAYKRLAHFRCELLRRGVQAQPL  520



>ref|XP_008014190.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X5 [Chlorocebus 
sabaeus]
Length=529

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  309  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  368

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  369  GYVVWQEVFDN-KVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAP--WYLNRI  425

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  426  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  485

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  486  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  517



>gb|EHH27459.1| hypothetical protein EGK_17654 [Macaca mulatta]
 gb|EHH63193.1| hypothetical protein EGM_16108 [Macaca fascicularis]
Length=540

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  320  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  379

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  380  GYVVWQEVFDN-KVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAP--WYLNRI  436

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  437  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  496

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  497  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  528



>ref|XP_011833991.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X1 [Mandrillus 
leucophaeus]
Length=540

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  320  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  379

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  380  GYVVWQEVFDN-KVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAP--WYLNRI  436

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  437  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  496

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  497  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  528



>ref|XP_011809215.1| PREDICTED: beta-hexosaminidase subunit alpha isoform X1 [Colobus 
angolensis palliatus]
Length=540

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 116/214 (54%), Gaps = 15/214 (7%)
 Frame = -1

Query  835  SKIFKYKFVHLGGDEVNTTCWTSTPRIEKWLKTRHF--DGQQAYQYFVLQAQKIALSHGY  662
            S +F   ++HLGGDEV+ TCW S P I+ +++ + F  D +Q   +++     I  S+G 
Sbjct  320  SSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGK  379

Query  661  EIINWEETFNNFGNKLSRKTVVHNWlg------gglaqqvvaagLRCIVSNQDRWYLDHL  500
              + W+E F+N   K+   T++  W            + V  AG R ++S    WYL+ +
Sbjct  380  GYVVWQEVFDN-KVKIRPDTIIQVWREEVPVNYMKELELVTKAGFRALLSAP--WYLNRI  436

Query  499  D--APWDGFYSNEPLDNITDPKHQALVLGGEVCMWGENIDASDIEQTIWPRAAAAAERLW  326
                 W  FY  EPL     P+ +ALV+GGE CMWGE +D +++   +WPRA A AERLW
Sbjct  437  SYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLW  496

Query  325  TSSENLPDDPNKVAGRLAHFRCLLNQRGVAAAPL  224
              S  L  D      RL+HFRC L +RGV A PL
Sbjct  497  --SNKLTSDLTFAYERLSHFRCELLRRGVQAQPL  528



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1798831613323