BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5543

Length=971
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    242   2e-72   Nicotiana sylvestris
ref|XP_009619497.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    239   2e-71   Nicotiana tomentosiformis
ref|XP_011083199.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      235   1e-69   Sesamum indicum [beniseed]
ref|XP_007046870.1|  Glycosyl hydrolase superfamily protein isofo...    233   7e-69   
ref|XP_012092731.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      232   2e-68   Jatropha curcas
ref|XP_004232427.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      231   2e-68   Solanum lycopersicum
ref|XP_006340651.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    231   2e-68   Solanum tuberosum [potatoes]
ref|XP_010113415.1|  Mannan endo-1,4-beta-mannosidase 7                 231   4e-68   Morus notabilis
ref|XP_008440745.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      227   5e-67   Cucumis melo [Oriental melon]
gb|ACN78662.1|  endo-beta-mannanase                                     226   2e-66   Actinidia arguta
ref|XP_008241714.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      226   3e-66   Prunus mume [ume]
gb|ABV32548.1|  endo-1,4-beta-mannosidase protein 2                     224   9e-66   Prunus persica
ref|XP_007202078.1|  hypothetical protein PRUPE_ppa005992mg             224   1e-65   Prunus persica
gb|ABY58035.1|  mannase                                                 224   1e-65   Prunus salicina [Japanese plum]
ref|XP_009347596.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    222   1e-64   
gb|ABD47729.1|  (1-4)-beta-mannan endohydrolase                         214   4e-64   Eucalyptus globulus subsp. globulus
ref|XP_011025835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      220   6e-64   Populus euphratica
ref|XP_011015126.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    219   2e-63   Populus euphratica
ref|XP_006383170.1|  (1-4)-beta-mannan endohydrolase family protein     218   3e-63   Populus trichocarpa [western balsam poplar]
emb|CAN70632.1|  hypothetical protein VITISV_020726                     212   3e-63   Vitis vinifera
ref|XP_006425633.1|  hypothetical protein CICLE_v10025631mg             218   3e-63   
ref|XP_002310816.2|  hypothetical protein POPTR_0007s13190g             218   4e-63   
ref|XP_011011941.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    218   4e-63   Populus euphratica
ref|XP_011013722.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    218   4e-63   Populus euphratica
ref|XP_006466833.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    216   1e-62   Citrus sinensis [apfelsine]
gb|KDO70993.1|  hypothetical protein CISIN_1g013811mg                   216   1e-62   Citrus sinensis [apfelsine]
ref|XP_009340713.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      216   2e-62   Pyrus x bretschneideri [bai li]
gb|ERM94646.1|  hypothetical protein AMTR_s00011p00202020               215   2e-62   Amborella trichopoda
ref|XP_008797528.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    215   3e-62   
ref|XP_004512071.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    215   3e-62   Cicer arietinum [garbanzo]
ref|XP_011623587.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      215   4e-62   Amborella trichopoda
ref|XP_010029765.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      214   6e-62   Eucalyptus grandis [rose gum]
ref|XP_008338221.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    214   1e-61   
ref|XP_003612065.1|  Mannan endo-1,4-beta-mannosidase                   213   3e-61   Medicago truncatula
ref|XP_010263608.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    213   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_002264115.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      212   4e-61   Vitis vinifera
ref|XP_010254774.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    211   9e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010926118.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      211   1e-60   Elaeis guineensis
gb|KHG22102.1|  Mannan endo-1,4-beta-mannosidase 7 -like protein        211   2e-60   Gossypium arboreum [tree cotton]
ref|XP_010924296.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    207   4e-60   
ref|XP_008800703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    209   9e-60   Phoenix dactylifera
ref|XP_004143522.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      208   2e-59   Cucumis sativus [cucumbers]
emb|CDP01989.1|  unnamed protein product                                207   4e-59   Coffea canephora [robusta coffee]
ref|XP_002281804.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      207   4e-59   Vitis vinifera
ref|XP_010924295.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    207   4e-59   Elaeis guineensis
gb|KJB43465.1|  hypothetical protein B456_007G201600                    213   3e-58   Gossypium raimondii
ref|XP_008338066.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    204   4e-58   
ref|XP_010679767.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      204   5e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009394803.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    202   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004238284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    201   4e-57   Solanum lycopersicum
gb|ABF69949.1|  (1-4)-beta-mannan endohydrolase (mannan endo-1,4-...    201   6e-57   Musa acuminata [banana]
ref|XP_007017589.1|  Glycosyl hydrolase superfamily protein             200   2e-56   Theobroma cacao [chocolate]
ref|XP_006342222.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    197   9e-56   Solanum tuberosum [potatoes]
ref|NP_201447.1|  mannan endo-1,4-beta-mannosidase 7                    197   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865067.1|  predicted protein                                  197   3e-55   Arabidopsis lyrata subsp. lyrata
gb|ACU18982.1|  unknown                                                 197   3e-55   Glycine max [soybeans]
ref|XP_003517214.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    197   4e-55   Glycine max [soybeans]
gb|KHN36084.1|  Mannan endo-1,4-beta-mannosidase 7                      196   8e-55   Glycine soja [wild soybean]
ref|XP_006841534.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      196   8e-55   Amborella trichopoda
ref|XP_006279868.1|  hypothetical protein CARUB_v10028560mg             195   1e-54   Capsella rubella
ref|XP_009416732.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    195   2e-54   
gb|KFK28321.1|  hypothetical protein AALP_AA8G500900                    194   2e-54   Arabis alpina [alpine rockcress]
ref|XP_006841527.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      194   3e-54   Amborella trichopoda
gb|AGG82699.1|  endo-1,4-beta-mannosidase                               193   5e-54   Morus alba var. multicaulis
gb|ABV32547.1|  endo-1,4-beta-mannosidase protein 1                     194   5e-54   Prunus persica
ref|XP_007222385.1|  hypothetical protein PRUPE_ppa006029mg             194   5e-54   Prunus persica
ref|XP_009785219.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    193   6e-54   Nicotiana sylvestris
gb|AFY10517.1|  endo-beta-1,4-mannanase                                 189   7e-54   Sisymbrium officinale
ref|XP_006393839.1|  hypothetical protein EUTSA_v10004263mg             193   8e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010484638.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    192   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008220834.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    192   3e-53   Prunus mume [ume]
gb|EEC71222.1|  hypothetical protein OsI_03157                          191   3e-53   Oryza sativa Indica Group [Indian rice]
sp|Q0JKM9.2|MAN1_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    191   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009602297.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    191   4e-53   Nicotiana tomentosiformis
ref|XP_010110051.1|  Mannan endo-1,4-beta-mannosidase 7                 190   7e-53   Morus notabilis
emb|CDX81394.1|  BnaC09g08050D                                          197   9e-53   
ref|XP_010444793.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      189   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010061294.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   3e-52   Eucalyptus grandis [rose gum]
gb|KDP38537.1|  hypothetical protein JCGZ_04462                         189   4e-52   Jatropha curcas
ref|NP_001280873.1|  mannan endo-1,4-beta-mannosidase 7-like prec...    188   5e-52   Malus domestica [apple tree]
ref|XP_009365114.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    188   6e-52   Pyrus x bretschneideri [bai li]
ref|XP_009336054.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    188   7e-52   Pyrus x bretschneideri [bai li]
gb|ADN34185.1|  endo-beta-mannanase                                     187   9e-52   Cucumis melo subsp. melo
gb|KCW68225.1|  hypothetical protein EUGRSUZ_F01879                     188   1e-51   Eucalyptus grandis [rose gum]
ref|XP_004147857.2|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      187   1e-51   Cucumis sativus [cucumbers]
gb|ACN78666.1|  endo-beta-mannanase                                     187   2e-51   Vaccinium corymbosum [American blueberry]
ref|XP_006435034.1|  hypothetical protein CICLE_v10001262mg             187   2e-51   Citrus clementina [clementine]
ref|XP_009112304.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    187   2e-51   Brassica rapa
gb|KEH36174.1|  mannan endo-1,4-beta-mannosidase-like protein           186   2e-51   Medicago truncatula
ref|XP_009365529.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    186   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_009406291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    186   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008466539.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    187   4e-51   
ref|XP_002510418.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    186   4e-51   Ricinus communis
emb|CDY18606.1|  BnaA09g07890D                                          193   4e-51   Brassica napus [oilseed rape]
ref|XP_010465469.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    186   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009103527.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      186   5e-51   Brassica rapa
ref|XP_006644473.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    185   9e-51   
emb|CDP07490.1|  unnamed protein product                                185   9e-51   Coffea canephora [robusta coffee]
ref|XP_010550422.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      184   1e-50   Tarenaya hassleriana [spider flower]
gb|KJB58235.1|  hypothetical protein B456_009G200500                    184   1e-50   Gossypium raimondii
ref|XP_009395690.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    184   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004291857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    184   2e-50   Fragaria vesca subsp. vesca
ref|XP_006590697.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    182   3e-50   Glycine max [soybeans]
emb|CDY68324.1|  BnaCnng58510D                                          188   4e-50   Brassica napus [oilseed rape]
gb|ACN78663.1|  endo-beta-mannanase                                     183   4e-50   Malus domestica [apple tree]
emb|CDY45231.1|  BnaA07g12590D                                          184   6e-50   Brassica napus [oilseed rape]
ref|XP_006473535.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    182   7e-50   Citrus sinensis [apfelsine]
ref|XP_003537602.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    181   2e-49   Glycine max [soybeans]
ref|XP_006590696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    181   2e-49   Glycine max [soybeans]
gb|KDO84614.1|  hypothetical protein CISIN_1g014426mg                   179   1e-48   Citrus sinensis [apfelsine]
ref|XP_003528027.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    179   2e-48   Glycine max [soybeans]
ref|XP_009407087.1|  PREDICTED: putative mannan endo-1,4-beta-man...    178   2e-48   
ref|NP_001241893.1|  uncharacterized protein LOC100814337 precursor     177   4e-48   Glycine max [soybeans]
gb|KHN45867.1|  Mannan endo-1,4-beta-mannosidase 7                      177   5e-48   Glycine soja [wild soybean]
ref|XP_007156980.1|  hypothetical protein PHAVU_002G033500g             177   1e-47   Phaseolus vulgaris [French bean]
gb|ACL52784.1|  unknown                                                 171   2e-47   Zea mays [maize]
ref|XP_007136624.1|  hypothetical protein PHAVU_009G059700g             176   3e-47   Phaseolus vulgaris [French bean]
ref|XP_003569504.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      174   8e-47   Brachypodium distachyon [annual false brome]
ref|XP_002306881.1|  hypothetical protein POPTR_0005s25120g             173   2e-46   
gb|ACN33740.1|  unknown                                                 170   2e-46   Zea mays [maize]
ref|XP_011083658.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   2e-46   Sesamum indicum [beniseed]
ref|NP_001145882.1|  uncharacterized protein LOC100279398 precursor     171   2e-45   Zea mays [maize]
ref|XP_002456093.1|  hypothetical protein SORBIDRAFT_03g030340          171   2e-45   Sorghum bicolor [broomcorn]
tpg|DAA58240.1|  TPA: putative endo-1,4-beta-mannosidase family p...    171   2e-45   
dbj|BAJ87939.1|  predicted protein                                      168   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003545272.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    168   2e-44   Glycine max [soybeans]
ref|XP_010911335.1|  PREDICTED: putative mannan endo-1,4-beta-man...    161   5e-43   Elaeis guineensis
ref|XP_010418656.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    157   9e-43   Camelina sativa [gold-of-pleasure]
gb|KHN20963.1|  Mannan endo-1,4-beta-mannosidase 7                      163   1e-42   Glycine soja [wild soybean]
gb|KHN12693.1|  Mannan endo-1,4-beta-mannosidase 7                      161   4e-42   Glycine soja [wild soybean]
ref|XP_010490700.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    156   6e-42   
ref|XP_003549439.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    161   6e-42   Glycine max [soybeans]
ref|XP_010911765.1|  PREDICTED: putative mannan endo-1,4-beta-man...    157   2e-41   Elaeis guineensis
ref|XP_010673216.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   3e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS69785.1|  endo-beta-mannanase                                     160   7e-41   Genlisea aurea
ref|XP_008799989.1|  PREDICTED: putative mannan endo-1,4-beta-man...    158   8e-41   
ref|XP_008804040.1|  PREDICTED: putative mannan endo-1,4-beta-man...    157   2e-40   Phoenix dactylifera
ref|XP_004495835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    156   3e-40   Cicer arietinum [garbanzo]
ref|XP_010914840.1|  PREDICTED: putative mannan endo-1,4-beta-man...    157   3e-40   Elaeis guineensis
dbj|BAD17132.1|  putative (1-4)-beta-mannan endohydrolase               156   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048226.2|  Os02g0766900                                       156   3e-40   
ref|XP_006444660.1|  hypothetical protein CICLE_v10020376mg             156   4e-40   Citrus clementina [clementine]
ref|XP_012083050.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   6e-40   Jatropha curcas
ref|XP_010490914.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   6e-40   
ref|XP_010490985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006491440.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   6e-40   Citrus sinensis [apfelsine]
ref|XP_010490811.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_007160733.1|  hypothetical protein PHAVU_001G012600g             155   1e-39   Phaseolus vulgaris [French bean]
ref|XP_010246810.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006386209.1|  hypothetical protein POPTR_0002s03490g             151   1e-39   
ref|XP_008799988.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    154   2e-39   
gb|KHN46504.1|  Mannan endo-1,4-beta-mannosidase 5                      152   2e-39   Glycine soja [wild soybean]
ref|XP_006836841.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      154   2e-39   Amborella trichopoda
ref|XP_010486712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    154   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010464779.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    154   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003591288.1|  Mannan endo-1,4-beta-mannosidase                   153   4e-39   Medicago truncatula
ref|XP_006300225.1|  hypothetical protein CARUB_v10016461mg             154   4e-39   
gb|KJB41765.1|  hypothetical protein B456_007G119100                    152   5e-39   Gossypium raimondii
ref|XP_010943133.1|  PREDICTED: putative mannan endo-1,4-beta-man...    153   6e-39   
ref|XP_003540598.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   7e-39   Glycine max [soybeans]
ref|XP_004969435.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   9e-39   Setaria italica
ref|XP_002454605.1|  hypothetical protein SORBIDRAFT_04g034200          152   9e-39   
ref|XP_010035363.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   1e-38   Eucalyptus grandis [rose gum]
ref|XP_002515142.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    152   1e-38   Ricinus communis
ref|XP_010914857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   1e-38   
gb|KJB41764.1|  hypothetical protein B456_007G119100                    152   1e-38   Gossypium raimondii
gb|KHG12601.1|  Mannan endo-1,4-beta-mannosidase 4                      152   1e-38   Gossypium arboreum [tree cotton]
ref|XP_006407494.1|  hypothetical protein EUTSA_v10020842mg             152   1e-38   Eutrema salsugineum [saltwater cress]
gb|KJB41766.1|  hypothetical protein B456_007G119100                    152   2e-38   Gossypium raimondii
ref|XP_006356570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    151   3e-38   Solanum tuberosum [potatoes]
gb|KCW46726.1|  hypothetical protein EUGRSUZ_K00548                     150   4e-38   Eucalyptus grandis [rose gum]
ref|XP_007051341.1|  Glycosyl hydrolase superfamily protein isofo...    150   4e-38   Theobroma cacao [chocolate]
ref|XP_003591290.1|  Mannan endo-1,4-beta-mannosidase                   151   5e-38   
ref|XP_010038519.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    150   6e-38   Eucalyptus grandis [rose gum]
ref|XP_008800333.1|  PREDICTED: putative mannan endo-1,4-beta-man...    150   6e-38   Phoenix dactylifera
ref|XP_006649074.1|  PREDICTED: putative mannan endo-1,4-beta-man...    150   7e-38   
ref|XP_010112044.1|  Mannan endo-1,4-beta-mannosidase 5                 149   9e-38   Morus notabilis
gb|KDO37208.1|  hypothetical protein CISIN_1g048104mg                   147   1e-37   Citrus sinensis [apfelsine]
gb|KFK38477.1|  hypothetical protein AALP_AA3G118100                    149   1e-37   Arabis alpina [alpine rockcress]
ref|XP_011007449.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   1e-37   Populus euphratica
ref|XP_004303778.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   2e-37   Fragaria vesca subsp. vesca
ref|NP_187700.1|  mannan endo-1,4-beta-mannosidase 3                    149   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006588317.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   2e-37   Glycine max [soybeans]
ref|XP_008805818.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    148   2e-37   
gb|ACG41070.1|  1,4-beta-D-mannan endohydrolase precursor               148   2e-37   Zea mays [maize]
ref|XP_009785223.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   3e-37   Nicotiana sylvestris
gb|AFK43830.1|  unknown                                                 147   5e-37   Lotus japonicus
ref|XP_009763332.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   5e-37   Nicotiana sylvestris
ref|XP_007216338.1|  hypothetical protein PRUPE_ppa020168mg             147   5e-37   
ref|XP_008664308.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    147   5e-37   
ref|XP_006356569.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   7e-37   Solanum tuberosum [potatoes]
ref|XP_008245064.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   7e-37   Prunus mume [ume]
ref|XP_009785881.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      147   8e-37   Nicotiana sylvestris
ref|XP_006478472.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   9e-37   
gb|AAN34823.1|  endo-beta-mannanase                                     147   1e-36   Daucus carota [carrots]
ref|XP_009616057.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      146   1e-36   Nicotiana tomentosiformis
ref|XP_002884818.1|  predicted protein                                  146   1e-36   Arabidopsis lyrata subsp. lyrata
gb|KEH43148.1|  mannan endo-1,4-beta-mannosidase-like protein           146   2e-36   Medicago truncatula
ref|XP_008805817.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   2e-36   
ref|XP_010911540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   3e-36   Elaeis guineensis
ref|XP_003573047.1|  PREDICTED: putative mannan endo-1,4-beta-man...    145   3e-36   Brachypodium distachyon [annual false brome]
ref|XP_011085841.1|  PREDICTED: putative mannan endo-1,4-beta-man...    145   3e-36   Sesamum indicum [beniseed]
gb|ABC87082.1|  1,4-beta-D-mannan endohydrolase precursor               145   3e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006441716.1|  hypothetical protein CICLE_v10023981mg             145   4e-36   
emb|CDP11090.1|  unnamed protein product                                145   4e-36   Coffea canephora [robusta coffee]
emb|CDP20988.1|  unnamed protein product                                145   4e-36   Coffea canephora [robusta coffee]
gb|KEH17608.1|  mannan endo-1,4-beta-mannosidase-like protein           143   4e-36   Medicago truncatula
gb|KHN43366.1|  Mannan endo-1,4-beta-mannosidase 1                      144   5e-36   Glycine soja [wild soybean]
gb|KEH43147.1|  mannan endo-1,4-beta-mannosidase-like protein           144   6e-36   Medicago truncatula
ref|XP_011025293.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   7e-36   Populus euphratica
ref|XP_009601553.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   9e-36   Nicotiana tomentosiformis
ref|XP_009616037.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   1e-35   Nicotiana tomentosiformis
ref|XP_003626162.1|  Mannan endo-1,4-beta-mannosidase                   144   1e-35   Medicago truncatula
ref|XP_002302695.1|  hypothetical protein POPTR_0002s18530g             144   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009785847.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   1e-35   Nicotiana sylvestris
ref|XP_010689012.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001234473.1|  Mannan endo-1,4-beta-mannosidase 2 precursor       143   2e-35   Solanum lycopersicum
emb|CDP21695.1|  unnamed protein product                                143   2e-35   Coffea canephora [robusta coffee]
ref|XP_006356528.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    143   2e-35   Solanum tuberosum [potatoes]
ref|XP_003605853.1|  Mannan endo-1,4-beta-mannosidase                   143   2e-35   Medicago truncatula
gb|EYU45795.1|  hypothetical protein MIMGU_mgv1a0212342mg               137   3e-35   Erythranthe guttata [common monkey flower]
ref|XP_002983364.1|  hypothetical protein SELMODRAFT_234217             142   3e-35   
gb|KHN14221.1|  Mannan endo-1,4-beta-mannosidase 1                      142   3e-35   Glycine soja [wild soybean]
ref|XP_003521650.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   3e-35   Glycine max [soybeans]
emb|CAC51690.3|  endo-beta-1,4-mannanase                                142   4e-35   Lactuca sativa [cultivated lettuce]
ref|XP_008372937.1|  PREDICTED: putative mannan endo-1,4-beta-man...    140   4e-35   
ref|XP_002960673.1|  hypothetical protein SELMODRAFT_403117             142   5e-35   
ref|XP_003634618.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    142   5e-35   
ref|XP_006296763.1|  hypothetical protein CARUB_v10015594mg             142   6e-35   Capsella rubella
emb|CDP20125.1|  unnamed protein product                                142   6e-35   Coffea canephora [robusta coffee]
emb|CAC08208.1|  (1-4)-beta-mannan endohydrolase                        142   6e-35   Coffea arabica [arabica coffee]
ref|XP_002272344.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      142   6e-35   
ref|XP_008778491.1|  PREDICTED: putative mannan endo-1,4-beta-man...    142   7e-35   
ref|XP_008778492.1|  PREDICTED: putative mannan endo-1,4-beta-man...    142   7e-35   
gb|KHN43394.1|  Mannan endo-1,4-beta-mannosidase 4                      140   7e-35   Glycine soja [wild soybean]
ref|XP_009789472.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   7e-35   Nicotiana sylvestris
gb|EYU22710.1|  hypothetical protein MIMGU_mgv1a023976mg                141   8e-35   Erythranthe guttata [common monkey flower]
dbj|BAK05001.1|  predicted protein                                      141   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004955228.1|  PREDICTED: putative mannan endo-1,4-beta-man...    141   1e-34   Setaria italica
ref|XP_009593808.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   1e-34   Nicotiana tomentosiformis
gb|EMT21291.1|  Putative mannan endo-1,4-beta-mannosidase 9             141   1e-34   
gb|KCW46727.1|  hypothetical protein EUGRSUZ_K00550                     140   1e-34   Eucalyptus grandis [rose gum]
emb|CBI17044.3|  unnamed protein product                                141   2e-34   Vitis vinifera
ref|XP_002884819.1|  hypothetical protein ARALYDRAFT_478424             140   2e-34   
ref|XP_009760858.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      140   2e-34   Nicotiana sylvestris
ref|XP_010038521.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   2e-34   Eucalyptus grandis [rose gum]
ref|XP_003554587.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   2e-34   Glycine max [soybeans]
ref|XP_009789471.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   2e-34   Nicotiana sylvestris
emb|CDP19235.1|  unnamed protein product                                140   2e-34   Coffea canephora [robusta coffee]
emb|CAC08442.1|  (1-4)-beta-mannan endohydrolase                        140   2e-34   Coffea arabica [arabica coffee]
gb|EYU45779.1|  hypothetical protein MIMGU_mgv1a020287mg                139   3e-34   Erythranthe guttata [common monkey flower]
ref|XP_009122559.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   4e-34   Brassica rapa
ref|XP_007163264.1|  hypothetical protein PHAVU_001G219800g             139   4e-34   Phaseolus vulgaris [French bean]
ref|XP_009779875.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   7e-34   Nicotiana sylvestris
gb|KHN12618.1|  Mannan endo-1,4-beta-mannosidase 4                      137   8e-34   Glycine soja [wild soybean]
ref|XP_007163300.1|  hypothetical protein PHAVU_001G223100g             138   1e-33   Phaseolus vulgaris [French bean]
ref|XP_002272567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      138   1e-33   Vitis vinifera
gb|KHN14185.1|  Putative mannan endo-1,4-beta-mannosidase 9             138   1e-33   Glycine soja [wild soybean]
ref|XP_002269954.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      138   1e-33   
gb|KHN42134.1|  Mannan endo-1,4-beta-mannosidase 6                      138   1e-33   Glycine soja [wild soybean]
ref|NP_001235608.1|  endo-1,4-beta-mannanase precursor                  138   1e-33   Glycine max [soybeans]
ref|XP_006576282.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   2e-33   Glycine max [soybeans]
ref|XP_003522088.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   2e-33   Glycine max [soybeans]
ref|XP_011090525.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   2e-33   Sesamum indicum [beniseed]
emb|CBI17039.3|  unnamed protein product                                138   2e-33   Vitis vinifera
ref|XP_006576280.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   2e-33   Glycine max [soybeans]
ref|XP_006576281.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   2e-33   Glycine max [soybeans]
ref|XP_009135138.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   3e-33   
ref|XP_009135139.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   3e-33   Brassica rapa
gb|EYU45780.1|  hypothetical protein MIMGU_mgv1a025011mg                137   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_003548330.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   3e-33   
ref|XP_009621242.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   3e-33   Nicotiana tomentosiformis
ref|XP_006599739.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   4e-33   Glycine max [soybeans]
emb|CAN71995.1|  hypothetical protein VITISV_023484                     137   4e-33   Vitis vinifera
ref|XP_007134569.1|  hypothetical protein PHAVU_010G058300g             137   4e-33   Phaseolus vulgaris [French bean]
ref|XP_007134568.1|  hypothetical protein PHAVU_010G058300g             137   5e-33   Phaseolus vulgaris [French bean]
ref|XP_011069567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    136   6e-33   Sesamum indicum [beniseed]
ref|XP_008380803.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   8e-33   
ref|XP_002270023.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      135   1e-32   Vitis vinifera
ref|XP_009391931.1|  PREDICTED: putative mannan endo-1,4-beta-man...    136   1e-32   
ref|XP_010683461.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      135   1e-32   
gb|AHA84179.1|  endo-1,4-beta-mannanase                                 135   1e-32   
ref|XP_010064850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   3e-32   
ref|XP_011468408.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    134   3e-32   
gb|KEH23290.1|  mannan endo-1,4-beta-mannosidase-like protein           134   4e-32   
ref|XP_004492573.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   6e-32   
ref|XP_009119647.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      134   6e-32   
gb|AET01118.2|  mannan endo-1,4-beta-mannosidase-like protein           134   6e-32   
gb|KEH17803.1|  mannan endo-1,4-beta-mannosidase-like protein           134   6e-32   
ref|XP_003626672.1|  Mannan endo-1,4-beta-mannosidase                   134   6e-32   
ref|XP_003626642.1|  Mannan endo-1,4-beta-mannosidase                   134   6e-32   
gb|KHN29491.1|  Mannan endo-1,4-beta-mannosidase 6                      134   7e-32   
gb|AET01148.2|  mannan endo-1,4-beta-mannosidase-like protein           134   8e-32   
ref|XP_003534636.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   8e-32   
ref|XP_006418357.1|  hypothetical protein EUTSA_v10007769mg             132   1e-31   
gb|KDO45466.1|  hypothetical protein CISIN_1g016140mg                   132   2e-31   
gb|AES61540.2|  mannan endo-1,4-beta-mannosidase-like protein           132   2e-31   
ref|XP_012088283.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   2e-31   
emb|CDX89985.1|  BnaA10g00970D                                          132   2e-31   
ref|XP_012088282.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   2e-31   
ref|XP_011001681.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   2e-31   
ref|XP_009614144.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   2e-31   
ref|XP_009774303.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   2e-31   
ref|XP_009614143.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   3e-31   
ref|XP_009774302.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   3e-31   
ref|XP_009774301.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   3e-31   
ref|XP_010522867.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   3e-31   
ref|XP_007140064.1|  hypothetical protein PHAVU_008G081200g             132   3e-31   
gb|AFX59322.1|  endo-1,4-beta-mannanase                                 132   3e-31   
ref|XP_002323680.2|  hypothetical protein POPTR_0016s14550g             132   3e-31   
ref|XP_012091033.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      132   3e-31   
ref|XP_002521547.1|  serine-threonine protein kinase, plant-type,...    134   4e-31   
gb|KCW46728.1|  hypothetical protein EUGRSUZ_K00551                     131   4e-31   
ref|XP_006859039.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      131   4e-31   
ref|XP_009614142.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   5e-31   
pdb|1RH9|A  Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopers...    130   5e-31   
ref|XP_004510098.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    133   5e-31   
ref|NP_001234131.1|  mannan endo-1,4-beta-mannosidase 4 precursor       130   6e-31   
ref|XP_011018989.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   6e-31   
ref|XP_011018985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   6e-31   
ref|XP_011018983.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   6e-31   
ref|XP_010522866.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   6e-31   
ref|XP_011018984.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   6e-31   
gb|KGN52652.1|  hypothetical protein Csa_5G648730                       126   7e-31   
ref|XP_010522865.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   7e-31   
ref|XP_011018982.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   7e-31   
ref|XP_011018981.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   7e-31   
ref|XP_006304532.1|  hypothetical protein CARUB_v10011405mg             130   1e-30   
ref|XP_002309191.2|  hypothetical protein POPTR_0006s11040g             130   1e-30   
ref|XP_008459570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   1e-30   
emb|CDY15229.1|  BnaC05g01080D                                          130   1e-30   
ref|XP_003552321.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   1e-30   
ref|XP_004494942.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   1e-30   
gb|KEH23282.1|  mannan endo-1,4-beta-mannosidase                        130   2e-30   
gb|KEH23283.1|  mannan endo-1,4-beta-mannosidase                        130   2e-30   
dbj|BAM05595.1|  (1-4)-beta-mannan endohydrolase                        125   2e-30   
ref|NP_001234575.1|  mannan endo-1,4-beta-mannosidase 1 precursor       129   2e-30   
gb|ABD47730.1|  (1-4)-beta-mannan endohydrolase                         125   2e-30   
ref|XP_011037345.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   2e-30   
ref|XP_003591289.1|  NADH dehydrogenase subunit F                       130   2e-30   
ref|XP_011095154.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   2e-30   
ref|NP_001234114.1|  mannan endo-1,4-beta-mannosidase precursor         129   2e-30   
ref|NP_187701.1|  putative mannan endo-1,4-beta-mannosidase 4           129   2e-30   
ref|XP_003553696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   2e-30   
gb|ACU19893.1|  unknown                                                 129   2e-30   
ref|XP_010474643.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-30   
ref|XP_006841495.2|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      129   3e-30   
ref|XP_011095155.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-30   
ref|XP_010457203.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   4e-30   
ref|XP_004228885.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   4e-30   
ref|XP_010480869.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      128   4e-30   
ref|XP_010313893.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    128   4e-30   
ref|XP_011100262.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   4e-30   
ref|NP_001043785.1|  Os01g0663300                                       128   4e-30   
gb|ABK95966.1|  unknown                                                 128   4e-30   
tpg|DAA52303.1|  TPA: putative endo-1,4-beta-mannosidase family p...    125   5e-30   
ref|XP_006376482.1|  glycosyl hydrolase family 5 family protein         128   5e-30   
gb|KHG08771.1|  Mannan endo-1,4-beta-mannosidase 6 -like protein        128   5e-30   
ref|XP_004249033.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   5e-30   
ref|XP_010327704.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   6e-30   
gb|KJB71480.1|  hypothetical protein B456_011G124800                    128   7e-30   
ref|XP_006644697.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   8e-30   
ref|XP_007033492.1|  Mannan endo-1,4-beta-mannosidase 6 isoform 1       128   8e-30   
ref|XP_006362338.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   8e-30   
ref|XP_010327703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   8e-30   
ref|NP_001234874.1|  inactive endo-beta-mannanase precursor             127   9e-30   
ref|XP_002273230.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   9e-30   
ref|NP_171733.2|  mannan endo-1,4-beta-mannosidase 1                    127   1e-29   
ref|XP_008229003.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   1e-29   
gb|EYU22711.1|  hypothetical protein MIMGU_mgv1a025294mg                127   1e-29   
ref|XP_009405187.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   1e-29   
dbj|BAM05593.1|  (1-4)-beta-mannan endohydrolase                        123   1e-29   
emb|CBI18021.3|  unnamed protein product                                126   1e-29   
gb|EYU42035.1|  hypothetical protein MIMGU_mgv1a005847mg                126   2e-29   
gb|EYU42036.1|  hypothetical protein MIMGU_mgv1a005847mg                126   2e-29   
ref|XP_006300114.1|  hypothetical protein CARUB_v10016343mg             126   2e-29   
sp|Q9FUQ6.1|MAN3_SOLLC  RecName: Full=Mannan endo-1,4-beta-mannos...    126   2e-29   
emb|CDP20827.1|  unnamed protein product                                124   2e-29   
ref|NP_001044230.2|  Os01g0746700                                       126   3e-29   
ref|XP_010272456.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    126   3e-29   
ref|XP_009631900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    126   3e-29   
dbj|BAJ91460.1|  predicted protein                                      124   3e-29   
gb|KDO64138.1|  hypothetical protein CISIN_1g012093mg                   126   3e-29   
ref|XP_010543149.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    126   3e-29   
ref|XP_006429615.1|  hypothetical protein CICLE_v10011654mg             126   3e-29   
ref|XP_010543148.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    126   4e-29   
gb|KDO64139.1|  hypothetical protein CISIN_1g012093mg                   125   4e-29   
ref|XP_004141631.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   4e-29   
ref|XP_010543147.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    126   4e-29   
ref|XP_006481220.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   4e-29   
ref|XP_002892099.1|  hypothetical protein ARALYDRAFT_470192             125   4e-29   
gb|KDO64137.1|  hypothetical protein CISIN_1g012093mg                   125   5e-29   
ref|XP_009803520.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   5e-29   
ref|XP_008448293.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      125   7e-29   
emb|CDP06381.1|  unnamed protein product                                125   7e-29   
gb|ABF99675.1|  endo-beta-mannanase, putative, expressed                122   7e-29   
gb|ABD47731.1|  (1-4)-beta-mannan endohydrolase                         120   7e-29   
ref|XP_004139946.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   8e-29   
ref|XP_008665709.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   8e-29   
ref|XP_008665710.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   8e-29   
ref|XP_010098023.1|  Mannan endo-1,4-beta-mannosidase 6                 124   9e-29   
ref|XP_002517909.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    124   1e-28   
gb|EAY75800.1|  hypothetical protein OsI_03716                          124   1e-28   
ref|XP_002528703.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    124   1e-28   
ref|XP_008370277.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   1e-28   
ref|XP_008370275.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   1e-28   
emb|CBI18019.3|  unnamed protein product                                124   2e-28   
ref|XP_007198827.1|  hypothetical protein PRUPE_ppa005783mg             124   2e-28   
ref|XP_010653330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   2e-28   
ref|XP_004141536.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   2e-28   
ref|XP_010653331.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   2e-28   
ref|XP_010052017.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   2e-28   
ref|XP_002273389.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   3e-28   
gb|ERN04226.1|  hypothetical protein AMTR_s00077p00136900               122   3e-28   
ref|XP_010260194.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   3e-28   
gb|EPS70897.1|  mannan endo-1,4-beta-mannosidase 2                      123   3e-28   
ref|XP_010260196.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   3e-28   
ref|XP_010260197.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   3e-28   
ref|XP_009370901.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   4e-28   
ref|XP_009370900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   4e-28   
gb|AAD20927.1|  (1-4)-beta-mannan endohydrolase                         122   4e-28   
ref|XP_008791709.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      122   5e-28   
ref|XP_008367886.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    122   5e-28   
ref|XP_002974905.1|  hypothetical protein SELMODRAFT_232427             122   6e-28   
ref|XP_011622682.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      122   6e-28   
ref|XP_002988915.1|  hypothetical protein SELMODRAFT_129038             122   6e-28   
ref|NP_179660.2|  mannan endo-1,4-beta-mannosidase 2                    122   7e-28   
gb|EYU24916.1|  hypothetical protein MIMGU_mgv1a007803mg                122   7e-28   
ref|XP_002884216.1|  glycosyl hydrolase family 5 protein                122   7e-28   
ref|XP_004149910.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      122   8e-28   
sp|Q0DM48.2|MAN3_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    122   9e-28   
ref|XP_002463596.1|  hypothetical protein SORBIDRAFT_01g002630          121   1e-27   
ref|XP_008244712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      121   2e-27   
ref|XP_003569799.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    121   2e-27   
ref|XP_006367645.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    120   2e-27   
sp|Q9LW44.3|MANP_ARATH  RecName: Full=Putative mannan endo-1,4-be...    120   2e-27   
ref|XP_006409005.1|  hypothetical protein EUTSA_v10001990mg             120   3e-27   
emb|CDY05783.1|  BnaC07g00200D                                          120   3e-27   
ref|XP_009117471.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      120   3e-27   
emb|CDY31945.1|  BnaA07g00500D                                          120   3e-27   
ref|XP_009102000.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    120   3e-27   
emb|CBI21857.3|  unnamed protein product                                120   3e-27   
ref|XP_008456477.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      120   3e-27   
ref|XP_002273772.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    120   3e-27   
ref|XP_010540874.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      120   3e-27   
ref|XP_006296707.1|  hypothetical protein CARUB_v10013751mg             120   4e-27   
ref|NP_194561.1|  mannan endo-1,4-beta-mannosidase 5                    120   4e-27   
ref|XP_006279332.1|  hypothetical protein CARUB_v10012718mg             120   4e-27   
gb|KDO53904.1|  hypothetical protein CISIN_1g014151mg                   119   5e-27   
gb|EMS46475.1|  Putative mannan endo-1,4-beta-mannosidase 9             118   5e-27   
ref|XP_009357862.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    119   5e-27   
gb|AFY10516.1|  endo-beta-1,4-mannanase                                 117   5e-27   
ref|XP_004302566.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    119   5e-27   
ref|XP_007207326.1|  hypothetical protein PRUPE_ppa005849mg             119   6e-27   
emb|CDX81978.1|  BnaC08g36230D                                          119   6e-27   
ref|XP_004969933.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    119   6e-27   
ref|XP_011466411.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    119   6e-27   
ref|XP_011466409.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    119   7e-27   
gb|KFK40440.1|  hypothetical protein AALP_AA3G373500                    119   8e-27   
ref|XP_004248170.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      119   8e-27   
ref|XP_009416974.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    119   9e-27   
ref|XP_011008632.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    119   9e-27   
ref|XP_010490281.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      117   1e-26   
ref|XP_002870892.1|  hypothetical protein ARALYDRAFT_349416             119   1e-26   
gb|AFK34066.1|  unknown                                                 114   1e-26   
gb|KCW69493.1|  hypothetical protein EUGRSUZ_F02942                     113   1e-26   
ref|NP_195813.1|  mannan endo-1,4-beta-mannosidase 6                    118   1e-26   
dbj|BAJ87988.1|  predicted protein                                      118   1e-26   
ref|XP_010438480.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    118   2e-26   
ref|XP_004487276.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    118   2e-26   
gb|KFK35900.1|  hypothetical protein AALP_AA4G051000                    118   2e-26   
emb|CDP14790.1|  unnamed protein product                                118   2e-26   
gb|EAY92423.1|  hypothetical protein OsI_14157                          118   2e-26   
ref|XP_010433238.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      118   2e-26   
ref|XP_006398561.1|  hypothetical protein EUTSA_v10013730mg             117   2e-26   
dbj|BAJ34043.1|  unnamed protein product                                118   2e-26   
ref|XP_002867455.1|  glycosyl hydrolase family 5 protein                117   2e-26   
ref|XP_006283768.1|  hypothetical protein CARUB_v10004854mg             117   2e-26   
gb|EEC76450.1|  hypothetical protein OsI_14158                          117   2e-26   
ref|XP_010447999.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   2e-26   
ref|XP_010043507.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    118   2e-26   
ref|XP_010043514.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   2e-26   
ref|XP_006357475.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   3e-26   
ref|XP_004243357.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   3e-26   
gb|AAL79758.1|AC096687_22  putative endohydrolase                       117   3e-26   
ref|XP_001769553.1|  predicted protein                                  117   3e-26   
ref|NP_001051777.1|  Os03g0828500                                       117   4e-26   
ref|XP_002458478.1|  hypothetical protein SORBIDRAFT_03g034420          117   4e-26   
gb|EAZ29139.1|  hypothetical protein OsJ_13202                          117   4e-26   
ref|XP_010490578.1|  PREDICTED: putative mannan endo-1,4-beta-man...    117   4e-26   
ref|XP_009588484.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   4e-26   
ref|XP_009400567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   5e-26   
ref|XP_009590206.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   5e-26   
ref|XP_009793291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   5e-26   
ref|XP_009421284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    117   5e-26   
dbj|BAK02230.1|  predicted protein                                      117   5e-26   
ref|XP_010035760.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    116   6e-26   
emb|CDY18983.1|  BnaC01g20850D                                          116   6e-26   
ref|XP_010490492.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    116   6e-26   
ref|XP_009144379.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    116   6e-26   



>ref|XP_009762330.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=434

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 154/179 (86%), Gaps = 9/179 (5%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F+IGTDFIANN+IP IDFAT H+YPDQW+++S+DQ+QL+FL NWLN+HI+D+QYIL+KPL
Sbjct  256  FDIGTDFIANNRIPGIDFATAHAYPDQWITNSNDQAQLSFLNNWLNSHIQDAQYILRKPL  315

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            LI EFGKSWKD GF+  QRD LY TVYY IYSSAKRGGAAAGGLFWQLL++GMD+FRDGY
Sbjct  316  LITEFGKSWKDSGFSSYQRDLLYNTVYYKIYSSAKRGGAAAGGLFWQLLSEGMDSFRDGY  375

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            EI+LSQ  STANLI+QQ HKL QIR+IF+RM+N+ R +RAKA         NRG++IGN
Sbjct  376  EIVLSQSPSTANLIAQQSHKLYQIRKIFSRMRNIQRWKRAKAARRGDWTDRNRGRRIGN  434



>ref|XP_009619497.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 155/180 (86%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            +F+IGTDFIANN+IP IDFAT H+YPDQW+++S+DQ+QL+FL +WLN+HI+D+QYIL+KP
Sbjct  255  SFDIGTDFIANNRIPGIDFATAHAYPDQWITNSNDQAQLSFLNHWLNSHIQDAQYILRKP  314

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LLI EFGKSWKD GF+  QRD LY TVYY IYSSAKRGGAAAGGLFWQLL++GMD+FRDG
Sbjct  315  LLITEFGKSWKDSGFSSYQRDLLYNTVYYKIYSSAKRGGAAAGGLFWQLLSEGMDSFRDG  374

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+L+Q  STANLI+QQ HKL QIR+IF+RM+N+ R +RAKA         NRG++IGN
Sbjct  375  YEIVLNQNPSTANLIAQQSHKLYQIRKIFSRMRNIQRWKRAKAARRGDWTGSNRGRRIGN  434



>ref|XP_011083199.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Sesamum indicum]
Length=433

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 149/180 (83%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F IGTDFIANN+IP IDFAT HSYPDQW+SSSDDQ QL+FL NWL+AHI+D+Q+IL KP
Sbjct  254  GFTIGTDFIANNRIPAIDFATVHSYPDQWLSSSDDQKQLSFLSNWLDAHIQDAQFILHKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LLI EFGKSWKDPGF+P +RD L+ TVY  IY+SAK GGAAAGGLFWQLLT+GMD+FRDG
Sbjct  314  LLITEFGKSWKDPGFSPYERDTLFNTVYSKIYASAKHGGAAAGGLFWQLLTEGMDSFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+L + +STAN+I+QQ HKL QIR+IF+RM+N G  RR +A         N+GK+IGN
Sbjct  374  YEIILDENSSTANVIAQQAHKLYQIRKIFSRMRNWGVWRRGRARRAPWLAAGNKGKRIGN  433



>ref|XP_007046870.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046871.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046872.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046873.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91027.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91028.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91029.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91030.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
Length=433

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 147/179 (82%), Gaps = 9/179 (5%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
             NIGTDFIANNQIP IDFAT HSYPDQW+SSS+DQ QL+FL  WL+AHI+D+Q+IL+KP+
Sbjct  255  LNIGTDFIANNQIPGIDFATVHSYPDQWLSSSNDQYQLSFLNKWLDAHIQDAQFILRKPV  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L+ EFGKSWKDPGF+  +RD L+ TVYY IYSSAKRGG AAGGLFWQLL++GMD+FRDGY
Sbjct  315  LLTEFGKSWKDPGFSTYKRDQLFNTVYYKIYSSAKRGGPAAGGLFWQLLSEGMDSFRDGY  374

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            +I+LS+  STAN ISQQ HKL QIRRIF RM+N+ R +RA+A         N G+ IGN
Sbjct  375  DIVLSESPSTANAISQQSHKLDQIRRIFTRMRNVERWKRARAMRRGQWHGGNGGRHIGN  433



>ref|XP_012092731.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Jatropha curcas]
 gb|KDP44593.1| hypothetical protein JCGZ_22175 [Jatropha curcas]
Length=434

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
               IGTDFIANN+IP IDFAT HSYPDQW+SSS++Q QL+FL NWLNAHI+DSQYIL+KP
Sbjct  255  GLEIGTDFIANNRIPAIDFATLHSYPDQWLSSSNNQYQLSFLNNWLNAHIQDSQYILRKP  314

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +LI EFGKSWKDPGF+  +RD ++ TVYY IYSSAKRGGAAAGGLFWQLLT+GMDNFRDG
Sbjct  315  ILITEFGKSWKDPGFSTYERDEMFSTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDNFRDG  374

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL---------GRLRRAKANRGKQIGN  452
            YEI+L + +STAN+I+QQ HKL QIR+IF RM+N+          R +    NRG++IGN
Sbjct  375  YEIILGENSSTANVIAQQSHKLYQIRKIFERMRNVQRWKRARAARRRQWQHGNRGRRIGN  434



>ref|XP_004232427.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Solanum lycopersicum]
Length=434

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 151/179 (84%), Gaps = 9/179 (5%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F+IGTDFIANN+IP IDFAT H+YPDQW+++S+DQ QL+FL NWL++HI+D+QYIL+KPL
Sbjct  256  FDIGTDFIANNRIPGIDFATVHAYPDQWVTNSNDQGQLSFLNNWLDSHIQDAQYILRKPL  315

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            LI EFGKS KD GF+  QRD LY TVYY IYSSAKRGGAAAGGLFWQLL++GM++F DGY
Sbjct  316  LITEFGKSSKDSGFSSYQRDLLYNTVYYKIYSSAKRGGAAAGGLFWQLLSEGMNSFGDGY  375

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            EI+LSQ  STANLI+QQ HKL QIR+IFARM+N+ R +RAKA         N+GK+IGN
Sbjct  376  EIILSQNPSTANLIAQQSHKLYQIRKIFARMRNIQRWKRAKAARRSDWTNRNKGKRIGN  434



>ref|XP_006340651.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum tuberosum]
Length=433

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 151/179 (84%), Gaps = 9/179 (5%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F+IGTDFIANN+IP IDFAT H+YPDQW+++S+DQ QL+FL NWL++HI+D+QYIL+KPL
Sbjct  255  FDIGTDFIANNRIPGIDFATAHAYPDQWVTNSNDQGQLSFLNNWLDSHIQDAQYILRKPL  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            LI EFGKS KD GF+  QRD LY TVYY IYSSAKRGGAAAGGLFWQLL++GM++F DGY
Sbjct  315  LITEFGKSSKDSGFSSYQRDLLYNTVYYKIYSSAKRGGAAAGGLFWQLLSEGMNSFGDGY  374

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            EI+LSQ  STANLI+QQ HKL QIR+IFARM+N+ R +RAKA         N+GK+IGN
Sbjct  375  EIILSQNPSTANLIAQQSHKLYQIRKIFARMRNVQRWKRAKAARRGGWTDRNKGKRIGN  433



>ref|XP_010113415.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
 gb|EXC35442.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
Length=436

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 146/180 (81%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F+IGTDFIANN+I  IDFAT H YPDQW+SSS+DQ QL+FL NWL+ HI+D+Q IL+KP
Sbjct  257  GFDIGTDFIANNRIHGIDFATVHCYPDQWLSSSNDQKQLSFLNNWLDTHIQDAQKILRKP  316

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKS KDPGFN  QRD L+ TVYY IYSSAKRGG A G LFWQLLT+GMD+FRDG
Sbjct  317  LLLTEFGKSGKDPGFNTYQRDQLFNTVYYKIYSSAKRGGVAGGSLFWQLLTEGMDSFRDG  376

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+LSQ +STAN+ISQQ HKL  +RRIFARM+N+ R ++A+A         N+GK+IGN
Sbjct  377  YEIILSQSSSTANIISQQSHKLYLVRRIFARMRNVERWKKARAARRAQWMNRNKGKRIGN  436



>ref|XP_008440745.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Cucumis melo]
Length=418

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ QL+FL NW++ HI+D++ IL+KP
Sbjct  248  GFNIGTDFIANNRIPGIDFATLHSYPDQWLSSSNDQYQLSFLNNWISTHIQDAESILRKP  307

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+ EFGKSWK PG++  +RD L+ TVYY IY+SA+RGGAAAGGLFWQLLT+GMD+FRDG
Sbjct  308  ILLTEFGKSWKVPGYSTNERDLLFNTVYYKIYASARRGGAAAGGLFWQLLTEGMDSFRDG  367

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQIGN  452
            YEI+LSQ  STAN+I+QQ  +L QIRRIFARM+N+ R +RA+A RGK+IGN
Sbjct  368  YEIILSQNPSTANVITQQSRRLYQIRRIFARMRNIERWKRARAARGKRIGN  418



>gb|ACN78662.1| endo-beta-mannanase [Actinidia arguta]
Length=433

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 152/180 (84%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN++P IDFAT HSYPDQW++SS++Q+QL+FL NWL+ HI+D+Q++L+KP
Sbjct  254  GFNIGTDFIANNRVPWIDFATVHSYPDQWLTSSNEQNQLSFLNNWLDTHIQDAQFVLRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKSWKDPG++  QRD L+ TVYY IYSSAKRGGAAAGGLFWQLLT+GMD+FRDG
Sbjct  314  LLLTEFGKSWKDPGYSTYQRDLLFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDSFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            Y+I+LS+  STAN+I+QQ H+L QIR+IFARM+N+ R +RA+          NRGK IGN
Sbjct  374  YDIVLSESPSTANVIAQQSHRLYQIRKIFARMRNVERWKRARWARRNPWFSRNRGKPIGN  433



>ref|XP_008241714.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Prunus mume]
Length=433

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 148/180 (82%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ+QL+F+ NWLN HI+D+QYIL+KP
Sbjct  254  GFNIGTDFIANNRIPGIDFATVHSYPDQWLSSSNDQNQLSFMNNWLNTHIQDAQYILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            + I EFGKSWKDPGFN  QRD L+ TVY  IYSSA+RG AAAGGLFWQLLT+GMD+F DG
Sbjct  314  VFITEFGKSWKDPGFNTYQRDLLFNTVYSKIYSSARRGAAAAGGLFWQLLTEGMDSFGDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            Y+I+LSQ  STAN+I+QQ HKL QIR+IFAR++N    +RA+A         N+GK+IGN
Sbjct  374  YDIVLSQSPSTANVIAQQSHKLYQIRKIFARIRNAQMWKRARAIRRAEWLARNKGKRIGN  433



>gb|ABV32548.1| endo-1,4-beta-mannosidase protein 2 [Prunus persica]
Length=433

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 149/180 (83%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ+QL+FL NWL+ HI+D+QYIL+KP
Sbjct  254  GFNIGTDFIANNRIPGIDFATVHSYPDQWLSSSNDQNQLSFLNNWLDTHIQDAQYILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            + I EFGKSWKDPGFN  QRD L+ TVY  IYSSA+RGGAAAGGLFWQLLT+GMD+F DG
Sbjct  314  VFITEFGKSWKDPGFNTYQRDLLFNTVYSKIYSSARRGGAAAGGLFWQLLTEGMDSFGDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            Y+I+LSQ  STAN+I+QQ HKL QIR+IFAR++N    +RA+A         N+GK+IGN
Sbjct  374  YDIVLSQSPSTANVIAQQSHKLYQIRKIFARIRNAQMWKRARAIRRAEWLARNKGKRIGN  433



>ref|XP_007202078.1| hypothetical protein PRUPE_ppa005992mg [Prunus persica]
 gb|EMJ03277.1| hypothetical protein PRUPE_ppa005992mg [Prunus persica]
Length=433

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 149/180 (83%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ+QL+FL NWL+ HI+D+QYIL+KP
Sbjct  254  GFNIGTDFIANNRIPGIDFATVHSYPDQWLSSSNDQNQLSFLNNWLDTHIQDAQYILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            + I EFGKSWKDPGFN  QRD L+ TVY  IYSSA+RGGAAAGGLFWQLLT+GMD+F DG
Sbjct  314  VFITEFGKSWKDPGFNTYQRDLLFNTVYSKIYSSARRGGAAAGGLFWQLLTEGMDSFGDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            Y+I+LSQ  STAN+I+QQ HKL QIR+IFAR++N    +RA+A         N+GK+IGN
Sbjct  374  YDIVLSQSPSTANVIAQQSHKLYQIRKIFARIRNAQMWKRARAIRRAEWLARNKGKRIGN  433



>gb|ABY58035.1| mannase [Prunus salicina]
Length=433

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 147/180 (82%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ+QL+F+ NWLN HI+D+QYIL+KP
Sbjct  254  GFNIGTDFIANNRIPGIDFATVHSYPDQWLSSSNDQNQLSFMNNWLNTHIQDAQYILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            + I EFGKSWKDPGFN  QRD  + TVY  IYSSA+RGGAAAG LFWQLLT+GMD+F DG
Sbjct  314  VFITEFGKSWKDPGFNTYQRDLFFNTVYSKIYSSARRGGAAAGALFWQLLTEGMDSFGDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            Y+I+LSQ  STAN+I+QQ HKL QIR+IFAR++N    +RA+A         N+GK+IGN
Sbjct  374  YDIVLSQSPSTANVIAQQSHKLYQIRKIFARIRNAQMWKRARAIRRAEWLARNKGKRIGN  433



>ref|XP_009347596.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7-like [Pyrus x bretschneideri]
 ref|XP_009347607.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7-like [Pyrus x bretschneideri]
Length=436

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 145/180 (81%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             +NIGTDFIANN+IP IDF T HSYPDQW+ SS+DQ QLAF  NWLN HI+D+Q IL+KP
Sbjct  257  GYNIGTDFIANNRIPGIDFTTVHSYPDQWLGSSNDQHQLAFSNNWLNTHIQDAQNILQKP  316

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            + IAEFGKSWKDPGF+  QRD L+ TVY  IY SAKRGGAAAGGLFWQLLT+GMD+FRDG
Sbjct  317  IFIAEFGKSWKDPGFSTYQRDLLFNTVYSKIYFSAKRGGAAAGGLFWQLLTEGMDSFRDG  376

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            Y+I+LSQ  STAN+I++Q HKL+QIR+IFAR++N    +RA+A         N+GK IG+
Sbjct  377  YDIVLSQSPSTANVIAEQSHKLNQIRKIFARIRNARMWKRARAIRRDEWLGRNKGKPIGD  436



>gb|ABD47729.1| (1-4)-beta-mannan endohydrolase [Eucalyptus globulus subsp. globulus]
Length=231

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F+IGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ QL+FL NWLN HI+D+QYIL+KP
Sbjct  59   GFDIGTDFIANNRIPGIDFATAHSYPDQWVSSSNDQYQLSFLNNWLNTHIQDAQYILRKP  118

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+ EFGKS KD GF+  QRD L+  VYY +Y+SAKRGGAAAG LFWQLLT+GMD+FRDG
Sbjct  119  ILLTEFGKSQKDHGFSTYQRDQLFNMVYYKVYASAKRGGAAAGSLFWQLLTEGMDSFRDG  178

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL  500
            YE++L+Q  STAN+I+ Q HKL QIR+IFARM+N+
Sbjct  179  YEVVLNQSPSTANIIAYQSHKLYQIRKIFARMRNV  213



>ref|XP_011025835.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Populus euphratica]
Length=435

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 147/182 (81%), Gaps = 11/182 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
               IGTDFIANN+IP IDFAT H+YPDQW+SSS D+SQL+FL NWL+ HI+D+Q IL+KP
Sbjct  254  GLKIGTDFIANNRIPGIDFATAHAYPDQWLSSSSDRSQLSFLNNWLDTHIQDAQNILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +LIAEFGKSWKDPGF+  QRD ++ TVYY IYSSAKRGGAAAGGLFWQLLT+GM NFRDG
Sbjct  314  ILIAEFGKSWKDPGFSTYQRDLMFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMGNFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK-----------ANRGKQI  458
            YE++L Q +STAN+I+QQ HKL QIR+IF R +N+ R ++A+            N+GK+I
Sbjct  374  YEVVLGQPSSTANVIAQQAHKLKQIRKIFMRTRNVERWKKARAARARRGRWQGGNKGKRI  433

Query  457  GN  452
            GN
Sbjct  434  GN  435



>ref|XP_011015126.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 143/182 (79%), Gaps = 11/182 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
               IGTDFIANN+IP +DFAT H+YPDQW SSS+DQ+QL+FL NWL+ HI+D+Q IL+KP
Sbjct  254  GLKIGTDFIANNRIPGLDFATVHAYPDQWFSSSNDQNQLSFLNNWLDTHIQDAQNILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +LIAEFGKSWK PGF+  QRD L+ TVYY IYSSAKRGGAAAGGLFWQLLT+GMDNFRDG
Sbjct  314  ILIAEFGKSWKYPGFSTYQRDLLFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDNFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL-----------GRLRRAKANRGKQI  458
            YEI+L Q +STAN+ISQQ HKL QIR+IF RM+N+            R      N GK+I
Sbjct  374  YEIILGQPSSTANVISQQAHKLYQIRKIFLRMRNVERWKRARAARARRHHWRGGNGGKRI  433

Query  457  GN  452
            GN
Sbjct  434  GN  435



>ref|XP_006383170.1| (1-4)-beta-mannan endohydrolase family protein [Populus trichocarpa]
 gb|ABK95661.1| unknown [Populus trichocarpa]
 gb|ERP60967.1| (1-4)-beta-mannan endohydrolase family protein [Populus trichocarpa]
Length=435

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 146/182 (80%), Gaps = 11/182 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
               IGTDFIANN+IP IDFAT H+YPDQW+SSS+DQ+QL+FL NWL+ HI+D+Q  L+KP
Sbjct  254  GLKIGTDFIANNRIPEIDFATVHAYPDQWLSSSNDQNQLSFLNNWLDTHIQDAQNSLRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +LIAEFGKSWK PGF+  QRD L+ TVYY IYSSAKRGGAAAGGLFWQLLT+GMDNF DG
Sbjct  314  ILIAEFGKSWKYPGFSTYQRDLLFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDNFHDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK-----------ANRGKQI  458
            YEI+L Q +STAN+I+QQ HKL QIR+IF RM+N+ R +RA+            N GK+I
Sbjct  374  YEIMLGQPSSTANVIAQQAHKLYQIRKIFLRMRNVERWKRARAARARRVHWRGGNGGKRI  433

Query  457  GN  452
            GN
Sbjct  434  GN  435



>emb|CAN70632.1| hypothetical protein VITISV_020726 [Vitis vinifera]
Length=240

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 146/180 (81%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + IGTDFIANN+I  IDFAT HSYPDQW+S S++QSQL+FL NWL AHI+D+Q IL+KP
Sbjct  61   GYYIGTDFIANNRIRGIDFATVHSYPDQWLSGSNEQSQLSFLNNWLGAHIQDAQNILRKP  120

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+ EFGKSWKDPGF+  QRD L+ TVY  IYSSA+RGGAAAGGLFWQLLT+GMD+FRDG
Sbjct  121  VLLTEFGKSWKDPGFSTYQRDQLFNTVYNQIYSSARRGGAAAGGLFWQLLTEGMDSFRDG  180

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            Y+I+LS+  STAN+I+QQ  K+ QIR+IFARM+N+ + + A+A         NR K+IGN
Sbjct  181  YDIVLSESPSTANVIAQQSRKIDQIRKIFARMRNMTKWKSARASRRAEWLARNRSKRIGN  240



>ref|XP_006425633.1| hypothetical protein CICLE_v10025631mg [Citrus clementina]
 gb|ESR38873.1| hypothetical protein CICLE_v10025631mg [Citrus clementina]
Length=436

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  958  NIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLL  779
            +IGTDFIANN IP IDFAT HSYPDQW+SSS+D+ QL+FL NWL+ HI+D+Q+IL+KP+L
Sbjct  259  DIGTDFIANNLIPGIDFATVHSYPDQWLSSSNDRYQLSFLNNWLDTHIQDAQHILRKPIL  318

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYE  599
            +AEFGKS KDPG++  QRD ++ TVYY IYSSAKRGGAAAGGLFWQLLT+GMD FRDGYE
Sbjct  319  LAEFGKSRKDPGYSTYQRDVMFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDAFRDGYE  378

Query  598  ILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGR  494
            I+LSQ  STAN+I+QQ HKL QIR+IFARM+N+ R
Sbjct  379  IVLSQIPSTANVITQQAHKLYQIRKIFARMRNVER  413



>ref|XP_002310816.2| hypothetical protein POPTR_0007s13190g [Populus trichocarpa]
 gb|EEE91266.2| hypothetical protein POPTR_0007s13190g [Populus trichocarpa]
Length=435

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 148/182 (81%), Gaps = 11/182 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
               IGTDFIANN+IP IDFAT H+YPDQW+SSS DQSQL+FL NWL+ HI+D+Q IL+KP
Sbjct  254  GLKIGTDFIANNRIPGIDFATAHAYPDQWLSSSSDQSQLSFLNNWLDTHIQDAQNILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +LIAEFGKSWKDPGF+  QRD ++ TVYY IYSSAKRGGAAAGGLFWQLLT+GM NFRDG
Sbjct  314  ILIAEFGKSWKDPGFSTYQRDLVFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMGNFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK-----------ANRGKQI  458
            YEI+L Q +STAN+I+QQ HKL+QIR+IF RM+N+ R +RA+             +GK+I
Sbjct  374  YEIVLGQPSSTANVIAQQAHKLNQIRKIFLRMRNVERWKRARAARARRGRWQGGKKGKRI  433

Query  457  GN  452
            GN
Sbjct  434  GN  435



>ref|XP_011011941.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 143/182 (79%), Gaps = 11/182 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
               IGTDFIANN+IP +DFAT H+YPDQW SSS+DQ+QL+FL NWL+ HI+D+Q IL+KP
Sbjct  254  GLKIGTDFIANNRIPGLDFATVHAYPDQWFSSSNDQNQLSFLNNWLDTHIQDAQNILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +LIAEFGKSWK PGF+  QRD L+ TVYY IYS+AKRGGAAAGGLFWQLLT+GMDNFRDG
Sbjct  314  ILIAEFGKSWKYPGFSTYQRDLLFNTVYYKIYSTAKRGGAAAGGLFWQLLTEGMDNFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL-----------GRLRRAKANRGKQI  458
            YEI+L Q +STAN+ISQQ HKL QIR+IF RM+N+            R      N GK+I
Sbjct  374  YEIILGQPSSTANVISQQAHKLYQIRKIFLRMRNVERWKRARAARARRHHWRGGNGGKRI  433

Query  457  GN  452
            GN
Sbjct  434  GN  435



>ref|XP_011013722.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 143/182 (79%), Gaps = 11/182 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
               IGTDFIANN+IP +DFAT H+YPDQW SSS+DQ+QL+FL NWL+ HI+D+Q IL+KP
Sbjct  254  GLKIGTDFIANNRIPGLDFATVHAYPDQWFSSSNDQNQLSFLNNWLDTHIQDAQNILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +LIAEFGKSWK PGF+  QRD L+ TVYY IYS+AKRGGAAAGGLFWQLLT+GMDNFRDG
Sbjct  314  ILIAEFGKSWKYPGFSTYQRDLLFNTVYYKIYSTAKRGGAAAGGLFWQLLTEGMDNFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL-----------GRLRRAKANRGKQI  458
            YEI+L Q +STAN+ISQQ HKL QIR+IF RM+N+            R      N GK+I
Sbjct  374  YEIILGQPSSTANVISQQAHKLYQIRKIFLRMRNVERWKRARAARARRHHWRGGNGGKRI  433

Query  457  GN  452
            GN
Sbjct  434  GN  435



>ref|XP_006466833.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Citrus sinensis]
Length=436

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -2

Query  958  NIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLL  779
            +IGTDFIANN IP IDFAT HSYPDQW+SSS+D+ QL+FL NWL+ HI+D+++IL+KP+L
Sbjct  259  DIGTDFIANNLIPGIDFATVHSYPDQWLSSSNDRDQLSFLNNWLDTHIQDAEHILRKPIL  318

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYE  599
            +AEFGKS KDPG++  QRD ++ TVYY IYSSAKRGGAAAGGLFWQLLT+GMD FRDGYE
Sbjct  319  LAEFGKSRKDPGYSTYQRDVMFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDAFRDGYE  378

Query  598  ILLSQRTSTANLISQQCHKLSQIRRIFARMKNL  500
            I+LSQ  STAN+I+QQ HKL QIR+IFARM+N+
Sbjct  379  IVLSQSPSTANVITQQAHKLYQIRKIFARMRNV  411



>gb|KDO70993.1| hypothetical protein CISIN_1g013811mg [Citrus sinensis]
Length=436

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
             +IGTDF+ANN IP IDFAT HSYPDQW+SSS+D+ QL+FL NWL+ HI+D+++IL+KP+
Sbjct  258  LDIGTDFVANNLIPGIDFATVHSYPDQWLSSSNDRDQLSFLNNWLDTHIQDAEHILRKPI  317

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L+AEFGKS KDPG++  QRD ++ TVYY IYSSAKRGGAAAGGLFWQLLT+GMD FRDGY
Sbjct  318  LLAEFGKSRKDPGYSTYQRDVMFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDAFRDGY  377

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNL  500
            EI+LSQ  STAN+I+QQ HKL QIR+IFARM+N+
Sbjct  378  EIVLSQSPSTANVITQQAHKLYQIRKIFARMRNV  411



>ref|XP_009340713.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Pyrus x bretschneideri]
Length=436

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            FNIGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ+QL FL NWLN HI+D+Q IL+KP+
Sbjct  258  FNIGTDFIANNRIPGIDFATVHSYPDQWLSSSNDQTQLTFLNNWLNTHIQDAQNILRKPI  317

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
             IAEFGKSWKDPGF+  QRD L+ TVY  IY SAKRGGAAAGGLFWQLLT+GMD+FRDGY
Sbjct  318  FIAEFGKSWKDPGFSTYQRDLLFNTVYSKIYFSAKRGGAAAGGLFWQLLTEGMDSFRDGY  377

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKN  503
            +I+LSQ  ST N+I+QQ HKL+QIR+IFAR +N
Sbjct  378  DIVLSQNPSTENVIAQQSHKLNQIRKIFARRRN  410



>gb|ERM94646.1| hypothetical protein AMTR_s00011p00202020 [Amborella trichopoda]
Length=404

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 141/180 (78%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFIANNQI  IDFAT HSYPDQW+S S+ ++QL+FL +WLN HI+D++ IL+KP
Sbjct  225  GFQVGTDFIANNQIWGIDFATVHSYPDQWLSGSNYETQLSFLGSWLNTHIQDAETILRKP  284

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+AEFG SWKDPGFN  QRD L+ TVY +IY+SA+RGGA  GGLFWQLL +GMD++RDG
Sbjct  285  LLLAEFGNSWKDPGFNEYQRDMLFNTVYNSIYASARRGGATVGGLFWQLLAEGMDSYRDG  344

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+L+Q  ST N+I+QQ HKL+ + R+FAR +N+ +L+RA++          RGK  GN
Sbjct  345  YEIVLTQNPSTVNIITQQSHKLTYLSRLFARWRNIEKLKRARSIRRAQWLARTRGKNSGN  404



>ref|XP_008797528.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
1-like [Phoenix dactylifera]
Length=430

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 146/180 (81%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI+NNQIP IDFAT HSYPDQW+S+++DQ+QLAFL  WL++HI+D++ IL+KP
Sbjct  251  GFQVGTDFISNNQIPGIDFATVHSYPDQWLSNTNDQTQLAFLNKWLDSHIQDARSILRKP  310

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+AEFGKSWKDPGF+ +QRD L+ TVY  IY SA+ GGA AGGLFWQLLT+GMD++RDG
Sbjct  311  LLLAEFGKSWKDPGFSSSQRDELFNTVYSKIYWSARTGGATAGGLFWQLLTEGMDSYRDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YE++L++  ST+N+I+  C +L  + +++ARM+N+G+L +AKA         N+GK +GN
Sbjct  371  YEVILNETPSTSNMITAYCRRLRYLGKLYARMRNVGKLEQAKAIRRKQWQDENKGKNVGN  430



>ref|XP_004512071.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cicer arietinum]
Length=424

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 3/173 (2%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN++P IDFAT H YPDQW+SS++++ Q+AFL NWL+AH  D+QY LKKP
Sbjct  251  GFNIGTDFIANNRVPNIDFATVHCYPDQWVSSTNEEDQVAFLNNWLSAHFLDAQYALKKP  310

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AEFGKS+KD  +N  QRD L+RTVYY IYSSAKRGG A+G LFWQLLT GM++F DG
Sbjct  311  ILVAEFGKSFKDSSYNTNQRDQLFRTVYYKIYSSAKRGGPASGALFWQLLTQGMESFDDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK---ANRGKQIG  455
            Y I+L Q +ST N+I+QQ HKL  IR+I+ R+ +  R +RA+    NRG+QIG
Sbjct  371  YGIMLGQTSSTGNVIAQQSHKLYLIRKIYGRIADERRWKRARFNGGNRGRQIG  423



>ref|XP_011623587.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Amborella trichopoda]
Length=431

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 141/180 (78%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFIANNQI  IDFAT HSYPDQW+S S+ ++QL+FL +WLN HI+D++ IL+KP
Sbjct  252  GFQVGTDFIANNQIWGIDFATVHSYPDQWLSGSNYETQLSFLGSWLNTHIQDAETILRKP  311

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+AEFG SWKDPGFN  QRD L+ TVY +IY+SA+RGGA  GGLFWQLL +GMD++RDG
Sbjct  312  LLLAEFGNSWKDPGFNEYQRDMLFNTVYNSIYASARRGGATVGGLFWQLLAEGMDSYRDG  371

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+L+Q  ST N+I+QQ HKL+ + R+FAR +N+ +L+RA++          RGK  GN
Sbjct  372  YEIVLTQNPSTVNIITQQSHKLTYLSRLFARWRNIEKLKRARSIRRAQWLARTRGKNSGN  431



>ref|XP_010029765.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Eucalyptus grandis]
 gb|KCW56722.1| hypothetical protein EUGRSUZ_I02413 [Eucalyptus grandis]
Length=427

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F+IGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ QL+FL NWLN HI+D+QYIL+KP
Sbjct  255  GFDIGTDFIANNRIPGIDFATAHSYPDQWVSSSNDQYQLSFLNNWLNTHIQDAQYILRKP  314

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+ EFGKS KD GF+  QRD L+  VYY +Y+SAKRGGAAAG LFWQLLT+GMD+FRDG
Sbjct  315  ILLTEFGKSQKDHGFSTYQRDQLFNMVYYKVYASAKRGGAAAGSLFWQLLTEGMDSFRDG  374

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL  500
            YE++L+Q  STAN+I+ Q HKL QIR+IFARM+N+
Sbjct  375  YEVVLNQSPSTANIIAYQSHKLYQIRKIFARMRNV  409



>ref|XP_008338221.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Malus domestica]
Length=436

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            FNIGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ+QL FL NWLN HI+D+Q IL+KP+
Sbjct  258  FNIGTDFIANNRIPGIDFATVHSYPDQWLSSSNDQTQLTFLNNWLNTHIQDAQNILRKPI  317

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
             IAEFGKSWKDPG +  QRD L+ TVY  IY SAKRGGAAAGGLFWQLLT+GMD+FRDGY
Sbjct  318  FIAEFGKSWKDPGLSTYQRDLLFNTVYSKIYFSAKRGGAAAGGLFWQLLTEGMDSFRDGY  377

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKN  503
            +I+LSQ  ST N+I+QQ HKL+QIR+IFAR +N
Sbjct  378  DIVLSQNPSTENVIAQQSHKLNQIRKIFARRRN  410



>ref|XP_003612065.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES95023.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=438

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 138/178 (78%), Gaps = 10/178 (6%)
 Frame = -2

Query  958  NIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLL  779
            NIGTDFIANN+IP IDFAT H YPDQW+ SS++Q QL+FL NWL+AH  D+QY LKKP+L
Sbjct  260  NIGTDFIANNRIPGIDFATVHCYPDQWVQSSNEQDQLSFLNNWLSAHFLDAQYALKKPIL  319

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYE  599
            +AEFGKS+KD GF+  QRD L+ TVYY IY+SAKRGG A+G LFWQLLT+GM++F DGY 
Sbjct  320  VAEFGKSFKDSGFSSNQRDQLFNTVYYKIYASAKRGGPASGALFWQLLTEGMESFDDGYG  379

Query  598  ILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK----------ANRGKQIG  455
            ILL Q TSTAN+I+QQ HKL  IR+I+A++ N  R +RA+           NRG QIG
Sbjct  380  ILLGQSTSTANVIAQQSHKLYLIRKIYAKIANERRWKRARFNGRRSSRDGGNRGGQIG  437



>ref|XP_010263608.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nelumbo nucifera]
Length=451

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 146/180 (81%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFIANNQIP IDFAT HSYPDQW SSS+DQ+QL+FL NWL+ HI+D+Q IL+KP
Sbjct  272  GFQVGTDFIANNQIPGIDFATVHSYPDQWFSSSNDQAQLSFLSNWLDIHIQDAQNILRKP  331

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+AEFGKS KDPGFN  +RD L+ TVY  IYSSA+ GGAAA GLFWQLLT+GMD+FRDG
Sbjct  332  LLLAEFGKSSKDPGFNTYERDMLFNTVYSKIYSSARSGGAAAAGLFWQLLTEGMDSFRDG  391

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+LS+  STAN+I+QQ  KL QIR+++AR++N+ + +RA+A         N+G+ IGN
Sbjct  392  YEIVLSESPSTANVIAQQSRKLYQIRKMYARLRNIEKWKRARAIRRAQWLARNKGRNIGN  451



>ref|XP_002264115.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Vitis vinifera]
 emb|CBI17484.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 146/180 (81%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + IGTDFIANN+I  IDFAT HSYPDQW+S S++QSQL+FL NWL AHI+D+Q IL+KP
Sbjct  254  GYYIGTDFIANNRIRGIDFATVHSYPDQWLSGSNEQSQLSFLNNWLGAHIQDAQNILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+ EFGKSWKDPGF+  QRD L+ TVY  IYSSA+RGGAAAGGLFWQLLT+GMD+FRDG
Sbjct  314  VLLTEFGKSWKDPGFSTYQRDQLFNTVYNQIYSSARRGGAAAGGLFWQLLTEGMDSFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            Y+I+LS+  STAN+I+QQ  K+ QIR+IFARM+N+ + + A+A         NR K+IGN
Sbjct  374  YDIVLSESPSTANVIAQQSRKIDQIRKIFARMRNMTKWKSARASRRAEWLARNRSKRIGN  433



>ref|XP_010254774.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nelumbo nucifera]
Length=433

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 145/180 (81%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFIANNQIP IDFAT HSYPDQW+SSS+DQ+QL+FL NWL+ HI+D+Q IL+KP
Sbjct  254  GFQLGTDFIANNQIPGIDFATVHSYPDQWLSSSNDQAQLSFLSNWLDTHIQDAQNILRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKSWKDPG+N  +RD L+ TVY  IYSSA+RGGAAAGGLFWQLL  GMD+ RDG
Sbjct  314  LLLTEFGKSWKDPGYNTYERDILFNTVYDKIYSSARRGGAAAGGLFWQLLALGMDSLRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+L + +ST N+I+QQ HKL QIR+++ R++N+ +L+RA+          N+G+ +GN
Sbjct  374  YEIVLGESSSTTNVIAQQSHKLYQIRKMYVRLRNIEKLKRAREIRRAQWLTRNKGRNVGN  433



>ref|XP_010926118.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Elaeis guineensis]
Length=430

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 145/180 (81%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI+NNQIP IDFAT HSYPDQW+S ++DQ+QLAFL  WL++HI+D++ +L+KP
Sbjct  251  GFQVGTDFISNNQIPGIDFATIHSYPDQWLSDTNDQAQLAFLNKWLDSHIQDARNVLRKP  310

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKSWKDPG++ +QRDAL+ TVY  IY SA+ GGA AGGLFWQLLT+GMD++RDG
Sbjct  311  LLLTEFGKSWKDPGYSSSQRDALFNTVYSKIYWSARTGGATAGGLFWQLLTEGMDSYRDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YE++L++  ST+N+I+  CH+L  + +++ARM+N+ +++ A+A         N+GK IGN
Sbjct  371  YEVILNEAPSTSNMITAYCHRLRYLGKLYARMRNIEKIQEAEAIRKQQWQNENKGKNIGN  430



>gb|KHG22102.1| Mannan endo-1,4-beta-mannosidase 7 -like protein [Gossypium arboreum]
Length=434

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 142/180 (79%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            + +IGTDFIANNQIP IDFAT HSYPDQW+SSS +Q QL+FL NWL+AHI D++  L+KP
Sbjct  255  SLDIGTDFIANNQIPGIDFATVHSYPDQWLSSSSEQYQLSFLNNWLDAHIRDARIALRKP  314

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AEFGKSWKDPGFN  QRD L+  VY  IY SAK GG A+GGLFWQLL  GM++FRDG
Sbjct  315  ILLAEFGKSWKDPGFNTYQRDQLFNIVYNKIYWSAKTGGPASGGLFWQLLAQGMESFRDG  374

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+LS+R+STAN+I+QQ HKL QIR+IF R +N+ R +RA+A         NRG  IGN
Sbjct  375  YEIILSERSSTANVIAQQSHKLDQIRKIFTRRRNVQRWKRARAKRRGGWHGRNRGGHIGN  434



>ref|XP_010924296.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X2 
[Elaeis guineensis]
Length=327

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 137/180 (76%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI+NNQIP IDFAT HSYPDQW+SSS+D  QLAFL  WL++HI D+  IL+KP
Sbjct  148  GFQVGTDFISNNQIPGIDFATVHSYPDQWLSSSNDHMQLAFLNRWLDSHIHDASNILRKP  207

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKSWKDPGF+ +QRDAL+ TVY  IY SA+ GGA AGGLFWQLLT+GMD+FRDG
Sbjct  208  LLLTEFGKSWKDPGFSSSQRDALFNTVYSKIYWSARTGGATAGGLFWQLLTEGMDSFRDG  267

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+LS+  STA +I+  C  L    +++ARM+N+ +L RAKA         N+GK  GN
Sbjct  268  YEIILSETPSTAKMITAYCRILHYWGKLYARMQNIKQLDRAKAMRRKHWHDENKGKNGGN  327



>ref|XP_008800703.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=430

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI+NNQIP IDFAT HSYPDQW+S+S+DQ+QLAFL  WL++HI+D++ IL+KP
Sbjct  251  GFQVGTDFISNNQIPGIDFATVHSYPDQWLSNSNDQAQLAFLNTWLDSHIQDARNILRKP  310

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKSWKDPGF+ +QRDAL+ TV+  IY SA+ GGA AGGLFWQLLT+GMD+FRDG
Sbjct  311  LLLTEFGKSWKDPGFSSSQRDALFNTVFSKIYWSARTGGATAGGLFWQLLTEGMDSFRDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            YEI+L++  STA +I+  C +L  + +++ARM+++ +L +AKA R KQ
Sbjct  371  YEIILNETPSTAKMIAAHCRRLHYLVKLYARMRDIEQLEKAKAMRRKQ  418



>ref|XP_004143522.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Cucumis sativus]
 gb|KGN48849.1| Endo-1,4-beta-mannosidase protein 2 [Cucumis sativus]
Length=418

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT HSYPDQW+SSS+DQ QL+FL NW++ HI+D++ IL+KP
Sbjct  248  GFNIGTDFIANNRIPGIDFATLHSYPDQWLSSSNDQYQLSFLNNWISTHIQDAESILRKP  307

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+ EFGKSWK PG++  +RD L+ TVY  IY+SA+RGGAAAGGLFWQLLT+GMD+FRDG
Sbjct  308  ILLTEFGKSWKVPGYSTNERDLLFNTVYSKIYASARRGGAAAGGLFWQLLTEGMDSFRDG  367

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQIGN  452
            YEI+LSQ  STAN+I+QQ  +L QIRRI+ARM+N+ R +RA+A RG++IGN
Sbjct  368  YEIILSQNPSTANVITQQSRRLYQIRRIYARMRNIERWKRARAARGRRIGN  418



>emb|CDP01989.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 142/179 (79%), Gaps = 8/179 (4%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
              NIGTDF+ANN++P IDFAT HSYPD W+SSS+DQSQ++F+  WL+AH +D+QY+L KP
Sbjct  254  GLNIGTDFVANNRVPGIDFATVHSYPDIWLSSSNDQSQVSFMNQWLDAHFQDAQYMLGKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +++AEFGKS KD GF+  +RDAL+  VY+ +YSSAK GG AAG LFWQLLT+G+D+FRDG
Sbjct  314  VMVAEFGKSSKDSGFSNYERDALFNDVYFKVYSSAKHGGPAAGALFWQLLTEGLDSFRDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA--------NRGKQIGN  452
            YEI+LSQ  STAN+I+QQ +KL  I++IF RM N+ R +RA+A        N+G+ IGN
Sbjct  374  YEIVLSQSPSTANVIAQQSYKLRLIQKIFTRMLNIKRWKRARAARGQWIDRNKGRHIGN  432



>ref|XP_002281804.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Vitis vinifera]
 emb|CBI19729.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 138/179 (77%), Gaps = 9/179 (5%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW SSS D +QL+FL  WL  HI+D+Q +L+KPL
Sbjct  255  FQVGTDFIANNQIPGIDFATVHSYPDQWFSSSSDDTQLSFLNEWLKNHIQDAQNVLRKPL  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L  EFGKS KD G++  QRD L+ TVY  IYSSA+ GGAA GG+FWQLLT+GMD+FRDGY
Sbjct  315  LFTEFGKSSKDSGYSTYQRDMLFNTVYSAIYSSARSGGAAVGGMFWQLLTEGMDSFRDGY  374

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            EI+LS+  STAN+I+QQ HKL  +R+++AR++N+ + +RA+A         N+GK  GN
Sbjct  375  EIVLSESPSTANVIAQQSHKLYLLRKMYARLRNIQKWKRARAIRRAQWWNRNKGKNTGN  433



>ref|XP_010924295.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X1 
[Elaeis guineensis]
Length=430

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 137/180 (76%), Gaps = 9/180 (5%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI+NNQIP IDFAT HSYPDQW+SSS+D  QLAFL  WL++HI D+  IL+KP
Sbjct  251  GFQVGTDFISNNQIPGIDFATVHSYPDQWLSSSNDHMQLAFLNRWLDSHIHDASNILRKP  310

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKSWKDPGF+ +QRDAL+ TVY  IY SA+ GGA AGGLFWQLLT+GMD+FRDG
Sbjct  311  LLLTEFGKSWKDPGFSSSQRDALFNTVYSKIYWSARTGGATAGGLFWQLLTEGMDSFRDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---------NRGKQIGN  452
            YEI+LS+  STA +I+  C  L    +++ARM+N+ +L RAKA         N+GK  GN
Sbjct  371  YEIILSETPSTAKMITAYCRILHYWGKLYARMQNIKQLDRAKAMRRKHWHDENKGKNGGN  430



>gb|KJB43465.1| hypothetical protein B456_007G201600 [Gossypium raimondii]
Length=1149

 Score =   213 bits (543),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            + +IGTDFIANNQIP IDFAT HSYPDQW+SSS +Q QL+FL NWL+AHI D++ IL+KP
Sbjct  255  SLDIGTDFIANNQIPGIDFATVHSYPDQWLSSSSEQYQLSFLNNWLDAHIRDARIILRKP  314

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AEFGKSWKDPGFN  QRD L+  VY  IY SAK GG A+GGLFWQLL  GM++FRDG
Sbjct  315  ILLAEFGKSWKDPGFNIYQRDQLFNIVYNKIYWSAKTGGPASGGLFWQLLAGGMESFRDG  374

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL  500
            YEI+LS+R+STAN+I+QQ HKL QIR+IF R +N+
Sbjct  375  YEIILSERSSTANVIAQQSHKLDQIRKIFTRRRNV  409



>ref|XP_008338066.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7 [Malus domestica]
Length=430

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             +NIGT+FIANN+IP IDF T HSYPDQW+ SS+DQ Q+ F  NWLN HI+ +Q IL+KP
Sbjct  257  GYNIGTEFIANNRIPGIDFTTIHSYPDQWLGSSNDQHQVVFSNNWLNTHIQVAQNILQKP  316

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            + IAEFGKSWKD GF   QRD L+ TVY  IY  AKRGGAAAGGLFWQLLT+GMD+FRDG
Sbjct  317  IYIAEFGKSWKDLGFRTYQRDLLFNTVYSKIYFLAKRGGAAAGGLFWQLLTEGMDSFRDG  376

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANR  470
            Y+I+LSQ  STAN+I+QQ HKL+QIR+IFAR++N    +RA+A R
Sbjct  377  YDIVLSQSPSTANVIAQQSHKLNQIRKIFARIRNARMWKRARAIR  421



>ref|XP_010679767.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Beta vulgaris 
subsp. vulgaris]
Length=431

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
             NIGTDFIANNQIP IDFAT H+YPDQW+S+ + QS+LAF+ NWL +HIEDSQ IL KPL
Sbjct  260  LNIGTDFIANNQIPGIDFATVHAYPDQWLSNINAQSELAFVNNWLTSHIEDSQNILHKPL  319

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L+AEFGKS KDPGFN  QRD L+ +VY  IYSSAKRGGAAAGGLFWQLLT+G++++ DGY
Sbjct  320  LLAEFGKSEKDPGFNTYQRDQLFASVYSKIYSSAKRGGAAAGGLFWQLLTEGIESYGDGY  379

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
             I+LS+  STA+ I+QQ  KL  I +IFARM+N+   +RA+  R ++
Sbjct  380  AIVLSKNPSTASTIAQQSRKLFLISKIFARMRNVELWKRAREIRNRE  426



>ref|XP_009394803.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
               IGTDFIANN+IP IDFAT HSYPDQW+S++D+QSQLAFL NWL  HI D++ +++KP
Sbjct  251  GLEIGTDFIANNEIPNIDFATIHSYPDQWLSNADEQSQLAFLSNWLGVHIRDARNVIRKP  310

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LLI EFGKSWKDPGF+  QRD L++TVY  IY SA+ GG+AAGGLFWQLL+ GMD++ DG
Sbjct  311  LLITEFGKSWKDPGFSIYQRDTLFKTVYSKIYWSARTGGSAAGGLFWQLLSQGMDSYGDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            Y+I++S+ TSTA +I+QQ  +L  + +++AR++N+ RL +AKA R +Q
Sbjct  371  YQIVMSEGTSTAQIITQQSRQLRYLGKLYARLRNIARLNKAKAVREEQ  418



>ref|XP_004238284.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum lycopersicum]
Length=413

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW++  DD++QL FL NWL  HIEDSQ ILKKP+
Sbjct  249  FQVGTDFIANNQIPEIDFATVHSYPDQWLTGQDDEAQLNFLTNWLKVHIEDSQTILKKPI  308

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            + AEFGK+ K PGF P QRD ++ TVY +I+SSAK GGAAAGGLFW +L +GMD+F+DGY
Sbjct  309  IFAEFGKTTKGPGFTPQQRDVIFNTVYSSIFSSAKGGGAAAGGLFWHVLAEGMDSFKDGY  368

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK  479
            EI+LS+ +S +++I QQ  +L++IR+++AR+KN+ + ++A+
Sbjct  369  EIILSESSSVSDIIIQQSKRLNKIRKMYARLKNIEKWKKAR  409



>gb|ABF69949.1| (1-4)-beta-mannan endohydrolase (mannan endo-1,4-beta-mannosidase), 
putative [Musa acuminata]
Length=428

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFIANNQIP IDFAT HSYPDQW+ +SDDQSQLAFL NWL+ HIED++++L+KP
Sbjct  249  GFQVGTDFIANNQIPGIDFATLHSYPDQWLPNSDDQSQLAFLNNWLDVHIEDARFVLRKP  308

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKS KDPGF+  QRDA++  VY  IYSSA  GGA AG  FWQL+  GMD++RDG
Sbjct  309  LLVTEFGKSSKDPGFSSEQRDAMFGAVYSKIYSSASSGGATAGSCFWQLMAQGMDSYRDG  368

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQI  458
            YE++LS+  ST  +I+ Q  +L  + R+ AR +N+ +L++AKA R KQ+
Sbjct  369  YEVVLSEAPSTTRIITVQSRQLRYLGRLRARERNIAKLKKAKAMREKQL  417



>ref|XP_007017589.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOY14814.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=431

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 135/179 (75%), Gaps = 11/179 (6%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+ SS ++SQ+AFL NWLN HI+D+Q IL+KPL
Sbjct  255  FQVGTDFIANNQIPGIDFATVHSYPDQWLQSSSEESQIAFLNNWLNNHIQDAQNILQKPL  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS K  G  P+QRD L+ TVY  IYSSA+ GG A GGLFWQL  +GMD+FRDGY
Sbjct  315  LFAEFGKSLKISG--PSQRDELFNTVYTAIYSSARGGGTAIGGLFWQLFAEGMDSFRDGY  372

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK---------ANRGKQIGN  452
            E++LS+ TST N+I+Q+  KL++IR+++ R++N+ + ++A+          N G   GN
Sbjct  373  EVILSEGTSTVNIITQESQKLNRIRKMYVRLRNMEKWKKARDIRRAQWWAGNGGSNTGN  431



>ref|XP_006342222.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum tuberosum]
Length=413

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW++  DD++QL FL NWL  HIEDSQ ILKKP+
Sbjct  249  FQVGTDFIANNQIPEIDFATAHSYPDQWLTGQDDEAQLNFLTNWLKVHIEDSQTILKKPI  308

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            + AEFGK+ K PGF P QRD ++ TVY +I+SSAK GGAAAGGLFW +L +GMD+F+DGY
Sbjct  309  IFAEFGKTTKGPGFTPQQRDLIFNTVYSSIFSSAKGGGAAAGGLFWHILAEGMDSFKDGY  368

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK  479
            EI+LS+ +S +++I +Q  +L++IR+++AR+KN+ + ++ +
Sbjct  369  EIILSESSSVSDIIIEQSKRLNKIRKMYARLKNIEKWKKPR  409



>ref|NP_201447.1| mannan endo-1,4-beta-mannosidase 7 [Arabidopsis thaliana]
 sp|Q9FJZ3.1|MAN7_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 7; AltName: Full=Beta-mannanase 
7; AltName: Full=Endo-beta-1,4-mannanase 7; 
Short=AtMAN7; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10922.1| mannan endo-1,4-beta-mannosidase [Arabidopsis thaliana]
 gb|AAN17429.1| mannan endo-1,4-beta-mannosidase [Arabidopsis thaliana]
 gb|AAP49511.1| At5g66460 [Arabidopsis thaliana]
 gb|AED98217.1| mannan endo-1,4-beta-mannosidase 7 [Arabidopsis thaliana]
Length=431

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 132/172 (77%), Gaps = 5/172 (3%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W   S +QSQ+ FL  WL+AHI+D+Q +L KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTVHSYPDEWFPDSSEQSQMDFLNKWLDAHIQDAQNVLHKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K PG+ P QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +G+DNF+DGY I+
Sbjct  320  EFGKSMKKPGYTPAQRDIVFNTVYSKIYGSAKRGGAAAGGLFWQLLVNGIDNFQDGYGII  379

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK-----ANRGKQIGN  452
            LSQ +ST N+ISQQ  KL+ IR+IFARM N+ + +RA+       RG +I N
Sbjct  380  LSQSSSTVNVISQQSRKLTLIRKIFARMINVEKWKRARGQGQVGKRGHKINN  431



>ref|XP_002865067.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41326.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=431

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 131/172 (76%), Gaps = 5/172 (3%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W   S +QSQ+ FL  WL+AHI+D+Q +L KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTVHSYPDEWFPDSSEQSQMDFLNKWLDAHIQDAQNVLHKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K PG+ P QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +G+DNF+DGY I+
Sbjct  320  EFGKSMKKPGYTPAQRDIVFNTVYSKIYGSAKRGGAAAGGLFWQLLVNGIDNFQDGYGII  379

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA-----NRGKQIGN  452
            LSQ +ST N+ISQQ  KL+ IR+IFARM N+ + +RA+       RG  I N
Sbjct  380  LSQSSSTVNVISQQSRKLTLIRKIFARMINVEKWKRARGRGQVRKRGHNIKN  431



>gb|ACU18982.1| unknown [Glycine max]
Length=431

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT H YPDQW+SSS+ Q QL+FL NWL+AH  D+QY +KKP
Sbjct  254  GFNIGTDFIANNRIPAIDFATVHCYPDQWVSSSNIQYQLSFLNNWLSAHFIDAQYHIKKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AEFGKS+K  G +  +RD ++ +VYY IY+SAKRGGAA+G LFWQLLT+GM++F+DG
Sbjct  314  ILVAEFGKSFK--GSSSYERDEVFNSVYYKIYASAKRGGAASGALFWQLLTEGMESFQDG  371

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            Y I+L Q +STANLI++Q  KL  IR+IFAR+ N+ R +RA+A
Sbjct  372  YGIILGQSSSTANLIARQSRKLYLIRKIFARVANMRRWQRARA  414



>ref|XP_003517214.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=431

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT H YPDQW+SSS+ Q QL+FL NWL+AH  D+QY +KKP
Sbjct  254  GFNIGTDFIANNRIPAIDFATVHCYPDQWVSSSNIQYQLSFLNNWLSAHFIDAQYHIKKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AEFGKS+K  G +  +RD ++ +VYY IY+SAKRGGAA+G LFWQLLT+GM++F+DG
Sbjct  314  ILVAEFGKSFK--GSSSYERDEVFNSVYYKIYASAKRGGAASGALFWQLLTEGMESFQDG  371

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            Y I+L Q +STANLI++Q  KL  IR+IFAR+ N+ R +RA+A
Sbjct  372  YGIILGQSSSTANLIARQSRKLYLIRKIFARVANMRRWQRARA  414



>gb|KHN36084.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=431

 Score =   196 bits (497),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             FNIGTDFIANN+IP IDFAT H YPDQW+SSS+ Q QL+FL NWL+AH  D+QY +KKP
Sbjct  254  GFNIGTDFIANNRIPAIDFATVHCYPDQWVSSSNIQYQLSFLNNWLSAHFIDAQYHIKKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AEFGKS+K  G +  +RD ++  VYY IY+SAKRGGAA+G LFWQLLT+GM++F+DG
Sbjct  314  ILVAEFGKSFK--GSSSYERDQVFNAVYYKIYASAKRGGAASGALFWQLLTEGMESFQDG  371

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            Y I+L Q +STANLI++Q  KL  IR+IFAR+ N+ R +RA+A
Sbjct  372  YGIILGQSSSTANLIARQSRKLYLIRKIFARVANMRRWQRARA  414



>ref|XP_006841534.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Amborella trichopoda]
 gb|ERN03209.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
Length=427

 Score =   196 bits (497),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NNQIP IDFAT H+YPDQW+S S DQ+QL+FL++W+ AHIEDS  +LKKP
Sbjct  258  GYKVGTDFISNNQIPGIDFATIHAYPDQWISGSSDQAQLSFLQSWVQAHIEDSNTVLKKP  317

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L  EFGKS K  G+ P  RD L+  VY +IY+SA+ GGA AGGLFWQLL   MDNFRDG
Sbjct  318  MLFTEFGKSSKTQGYTPGLRDTLFAAVYNSIYTSARSGGAGAGGLFWQLLDKDMDNFRDG  377

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            YE+++++  STAN+I+QQ HK+S + R+FA+ +N+ R+  AK+ R  Q
Sbjct  378  YEVIMAESPSTANVIAQQSHKVSSLNRVFAKRRNVHRVEEAKSMRENQ  425



>ref|XP_006279868.1| hypothetical protein CARUB_v10028560mg [Capsella rubella]
 gb|EOA12766.1| hypothetical protein CARUB_v10028560mg [Capsella rubella]
Length=432

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W + S +QSQ+ FL  WL+AHIED+Q +++KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTVHSYPDEWFTDSSEQSQMDFLNKWLDAHIEDAQTVVRKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G+ P QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY I+
Sbjct  320  EFGKSMKKSGYTPAQRDFVFNTVYNKIYGSAKRGGAAAGGLFWQLLGNGMDNFQDGYGII  379

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            LSQ +ST N+ISQQ  KL+ IR+IFARM N+ + +RA+ 
Sbjct  380  LSQSSSTVNVISQQSRKLTLIRKIFARMINVRKWKRARG  418



>ref|XP_009416732.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI NNQIP IDFAT HSYPDQW+ +SDDQSQLAFL NWL+ HIED++ +L+KP
Sbjct  247  GFQVGTDFITNNQIPGIDFATLHSYPDQWLPNSDDQSQLAFLNNWLDVHIEDARDVLRKP  306

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKS KDPGF+  QRDA++  VY  IYSSA  GGA AG  FWQL+  GMD++RDG
Sbjct  307  LLVTEFGKSSKDPGFSSEQRDAMFGAVYSKIYSSASSGGATAGSCFWQLMAQGMDSYRDG  366

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQI  458
            YE++LS+  ST  +I+ Q  +L  + R+ A  +N+ +L++AKA R KQ+
Sbjct  367  YEVVLSEAPSTTRIITVQSRQLRYLGRLRAGERNIAKLKKAKAMREKQL  415



>gb|KFK28321.1| hypothetical protein AALP_AA8G500900 [Arabis alpina]
Length=433

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN++P IDF T HSYPD+W  +S +QSQ+ FL  W++AHI+D+Q +L KP+++A
Sbjct  260  GTDFIANNRVPGIDFVTAHSYPDEWFENSSEQSQMDFLNKWIDAHIQDAQNVLHKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K PG++P QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY I 
Sbjct  320  EFGKSMKKPGYSPAQRDMVFNTVYSKIYGSAKRGGAAAGGLFWQLLGNGMDNFQDGYGIK  379

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            LS+ +ST N+I+QQ  KL+ IR+IFARM N+ + +RA+A
Sbjct  380  LSESSSTVNVIAQQSGKLTLIRKIFARMINVEKWKRARA  418



>ref|XP_006841527.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Amborella trichopoda]
 gb|ERN03202.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
Length=427

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI NNQIP IDFAT H+YPDQW+  S DQ+QL+FL++W+ AHIEDS  +LKKP
Sbjct  258  GYKVGTDFIFNNQIPGIDFATIHAYPDQWIPGSSDQAQLSFLQSWVQAHIEDSNTVLKKP  317

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L  EFGKS K  G+ P  RD L+ TVY +IY+SA+ GGA AGGLFWQLL   MDNFRDG
Sbjct  318  MLFTEFGKSSKTQGYTPGLRDTLFATVYNSIYTSARSGGAGAGGLFWQLLDKDMDNFRDG  377

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            Y++++++  STAN+I+QQ HKLS + R+FA ++N+ R+  AK+ R  Q
Sbjct  378  YDVIMAESPSTANVIAQQSHKLSSLNRMFANLRNMQRVEEAKSIRENQ  425



>gb|AGG82699.1| endo-1,4-beta-mannosidase [Morus alba var. multicaulis]
Length=420

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 127/167 (76%), Gaps = 6/167 (4%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+S S  +SQLAFL+ WL  HI+D+Q +L KP+
Sbjct  248  FQVGTDFIANNQIPGIDFATVHSYPDQWLSGSSSESQLAFLKTWLQEHIQDAQDVLHKPV  307

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS         QRD ++ TVY  IYSSA  GG+A GGLFWQLL+ GMD+FRDGY
Sbjct  308  LFAEFGKS------GANQRDEVFNTVYSAIYSSASAGGSAVGGLFWQLLSQGMDSFRDGY  361

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++L++ +ST  LI+Q+  KL+ IR++FAR++NL +L++AK  R  Q
Sbjct  362  EVVLTESSSTVALIAQESQKLNHIRKMFARLRNLDKLKKAKDVRSAQ  408



>gb|ABV32547.1| endo-1,4-beta-mannosidase protein 1 [Prunus persica]
Length=431

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N F +GTDFIANNQIP IDFAT HSYPDQW+S S  + Q+AFL NW+N HI+D+Q ILKK
Sbjct  251  NYFQVGTDFIANNQIPGIDFATVHSYPDQWLSGSSYEDQVAFLNNWVNDHIQDAQKILKK  310

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+L AEFG+S K+ G+   QRD ++ TVY  IYSSA+ GGAA GGLFWQLL +GMD+F+D
Sbjct  311  PILFAEFGRSLKESGYTTNQRDRIFTTVYSAIYSSARGGGAAVGGLFWQLLAEGMDSFQD  370

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            GY ++LS+ +ST +LIS++  +L +IR+++AR++N+ + +RA+  R  Q
Sbjct  371  GYGVVLSESSSTVSLISEESQRLIKIRKMYARLRNIEKWKRAREIRRAQ  419



>ref|XP_007222385.1| hypothetical protein PRUPE_ppa006029mg [Prunus persica]
 gb|EMJ23584.1| hypothetical protein PRUPE_ppa006029mg [Prunus persica]
Length=431

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N F +GTDFIANNQIP IDFAT HSYPDQW+S S  + Q+AFL NW+N HI+D+Q ILKK
Sbjct  251  NYFQVGTDFIANNQIPGIDFATVHSYPDQWLSGSSYEDQVAFLNNWVNDHIQDAQKILKK  310

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+L AEFG+S K+ G+   QRD ++ TVY  IYSSA+ GGAA GGLFWQLL +GMD+F+D
Sbjct  311  PILFAEFGRSLKESGYTTNQRDRIFTTVYSAIYSSARGGGAAVGGLFWQLLAEGMDSFQD  370

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            GY ++LS+ +ST +LIS++  +L +IR+++AR++N+ + +RA+  R  Q
Sbjct  371  GYGVVLSESSSTVSLISEESQRLIKIRKMYARLRNIEKWKRAREIRRAQ  419



>ref|XP_009785219.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=419

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW++  DD++QL FL +WLN HI+D+Q ILKKPL
Sbjct  252  FLVGTDFIANNQIPEIDFATVHSYPDQWLTGQDDEAQLNFLNDWLNVHIQDAQSILKKPL  311

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            + AEFGK++K  GF P QRD ++ TVY +IY SAK GGAAAGGLFWQLL++GMD +RDGY
Sbjct  312  IFAEFGKTYKGAGFTPEQRDIVFNTVYSSIYWSAKGGGAAAGGLFWQLLSEGMDLYRDGY  371

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRA--KANRG  467
            EI+ S+  S + +I QQ  +L++IR+++AR+ N+ + +RA  K N G
Sbjct  372  EIIFSESPSVSEIILQQSQRLNKIRKMYARLVNVEKWKRARDKINHG  418



>gb|AFY10517.1| endo-beta-1,4-mannanase, partial [Sisymbrium officinale]
Length=299

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T H YPD+W   + +QSQ+ FL  WL+AHI+D+Q +L KP+++A
Sbjct  128  GTDFIANNRIPGIDFVTVHCYPDEWFIDASEQSQMEFLNKWLDAHIQDAQNVLHKPIILA  187

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G+ P QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY I+
Sbjct  188  EFGKSTKKTGYTPAQRDMVFNTVYGKIYGSAKRGGAAAGGLFWQLLGNGMDNFQDGYGII  247

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKAN  473
            L Q +ST NLI+QQ  KL+ IR+IFARM N+ +  RA+ +
Sbjct  248  LDQSSSTVNLIAQQSRKLTLIRKIFARMINVEKWNRARGH  287



>ref|XP_006393839.1| hypothetical protein EUTSA_v10004263mg [Eutrema salsugineum]
 gb|ABB45852.1| hypothetical protein [Eutrema halophilum]
 gb|ESQ31125.1| hypothetical protein EUTSA_v10004263mg [Eutrema salsugineum]
Length=431

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN++P IDF T HSYPD+W   S +Q+Q+ FL  W++AHI+D+Q +L+KP++IA
Sbjct  260  GTDFIANNRVPGIDFVTVHSYPDEWFVDSSEQAQMEFLNKWIDAHIQDAQNVLQKPIIIA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G++P QRD +Y TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY I+
Sbjct  320  EFGKSEKKAGYSPAQRDIVYNTVYSKIYGSAKRGGAAAGGLFWQLLGNGMDNFQDGYGII  379

Query  592  LSQR-TSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANR  470
            LSQR +ST N+I+QQ  KL+ +R+IFARM N+ + +RA   R
Sbjct  380  LSQRSSSTVNVIAQQSRKLTLLRKIFARMINVEKWKRAHQRR  421



>ref|XP_010484638.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Camelina 
sativa]
Length=434

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYILKKPLL  779
            GTDFIANN+IP IDF T HSYPD+W   +S+ +QS++ FL  WLNAHI+D+Q +L+KP++
Sbjct  260  GTDFIANNRIPGIDFVTVHSYPDEWFTDASASEQSKMDFLNKWLNAHIQDAQNVLRKPII  319

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYE  599
            +AEFGKS K  G++P +RD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY 
Sbjct  320  VAEFGKSTKKQGYSPAERDIVFNTVYGKIYESAKRGGAAAGGLFWQLLGNGMDNFQDGYG  379

Query  598  ILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANR  470
            I+L+Q +ST N+I+QQ  KL+ IR+IFARM N+ + +RA+ +R
Sbjct  380  IILNQSSSTVNVIAQQSRKLTLIRKIFARMINVEKWKRARGHR  422



>ref|XP_008220834.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Prunus mume]
Length=431

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+S S  + Q++FL NW+N HI+D+Q ILKKP+
Sbjct  253  FQVGTDFIANNQIPGIDFATVHSYPDQWLSGSSYEDQVSFLNNWVNDHIQDAQNILKKPI  312

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFG+S K+ G+   QRD ++ TVY  IYSSA+ GGAA GGLFWQLL +GMD+F+DGY
Sbjct  313  LFAEFGRSLKESGYTTNQRDQIFTTVYSAIYSSARGGGAAVGGLFWQLLAEGMDSFQDGY  372

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
             I+LS+ +ST +LIS+Q  +L +IR++ AR++N+ + +RA+  R  Q
Sbjct  373  GIVLSESSSTVSLISEQSQRLIKIRKMHARLRNIEKWKRAREIRRAQ  419



>gb|EEC71222.1| hypothetical protein OsI_03157 [Oryza sativa Indica Group]
Length=432

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 6/168 (4%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANNQ+P IDFAT HSYPDQW+S  DDQ+QL F+  WL+AHI D+Q +L+K
Sbjct  264  SGYQLGTDFIANNQVPGIDFATVHSYPDQWLSGKDDQAQLGFMGRWLDAHIADAQAVLRK  323

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLLIAEFGKSWKDPG++  QRDALY TVY  IY SA+RGGA  GGLFWQLL  GMD++RD
Sbjct  324  PLLIAEFGKSWKDPGYSSGQRDALYGTVYAKIYESARRGGATVGGLFWQLLVPGMDSYRD  383

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGK  464
            GYE++  +  ST  +I+    +L  + + FAR       R+A+  RGK
Sbjct  384  GYEVVFGETPSTTGVITTNSRRLRFLSKAFARA------RQAQPARGK  425



>sp|Q0JKM9.2|MAN1_ORYSJ RecName: Full=Mannan endo-1,4-beta-mannosidase 1; AltName: Full=Beta-mannanase 
1; AltName: Full=Endo-beta-1,4-mannanase 1; 
AltName: Full=OsMAN1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB91747.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 gb|EAZ12991.1| hypothetical protein OsJ_02911 [Oryza sativa Japonica Group]
Length=432

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 6/168 (4%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANNQ+P IDFAT HSYPDQW+S  DDQ+QL F+  WL+AHI D+Q +L+K
Sbjct  264  SGYQLGTDFIANNQVPGIDFATVHSYPDQWLSGKDDQAQLGFMGRWLDAHIADAQAVLRK  323

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLLIAEFGKSWKDPG++  QRDALY TVY  IY SA+RGGA  GGLFWQLL  GMD++RD
Sbjct  324  PLLIAEFGKSWKDPGYSSGQRDALYGTVYAKIYESARRGGATVGGLFWQLLVPGMDSYRD  383

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGK  464
            GYE++  +  ST  +I+    +L  + + FAR       R+A+  RGK
Sbjct  384  GYEVVFGETPSTTGVITTNSRRLRFLSKAFARA------RQAQPARGK  425



>ref|XP_009602297.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW++  D ++QL FL +WLN HI+D+Q ILKKPL
Sbjct  252  FLVGTDFIANNQIPEIDFATVHSYPDQWLTGQDGEAQLNFLNDWLNVHIQDAQSILKKPL  311

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            + AEFGK++K  GF   QRD ++ TVY +IY SAK GGAAAGGLFWQLL +GMD++RDGY
Sbjct  312  IFAEFGKTYKGAGFTAEQRDIVFNTVYSSIYWSAKGGGAAAGGLFWQLLAEGMDSYRDGY  371

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK  479
            EI+ S+  S + +I QQ  +L++IR+++AR+ N+ + +RA+
Sbjct  372  EIIFSESPSVSEIILQQSQRLNKIRKMYARLVNIEKWKRAR  412



>ref|XP_010110051.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
 gb|EXC25069.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
Length=420

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 127/167 (76%), Gaps = 6/167 (4%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+SSS  +SQ AFL+ WL  HI+D+Q +L KP+
Sbjct  248  FQVGTDFIANNQIPGIDFATVHSYPDQWLSSSSSESQQAFLKTWLQEHIQDAQDVLHKPV  307

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS         QRD ++ TVY  IYSSA  GG+A GGLFWQLL+ GMD+FRDGY
Sbjct  308  LFAEFGKS------GANQRDEVFNTVYSAIYSSASAGGSAVGGLFWQLLSQGMDSFRDGY  361

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++L++ +ST  LI+Q+  KL+ IR++FAR++NL +L+RAK  R  Q
Sbjct  362  EVILTESSSTVALIAQESQKLNHIRKMFARLRNLDKLKRAKDVRSAQ  408



>emb|CDX81394.1| BnaC09g08050D [Brassica napus]
Length=1046

 Score =   197 bits (501),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 97/159 (61%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W   + +Q Q+ FL  WL+AHI+D+Q +L+KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTAHSYPDEWFIDASEQFQMEFLNKWLDAHIQDAQNVLRKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G++P QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY I+
Sbjct  320  EFGKSTKKAGYSPAQRDVVFNTVYTKIYESAKRGGAAAGGLFWQLLGNGMDNFQDGYGII  379

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            L Q +ST N+I+QQ  KL+ IR+IFARM N+ + +RA+ 
Sbjct  380  LGQSSSTVNVIAQQSRKLTLIRKIFARMINVEKWKRARG  418



>ref|XP_010444793.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Camelina sativa]
Length=434

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYILKKPLL  779
            GTDFIANN+IP IDFAT HSYPD+W   +S+ +QS++ FL  WL+AHI+D+Q +L+KP++
Sbjct  260  GTDFIANNRIPGIDFATVHSYPDEWFTDASASEQSKMDFLNKWLDAHIQDAQNVLRKPII  319

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYE  599
            +AEFGKS K  G++P +RD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY 
Sbjct  320  VAEFGKSTKKQGYSPAERDIVFNTVYGKIYESAKRGGAAAGGLFWQLLGNGMDNFQDGYG  379

Query  598  ILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKAN  473
            I+L+Q +ST N+I+QQ  KL+ IR+IFARM N+ + +RA+ +
Sbjct  380  IILNQSSSTVNVIAQQSRKLTLIRKIFARMINVEKWKRARGH  421



>ref|XP_010061294.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Eucalyptus 
grandis]
Length=426

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            +F +GTDFI NNQIP IDFAT HSYPDQW+S     +Q++FL NW+N HI+D+Q +L KP
Sbjct  257  SFLVGTDFIENNQIPGIDFATVHSYPDQWLSDPSVGNQISFLSNWVNTHIQDAQNVLHKP  316

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL AEFG S KD G+N  +RD  + TVY  IYSSA+ GGAAAG +FWQLLT GMD++RDG
Sbjct  317  LLFAEFGISSKDSGYNQNERDQFFDTVYSAIYSSARGGGAAAGSMFWQLLTVGMDSYRDG  376

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQIGN  452
            YEI+LS+  STA++I+QQ  KL++IR+++AR+KN+   ++A  NR    GN
Sbjct  377  YEIVLSESPSTASVIAQQSQKLNKIRKMYARLKNIEEWKKAN-NRRNDGGN  426



>gb|KDP38537.1| hypothetical protein JCGZ_04462 [Jatropha curcas]
Length=431

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F IGTDFIANNQIP IDFAT HSYPDQW+ +S+ + Q +FL NWLN HI+D+Q IL KP+
Sbjct  255  FQIGTDFIANNQIPGIDFATVHSYPDQWLPNSNTEGQESFLNNWLNNHIQDAQNILHKPV  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS +   +N  QRD L+ T+Y  IYSSA+ GGAAAGG+FWQL+T+GMD+FRDGY
Sbjct  315  LFAEFGKSSRTAAYN--QRDQLFTTIYSAIYSSARGGGAAAGGMFWQLMTEGMDSFRDGY  372

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++ S+  STA++I  Q  KL++IR+++AR++N+ +  RA+  R  Q
Sbjct  373  EVVFSENPSTASIIVDQSQKLNKIRKMYARLRNIEKWNRAREIRQAQ  419



>ref|NP_001280873.1| mannan endo-1,4-beta-mannosidase 7-like precursor [Malus domestica]
 gb|ACN78664.1| endo-beta-mannanase [Malus domestica]
Length=429

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N + IGTDF+ANNQIP IDFAT HSYPDQW++ S  + Q++FL +W+N HI D+Q ILKK
Sbjct  249  NYYQIGTDFLANNQIPGIDFATVHSYPDQWLNGSSYEDQVSFLNSWVNDHIHDAQNILKK  308

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+L AEFG+S K+ G+   QRD ++ TVY  IYSSA+ GG A GGLFWQLL  GMD+F+D
Sbjct  309  PVLFAEFGRSLKESGYTINQRDRIFTTVYSGIYSSARGGGPAVGGLFWQLLAQGMDSFQD  368

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            GY ++LS+ +ST  LI+++  KL +IR+++AR++N+ + +RA+  R  Q
Sbjct  369  GYGVVLSESSSTVGLIAEESQKLIKIRKMYARLRNIEKWKRAREIRRDQ  417



>ref|XP_009365114.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N + IGTDF+ANNQIP IDFAT HSYPDQW++ S  + Q++FL +W+N HI D+Q ILKK
Sbjct  249  NYYQIGTDFLANNQIPGIDFATVHSYPDQWLTGSSYEDQVSFLNSWVNDHIHDAQNILKK  308

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+L AEFG+S K+ G+   QRD ++ TVY  IYSSA+ GG A GGLFWQLL  GMD+F+D
Sbjct  309  PVLFAEFGRSLKESGYTINQRDRIFTTVYSGIYSSARGGGPAVGGLFWQLLAQGMDSFQD  368

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            GY ++LS+ +ST  LI+++  KL +IR+++AR++N+ + +RA+  R  Q
Sbjct  369  GYGVVLSEGSSTVGLIAEESRKLIKIRKMYARLRNMEKWKRAREIRRDQ  417



>ref|XP_009336054.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N + IGTDF+ANNQIP IDFAT HSYPDQW++ S  + Q++FL +W+N HI D+Q ILKK
Sbjct  249  NYYQIGTDFLANNQIPGIDFATVHSYPDQWLTGSSYEDQVSFLNSWVNDHIHDAQNILKK  308

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+L AEFG+S K+ G+   QRD ++ TVY  IYSSA+ GG A GGLFWQLL  GMD+F+D
Sbjct  309  PVLFAEFGRSLKESGYTINQRDRIFTTVYSGIYSSARGGGPAVGGLFWQLLAQGMDSFQD  368

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            GY ++LS+ +ST  LI+++  KL +IR+++AR++N+ + +RA+  R  Q
Sbjct  369  GYGVVLSEGSSTVGLIAEESRKLIKIRKMYARLRNIEKWKRAREIRRDQ  417



>gb|ADN34185.1| endo-beta-mannanase [Cucumis melo subsp. melo]
Length=425

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+S S  ++QL+FL  WLN HI+D+Q IL KP+
Sbjct  248  FQVGTDFIANNQIPEIDFATVHSYPDQWLSGSSYENQLSFLNTWLNDHIQDAQNILHKPV  307

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS K  G +  QRD L+  VY  +YSSA+ GGAA GG+FWQLL +GMD+FRDGY
Sbjct  308  LFAEFGKSIKYSGAD--QRDQLFNAVYSAVYSSARGGGAAIGGMFWQLLVEGMDSFRDGY  365

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++LS+  STANLI+Q+  +L  IRR++A+++N+ + +RAK  +  Q
Sbjct  366  EVVLSESPSTANLITQESRRLIHIRRMYAKLRNIEKWKRAKEMKKAQ  412



>gb|KCW68225.1| hypothetical protein EUGRSUZ_F01879 [Eucalyptus grandis]
Length=464

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            +F +GTDFI NNQIP IDFAT HSYPDQW+S     +Q++FL NW+N HI+D+Q +L KP
Sbjct  295  SFLVGTDFIENNQIPGIDFATVHSYPDQWLSDPSVGNQISFLSNWVNTHIQDAQNVLHKP  354

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL AEFG S KD G+N  +RD  + TVY  IYSSA+ GGAAAG +FWQLLT GMD++RDG
Sbjct  355  LLFAEFGISSKDSGYNQNERDQFFDTVYSAIYSSARGGGAAAGSMFWQLLTVGMDSYRDG  414

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQIGN  452
            YEI+LS+  STA++I+QQ  KL++IR+++AR+KN+   ++A  NR    GN
Sbjct  415  YEIVLSESPSTASVIAQQSQKLNKIRKMYARLKNIEEWKKAN-NRRNDGGN  464



>ref|XP_004147857.2| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Cucumis sativus]
 gb|KGN59983.1| hypothetical protein Csa_3G859700 [Cucumis sativus]
Length=425

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+S S  ++QL+FL  WLN HI+D+Q IL KP+
Sbjct  248  FQVGTDFIANNQIPEIDFATVHSYPDQWLSGSSYENQLSFLNTWLNDHIQDAQNILHKPV  307

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS K  G +  QRD L+  VY  +YSSA+ GGAA GG+FWQLL +GMD+FRDGY
Sbjct  308  LFAEFGKSTKYSGAD--QRDQLFNAVYSAVYSSARGGGAAIGGMFWQLLVEGMDSFRDGY  365

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK  479
            E++LS+  STANLI+Q+  +L  IRR++A+++N+ + +RAK
Sbjct  366  EVVLSESPSTANLITQESRRLIHIRRMYAKLRNIEKWKRAK  406



>gb|ACN78666.1| endo-beta-mannanase [Vaccinium corymbosum]
Length=425

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPD W+    D+SQL+FL +W++ HI+D+Q  L KPL
Sbjct  253  FQVGTDFIANNQIPGIDFATVHSYPDVWLEGKSDESQLSFLNSWVDNHIQDAQNTLGKPL  312

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDN--FRD  608
            L  EFGKS KDPGFN  +RD ++ TVY  IYSSAK GGAAAGGLFWQLL +GM++    D
Sbjct  313  LFTEFGKSSKDPGFNTNKRDTMFNTVYSAIYSSAKGGGAAAGGLFWQLLGEGMESLGLGD  372

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK-ANRGKQIGN  452
            GYEI+LS+ +ST  L++Q+  KL  IRR++A ++N+   + A+   RG  +GN
Sbjct  373  GYEIVLSESSSTVGLVTQESQKLKNIRRMYAHLRNVEIWKSARDTKRGGNVGN  425



>ref|XP_006435034.1| hypothetical protein CICLE_v10001262mg [Citrus clementina]
 gb|ESR48274.1| hypothetical protein CICLE_v10001262mg [Citrus clementina]
Length=425

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP+IDFAT HSYPDQW+ SS D+SQ++FL NWL  HI+D+Q IL+KP+
Sbjct  249  FQVGTDFIANNQIPSIDFATLHSYPDQWLPSSSDESQISFLNNWLYNHIQDAQDILRKPI  308

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L+AEFGKS K  G N  QRD L+ TVY  IYSSA+ GGAA GG+FWQL T+G+D++RDGY
Sbjct  309  LLAEFGKSLKTSGAN--QRDQLFDTVYSAIYSSARSGGAAVGGMFWQLFTEGLDSYRDGY  366

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++ S+  STA +I+ Q  KL++IR+++ R++N+ + +RA+  R  Q
Sbjct  367  EVIFSENPSTATIITDQSQKLNRIRKMYVRLRNVQKWKRARDIRRAQ  413



>ref|XP_009112304.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Brassica 
rapa]
Length=431

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W   + +Q Q+ FL  W++AHI+D+Q +L+KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTAHSYPDEWFVDASEQFQMEFLNKWVDAHIQDAQNVLRKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G++  QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY I+
Sbjct  320  EFGKSTKKAGYSSAQRDLVFNTVYTKIYESAKRGGAAAGGLFWQLLGNGMDNFQDGYGII  379

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            L Q +ST N+I+QQ  KL+ IR+IFARM ++ + +RA+ 
Sbjct  380  LGQSSSTVNVIAQQSRKLTLIRKIFARMIDVEKWKRARG  418



>gb|KEH36174.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=410

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIPTIDFAT HSYPDQW+S+S  + Q++FLR WLN HI+D+Q IL KPL
Sbjct  249  FQVGTDFIANNQIPTIDFATLHSYPDQWLSNSGYEDQISFLRGWLNEHIQDAQNILHKPL  308

Query  781  LIAEFGKSWKDPGF--NPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            L AEFG S K+ G   N T+RD  + TVY  IYSSA  GG A GGLFWQLL +GMD+FRD
Sbjct  309  LFAEFGISSKNLGSSNNSTKRDQFFNTVYSAIYSSASGGGTAVGGLFWQLLAEGMDSFRD  368

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGR  494
             YE++L++  STA LI+Q+  KL +IR+++AR+KN+ +
Sbjct  369  DYEVILAESPSTATLIAQESQKLKRIRKMYARLKNIDK  406



>ref|XP_009365529.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N + IGTDFIANNQIP IDFAT H+YPDQW++ S  + Q++FL +W++ HI+D+Q ILKK
Sbjct  249  NNYPIGTDFIANNQIPDIDFATVHAYPDQWLTGSSYEDQVSFLNSWVSGHIQDAQNILKK  308

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+L AEFG+S K+ G+  +QRD ++  VY  IYSSA+ GGAA GGLFWQLL +GMDNF+D
Sbjct  309  PVLFAEFGRSLKESGYTTSQRDRMFTVVYLGIYSSARGGGAAVGGLFWQLLAEGMDNFQD  368

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK  479
            GY ++LS+ +ST  LI+++  KL++IR+ +AR++N+ + +RA+
Sbjct  369  GYGVVLSESSSTVGLIAEESRKLNEIRKKYARLRNIEKWKRAR  411



>ref|XP_009406291.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 125/168 (74%), Gaps = 10/168 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI+NNQIP IDFAT HSYPDQW+  S+D+SQL+FL+NWL+ H+ D+  +L+KP
Sbjct  251  GFQVGTDFISNNQIPGIDFATVHSYPDQWIPDSNDRSQLSFLKNWLDIHLHDACDVLQKP  310

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFGKS KDPGF+  +RDA++RTVY  +Y SA+ GGA AG LFWQLL  GMD++RDG
Sbjct  311  LLVTEFGKSCKDPGFSNDERDAMFRTVYSKVYLSARTGGATAGSLFWQLLAQGMDSYRDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            YE++L +  ST  +I+ Q HKL          + + +L+RAKA +GK 
Sbjct  371  YEVILGESPSTTRVITLQSHKL----------RTIAKLKRAKAMKGKH  408



>ref|XP_008466539.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis melo]
Length=476

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+S S  ++QL+FL  WLN HI+D+Q IL KP+
Sbjct  299  FQVGTDFIANNQIPEIDFATVHSYPDQWLSGSSYENQLSFLNTWLNDHIQDAQNILHKPV  358

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS K  G +  QRD L+  VY  +YSSA+ GGAA GG+FWQLL +GMD+FRDGY
Sbjct  359  LFAEFGKSIKYSGAD--QRDQLFNAVYSAVYSSARGGGAAIGGMFWQLLVEGMDSFRDGY  416

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++LS+  STANLI+Q+  +L  IRR++A+++N+ + +RAK  +  Q
Sbjct  417  EVVLSESPSTANLITQESRRLIHIRRMYAKLRNIEKWKRAKEMKKAQ  463



>ref|XP_002510418.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF52605.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=432

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 131/167 (78%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F IGTDF+ANNQIP IDFAT HSYPDQW+ S+DD+SQ +FL +WLN HI+D+Q IL KP+
Sbjct  256  FQIGTDFVANNQIPDIDFATVHSYPDQWLPSADDESQQSFLNDWLNNHIQDAQNILHKPV  315

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS +   +N  QRD L+ TVY+ IYSSA+ GGAAAGG+FWQL T GMD+FRDGY
Sbjct  316  LFAEFGKSSRTAAYN--QRDQLFNTVYWAIYSSARGGGAAAGGMFWQLFTGGMDSFRDGY  373

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++ ++  STA +I+ Q  KL++IR+++AR++N+ +  RA+  R  Q
Sbjct  374  EVVFNENPSTAGIIADQSQKLNKIRKMYARLRNIEKWNRARQIRTAQ  420



>emb|CDY18606.1| BnaA09g07890D [Brassica napus]
Length=1113

 Score =   193 bits (490),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W   + +Q Q+ FL  W++AHI+D+Q +L+KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTAHSYPDEWFIDASEQFQMEFLNKWVDAHIQDAQNVLRKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G++P QRD ++ TVY  IY SAKRGGAAAGGLFWQLL  GMDNF+DGY I+
Sbjct  320  EFGKSTKKAGYSPAQRDLVFNTVYTKIYESAKRGGAAAGGLFWQLLGSGMDNFQDGYGII  379

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            L Q +ST N+I+QQ  KL+ IR+IFARM N+ + +RA+ 
Sbjct  380  LGQSSSTVNVIAQQSRKLTLIRKIFARMINVEKWKRARG  418



>ref|XP_010465469.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Camelina 
sativa]
Length=433

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqs--QLAFLRNWLNAHIEDSQYILKKPLL  779
            GTDFIANN+IP IDFAT HSYPD+W + +      ++ FL  W++AHI+D+Q +L+KP++
Sbjct  261  GTDFIANNRIPGIDFATVHSYPDEWFTDASASEQFKMDFLNKWIDAHIQDAQNVLRKPII  320

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYE  599
            +AEFGKS K  G++  +RD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY 
Sbjct  321  VAEFGKSMKKQGYSSAERDIVFNTVYSKIYESAKRGGAAAGGLFWQLLGNGMDNFQDGYG  380

Query  598  ILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKAN  473
            I+L+Q +ST N+I+QQ  KL+ IR+IFARM N+ + +RA+ +
Sbjct  381  IILNQSSSTVNVIAQQSRKLTLIRKIFARMINVEKWKRARGH  422



>ref|XP_009103527.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Brassica rapa]
Length=426

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W   S +QSQ+ FL  WL+AHI+D+Q +L KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTVHSYPDEWFVDSSEQSQMEFLNKWLDAHIQDAQNVLHKPIIVA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G    QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY I+
Sbjct  320  EFGKSTKKAG--SAQRDLVFNTVYGKIYESAKRGGAAAGGLFWQLLGNGMDNFQDGYGII  377

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            LSQ +ST N+I+QQ  KL+ IRRIFARM N+ + +RA+ 
Sbjct  378  LSQSSSTVNVIAQQSRKLTLIRRIFARMINVEKWKRARG  416



>ref|XP_006644473.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Oryza brachyantha]
Length=430

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 124/167 (74%), Gaps = 2/167 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANNQ+P +DFAT HSYPDQW+SS D+Q+QL F+ +WL+AHI D+Q +L+K
Sbjct  264  SGYQLGTDFIANNQVPGVDFATVHSYPDQWLSSKDEQAQLTFMGSWLDAHIADAQAVLRK  323

Query  787  PLLIAEFGKSWKDPGFNP-TQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFR  611
            PLLIAEFGKSWKDPG++   QRDALY  VY  IY SA+RGGA  GGLFWQL+  GMD++R
Sbjct  324  PLLIAEFGKSWKDPGYSSGGQRDALYGVVYAKIYESARRGGATVGGLFWQLMVAGMDSYR  383

Query  610  DGYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL-GRLRRAKAN  473
            DGYE++  +  ST  +I+    +L  + + FAR + + G+ R    N
Sbjct  384  DGYEVVFGETPSTTGVITTNSRRLRFLSKAFARARQVRGKGRHNGGN  430



>emb|CDP07490.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F  GTDFIA+NQI  IDFAT HSYPD W++   +++QL+FL NWL +HI+D++ IL+KPL
Sbjct  257  FQAGTDFIASNQIKDIDFATVHSYPDAWLAGQSEEAQLSFLINWLQSHIQDAEKILQKPL  316

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L  EFGKS KDPGFN  QRD L+ TVY TIYSSA  GGAAAGGLFWQ LT+GMD  RDGY
Sbjct  317  LFTEFGKSSKDPGFNMNQRDLLFNTVYSTIYSSASGGGAAAGGLFWQFLTEGMDPLRDGY  376

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQIG  455
            E++LS+ +STA++I QQ  +L++IRR+++R  N+   + A+   G  +G
Sbjct  377  EVILSESSSTASIIVQQSRRLNKIRRMYSRNSNVLPKKEARNYDGDNLG  425



>ref|XP_010550422.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Tarenaya hassleriana]
Length=426

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  958  NIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLL  779
            N+GTDFIANN++P IDF T HSYPDQW+  S+D+SQL FL  WL+AHI+D+Q +L+KP+L
Sbjct  258  NVGTDFIANNRVPGIDFVTVHSYPDQWLPYSNDESQLDFLNKWLDAHIQDAQNVLQKPVL  317

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYE  599
            +AEFGKS   PGF   +RD ++ TVY  IY+SAK  GAAAGGLFWQLLT+ MDNF+DGY 
Sbjct  318  MAEFGKSTHAPGFCLDKRDTIFNTVYGKIYASAKGQGAAAGGLFWQLLTESMDNFQDGYG  377

Query  598  ILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQIG  455
            I+LS+ +ST N+ISQQ  KL  IRR+FARM+N+   +RA+    K  G
Sbjct  378  IVLSEGSSTVNVISQQSRKLGLIRRMFARMRNVEIWKRARNGAKKVWG  425



>gb|KJB58235.1| hypothetical protein B456_009G200500 [Gossypium raimondii]
 gb|KJB58236.1| hypothetical protein B456_009G200500 [Gossypium raimondii]
Length=431

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+ SS D+SQ+AFL NWL  HI+D+Q IL+KPL
Sbjct  255  FQVGTDFIANNQIPGIDFATVHSYPDQWLQSSSDESQIAFLNNWLYNHIQDAQNILQKPL  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS K  G  P QRD LY TVY  IYSSA+ GGAA GGLFWQLL +GMD++ DGY
Sbjct  315  LFAEFGKSLKIAG--PNQRDELYNTVYTAIYSSARGGGAAIGGLFWQLLAEGMDSYGDGY  372

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E+++SQ TS  +LI+++  KL++IR+++ R++++ +  +A+  R  Q
Sbjct  373  EVIMSQGTSIVDLITRESQKLNRIRKMYVRLRDIEKWNKAREIRRAQ  419



>ref|XP_009395690.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIANN+IP IDFAT H YPDQW+S+S+DQSQLAFL NW++ HI D++  L+KPLL+
Sbjct  255  VGTDFIANNRIPNIDFATIHVYPDQWLSASNDQSQLAFLSNWIDVHIRDARDALRKPLLV  314

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS KDPGF+  QRDAL++TVY  IY SA+ GG+AAGG FWQLL++GM ++ DGYEI
Sbjct  315  TEFGKSSKDPGFSVGQRDALFKTVYSKIYWSARSGGSAAGGFFWQLLSEGMGSYGDGYEI  374

Query  595  LLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            +LS+ +STA +I+ Q  +L  + + +AR +N+ +L +AKA R ++
Sbjct  375  VLSEGSSTARIIALQSRQLRYLGKWYARQRNVAKLNKAKAMREEE  419



>ref|XP_004291857.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Fragaria 
vesca subsp. vesca]
Length=433

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW++ S+ + Q++FL +W+N HI+D+Q IL KP+
Sbjct  255  FQVGTDFIANNQIPGIDFATVHSYPDQWLTGSNYEDQVSFLSSWVNDHIQDAQNILHKPV  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFG+S K+ G+  +QRD ++ T+Y  IYSSA+ GGAA GGLFWQLL +GMD+F+DGY
Sbjct  315  LFAEFGRSLKESGYTTSQRDQIFNTLYSAIYSSARGGGAAVGGLFWQLLAEGMDSFQDGY  374

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
             ++LS+ +ST  +I+++  +L +IR+++AR++N+ + +RA+  R  Q
Sbjct  375  GVVLSESSSTVGIIAEESQRLIKIRKMYARLRNIEKWKRARDIRRAQ  421



>ref|XP_006590697.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like isoform X3 
[Glycine max]
Length=358

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F+IGTDFI NN+IP IDFAT H YPDQW+SSS+ Q QL+FL NWL+AH  D+QY +KKP
Sbjct  187  GFDIGTDFIGNNRIPAIDFATVHCYPDQWVSSSNIQYQLSFLNNWLSAHFIDAQYRIKKP  246

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AEFGKS+K    +  +RD ++ +VYY IY+SAKRGGAA+G LFWQLLT+GM++F+DG
Sbjct  247  ILVAEFGKSFKS--SSSYERDEVFNSVYYKIYASAKRGGAASGALFWQLLTEGMESFQDG  304

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---NRGKQIGN  452
            Y I+L Q +STANLI++Q  KL  IR+IFAR+ N+ R +RA+A   N G+ IGN
Sbjct  305  YGIILGQSSSTANLIARQSRKLYLIRKIFARVANMRRWQRARARGGNGGRYIGN  358



>emb|CDY68324.1| BnaCnng58510D [Brassica napus]
Length=823

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 126/159 (79%), Gaps = 2/159 (1%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W   S++QSQ+ FL  WL+AHI+D+Q +L KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTVHSYPDEWFVDSNEQSQMEFLNKWLDAHIQDAQNVLHKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G    QRDA++ TVY  IY SAKRGG+AAGGLFWQLL +GMDNF+DGY I+
Sbjct  320  EFGKSTKKAG--SAQRDAVFNTVYGKIYESAKRGGSAAGGLFWQLLGNGMDNFQDGYGII  377

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            LSQ +ST N+I+QQ  KL+ IRRIFARM N+ + +RA+ 
Sbjct  378  LSQSSSTVNVIAQQSRKLTLIRRIFARMINVEKWKRARG  416



>gb|ACN78663.1| endo-beta-mannanase, partial [Malus domestica]
Length=428

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N + IGTDFIANNQI  IDFAT H+YPDQW++ +  + Q++FL +W++ HI+D+Q ILKK
Sbjct  248  NNYQIGTDFIANNQIRDIDFATVHAYPDQWLTGAGYEDQVSFLNSWVSGHIQDAQNILKK  307

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+L AEFG+S K+ G+  +QRD ++  VY  IYSSA+ GGAA GGLFWQLL + MDNF+D
Sbjct  308  PVLFAEFGRSLKESGYTTSQRDRIFTIVYSGIYSSARGGGAAVGGLFWQLLAEEMDNFQD  367

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANR  470
            GY I+LS+ +ST  LI+++  KL++IR+++AR+KN+ + +RA+  R
Sbjct  368  GYGIVLSESSSTVGLIAEESRKLNEIRKMYARLKNIEKWKRAREVR  413



>emb|CDY45231.1| BnaA07g12590D [Brassica napus]
Length=469

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANN+IP IDF T HSYPD+W   S DQSQ+ FL  WL+AHI+D+Q +L KP+++A
Sbjct  260  GTDFIANNRIPGIDFVTVHSYPDEWFVDSSDQSQMEFLNKWLDAHIQDAQNVLHKPIILA  319

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K  G    QRD ++ TVY  IY SAKRGGAAAGGLFWQLL +GMDNF+DGY I+
Sbjct  320  EFGKSTKKGG--SAQRDLVFNTVYGKIYESAKRGGAAAGGLFWQLLGNGMDNFQDGYGII  377

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
            LSQ +ST N+I+QQ  KL+ IRRIFARM N+ + +RA+ 
Sbjct  378  LSQSSSTVNVIAQQSRKLTLIRRIFARMINVEKWKRARG  416



>ref|XP_006473535.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Citrus sinensis]
Length=425

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+ SS D+SQ +FL NWL  HI+D+Q  L+KP+
Sbjct  249  FQVGTDFIANNQIPGIDFATLHSYPDQWLPSSSDESQTSFLNNWLYNHIQDAQDTLRKPI  308

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L+AEFGKS K  G N  QRD L+ TVY  IYSSA+ GGAA GG+FWQL T+G+D++RDGY
Sbjct  309  LLAEFGKSLKTSGAN--QRDQLFDTVYSAIYSSARSGGAAVGGMFWQLFTEGLDSYRDGY  366

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++ S+  STA +I+ Q  KL++IR+++ R++N+ + +RA+  R  Q
Sbjct  367  EVIFSENPSTATIITDQSQKLNRIRKMYVRLRNVQKWKRARDIRRAQ  413



>ref|XP_003537602.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like isoform X1 
[Glycine max]
 gb|KHN41948.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=425

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 5/174 (3%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F+IGTDFI NN+IP IDFAT H YPDQW+SSS+ Q QL+FL NWL+AH  D+QY +KKP
Sbjct  254  GFDIGTDFIGNNRIPAIDFATVHCYPDQWVSSSNIQYQLSFLNNWLSAHFIDAQYRIKKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AE          +  +RD ++ +VYY IY+SAKRGGAA+G LFWQLLT+GM++F+DG
Sbjct  314  ILVAE--FGKSFKSSSSYERDEVFNSVYYKIYASAKRGGAASGALFWQLLTEGMESFQDG  371

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---NRGKQIGN  452
            Y I+L Q +STANLI++Q  KL  IR+IFAR+ N+ R +RA+A   N G+ IGN
Sbjct  372  YGIILGQSSSTANLIARQSRKLYLIRKIFARVANMRRWQRARARGGNGGRYIGN  425



>ref|XP_006590696.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like isoform X2 
[Glycine max]
Length=423

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 5/174 (3%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F+IGTDFI NN+IP IDFAT H YPDQW+SSS+ Q QL+FL NWL+AH  D+QY +KKP
Sbjct  252  GFDIGTDFIGNNRIPAIDFATVHCYPDQWVSSSNIQYQLSFLNNWLSAHFIDAQYRIKKP  311

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AE          +  +RD ++ +VYY IY+SAKRGGAA+G LFWQLLT+GM++F+DG
Sbjct  312  ILVAE--FGKSFKSSSSYERDEVFNSVYYKIYASAKRGGAASGALFWQLLTEGMESFQDG  369

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA---NRGKQIGN  452
            Y I+L Q +STANLI++Q  KL  IR+IFAR+ N+ R +RA+A   N G+ IGN
Sbjct  370  YGIILGQSSSTANLIARQSRKLYLIRKIFARVANMRRWQRARARGGNGGRYIGN  423



>gb|KDO84614.1| hypothetical protein CISIN_1g014426mg [Citrus sinensis]
Length=425

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 128/167 (77%), Gaps = 2/167 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+ SS D+SQ +FL NWL  HI+D+Q  L+KP+
Sbjct  249  FQVGTDFIANNQIPGIDFATLHSYPDQWLPSSSDESQTSFLNNWLYNHIQDAQDTLRKPI  308

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L+AEFGKS K  G N  QRD L+ TVY  IY SA+ GGAA GG+FWQL T+G+D++RDGY
Sbjct  309  LLAEFGKSLKTSGAN--QRDQLFDTVYSAIYLSARSGGAAVGGMFWQLFTEGLDSYRDGY  366

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++ S+  STA +I+ Q  KL+++R+++ R++N+ + +RA+  R  Q
Sbjct  367  EVIFSENPSTATIITDQSQKLNRLRKMYVRLRNVQKWKRARDIRRAQ  413



>ref|XP_003528027.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=420

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            FN+GTDFIANNQIP IDFAT HSYPDQW+SSS  + Q++FL  WLN HI+D+Q  L KPL
Sbjct  256  FNVGTDFIANNQIPGIDFATVHSYPDQWISSSGYEDQISFLGRWLNEHIQDAQNTLHKPL  315

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFG S K  G N T RD L+ TVY  IYSSA  GGAA GGLFWQL+  GMD++RDGY
Sbjct  316  LFAEFGISTKSYGGNSTPRDRLFNTVYSAIYSSASSGGAAVGGLFWQLMAQGMDSYRDGY  375

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRG  467
            E++L +  STANLI+Q+  KL++IR+++AR++N+ +   AK  RG
Sbjct  376  EVVLDESPSTANLIAQESQKLNRIRKMYARLRNIEKWNEAKQIRG  420



>ref|XP_009407087.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Musa 
acuminata subsp. malaccensis]
Length=395

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFIANNQ+P IDFAT H+YPDQW+  S+D  QLAFLR+W+ +HI+D+  IL KP
Sbjct  242  GYEVGTDFIANNQVPGIDFATIHAYPDQWVPGSNDDGQLAFLRSWIQSHIQDAGSILGKP  301

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++ EFGKS +  G+  ++RDA Y T+Y  IY+SAK GG  AGGLFWQLL  GMD+FRDG
Sbjct  302  LMVTEFGKSSRQAGYTVSKRDAFYATIYDAIYASAKAGGPCAGGLFWQLLAQGMDSFRDG  361

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIF  518
            YEI+ ++  ST ++IS+Q H++S +R+IF
Sbjct  362  YEIIFAESPSTTSIISRQSHRISNLRKIF  390



>ref|NP_001241893.1| uncharacterized protein LOC100814337 precursor [Glycine max]
 gb|ACU17987.1| unknown [Glycine max]
Length=418

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            FN+GTDFIANNQIP IDFAT HSYPDQW+SSS  + Q++FL  WL+ HI+D+Q  L KPL
Sbjct  252  FNVGTDFIANNQIPGIDFATVHSYPDQWLSSSSYEDQISFLGRWLDEHIQDAQNTLHKPL  311

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFG S K  G N T RD L+ TVY  IYSSA  GGAA GGLFWQL+  GMD++RDGY
Sbjct  312  LFAEFGISTKSYGGNSTPRDRLFNTVYSAIYSSASSGGAAVGGLFWQLMVQGMDSYRDGY  371

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRG  467
            E++L +  STANLI+Q+  KL++IR+++AR++N+ +   AK  RG
Sbjct  372  EVVLDESPSTANLIAQESQKLNRIRKMYARLRNIEKWNEAKQIRG  416



>gb|KHN45867.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=417

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            FN+GTDFIANNQIP IDFAT HSYPDQW+SSS  + Q++FL  WL+ HI+D+Q  L KPL
Sbjct  251  FNVGTDFIANNQIPGIDFATVHSYPDQWLSSSSYEDQISFLGRWLDEHIQDAQNTLHKPL  310

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFG S K  G N T RD L+ TVY  IYSSA  GGAA GGLFWQL+  GMD++RDGY
Sbjct  311  LFAEFGISTKSYGGNSTPRDRLFNTVYSAIYSSASSGGAAVGGLFWQLMVQGMDSYRDGY  370

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRG  467
            E++L +  STANLI+Q+  KL++IR+++AR++N+ +   AK  RG
Sbjct  371  EVVLDESPSTANLIAQESQKLNRIRKMYARLRNIEKWNEAKQIRG  415



>ref|XP_007156980.1| hypothetical protein PHAVU_002G033500g [Phaseolus vulgaris]
 gb|ESW28974.1| hypothetical protein PHAVU_002G033500g [Phaseolus vulgaris]
Length=431

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F+IGTDFIANN+I  IDFAT H YPDQW+SSS+DQ QL+FL +WL+AH  D+QY ++KP
Sbjct  254  GFDIGTDFIANNRISDIDFATVHCYPDQWVSSSNDQYQLSFLNSWLSAHFMDAQYAIRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L+AEFGKS K   +   +RD ++  VYY IY+SAKRGGAA G LFWQLLT GM++F+DG
Sbjct  314  VLVAEFGKSLKGSAY---ERDEVFNAVYYRIYASAKRGGAAGGALFWQLLTGGMESFQDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL  500
            Y I+L Q +STA+LI++Q  KL  IR+IFAR+ N+
Sbjct  371  YGIMLGQSSSTADLIARQSRKLFLIRKIFARVANM  405



>gb|ACL52784.1| unknown [Zea mays]
Length=229

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANN+ P IDFAT HSYPDQW+   D Q+QL FL  WL+AHI D++ +L+K
Sbjct  60   SGYQVGTDFIANNRAPGIDFATVHSYPDQWLGGLDAQAQLRFLGAWLDAHIADARAVLRK  119

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL+AEFG+S  DPG++  QRDA++ TVY  +Y SA+ GG AAG LFWQLL +GMD++ D
Sbjct  120  PLLVAEFGESRHDPGYSGGQRDAVFGTVYARVYDSARAGGPAAGALFWQLLAEGMDSYGD  179

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMK  506
            GYE++L Q  STA +I+ Q  +L  + R F R +
Sbjct  180  GYEVVLPQAPSTAGVIATQSRRLQGLARAFVRAR  213



>ref|XP_007136624.1| hypothetical protein PHAVU_009G059700g [Phaseolus vulgaris]
 gb|ESW08618.1| hypothetical protein PHAVU_009G059700g [Phaseolus vulgaris]
Length=432

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            FN+GTDFIANNQIP IDFAT HSYPDQW+SSS  + Q++FL  W++ HI+D+Q  L KP+
Sbjct  257  FNVGTDFIANNQIPGIDFATVHSYPDQWLSSSGYEEQISFLGRWVDEHIQDAQNTLHKPV  316

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFG S K  G N + RD L+ TVY  IYSSA  GGAA GGLFWQLL  GMD FRDGY
Sbjct  317  LFAEFGISTKSFGGNSSPRDRLFNTVYSAIYSSASSGGAAVGGLFWQLLAQGMDYFRDGY  376

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
            E++L +  STA+LI+Q+  KL+ IR+++ R++N+ +  RAK  RG Q
Sbjct  377  EVVLDESPSTASLIAQESQKLNHIRKMYVRLRNIEKWNRAKEIRGSQ  423



>ref|XP_003569504.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Brachypodium distachyon]
Length=417

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANN  P IDFAT HSYPDQWM  SDD +QL FL  WL+AH+ED++  L+K
Sbjct  248  SGYLVGTDFIANNMAPGIDFATVHSYPDQWMPGSDDSAQLGFLGRWLDAHVEDARAKLRK  307

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLLIAEFGKSWKDPG++   RDA +  VY  IY SA++GG   GGLFWQL+ DGMD++ D
Sbjct  308  PLLIAEFGKSWKDPGYSSAVRDAQFGAVYAKIYESARKGGPMVGGLFWQLMADGMDSYGD  367

Query  607  GYEILLSQR-TSTANLISQQCHKLSQIRRIFARMK  506
            GYE++ +    ST  +I+ Q  KL  + + FAR +
Sbjct  368  GYEVIFADAPASTTGVITTQSRKLKMLGKAFARAE  402



>ref|XP_002306881.1| hypothetical protein POPTR_0005s25120g [Populus trichocarpa]
 gb|EEE93877.1| hypothetical protein POPTR_0005s25120g [Populus trichocarpa]
Length=420

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+  S ++SQ +FL +WLN HI+DSQ IL+KP+
Sbjct  255  FQVGTDFIANNQIPDIDFATVHSYPDQWLPDSSEESQESFLNSWLNNHIQDSQNILRKPV  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS +    N  QRD L+ TVY  IYSSA  GGAAAGG+FWQLLT+GMD+FRDGY
Sbjct  315  LFAEFGKSLRTS--NDNQRDRLFNTVYSAIYSSASSGGAAAGGMFWQLLTEGMDSFRDGY  372

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAK  479
            E++ SQ  ST ++I  Q  KL++IR+++AR++N+ + +RAK
Sbjct  373  EVVFSQNPSTTSVIVDQSQKLNRIRKMYARLRNIEKWKRAK  413



>gb|ACN33740.1| unknown [Zea mays]
Length=299

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANN+ P IDFAT HSYPDQW+   D Q+QL FL  WL+AHI D++ +L+K
Sbjct  130  SGYQVGTDFIANNRAPGIDFATVHSYPDQWLGGLDAQAQLRFLGAWLDAHIADARAVLRK  189

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL+AEFG+S  DPG++  QRDA++ TVY  +Y SA+ GG AAG LFWQLL +GMD++ D
Sbjct  190  PLLVAEFGESRHDPGYSGGQRDAVFGTVYARVYDSARAGGPAAGALFWQLLAEGMDSYGD  249

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMK  506
            GYE++L Q  STA +I+ Q  +L  + R F R +
Sbjct  250  GYEVVLPQAPSTAGVIATQSRRLQGLARAFVRAR  283



>ref|XP_011083658.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Sesamum indicum]
Length=425

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFI NN+I  IDFAT HSYPDQW++S  D++QL FL +WLN+HI+D+Q +L+KP+
Sbjct  273  FQVGTDFITNNRISDIDFATVHSYPDQWLTSQSDEAQLLFLNDWLNSHIQDAQTVLQKPV  332

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS KD G++  +RD L+  VY  IYSSA  GG AAGGLFWQLLT+GMD+F DGY
Sbjct  333  LFAEFGKSSKDAGYDTYKRDDLFNMVYSAIYSSAGSGGVAAGGLFWQLLTEGMDDFSDGY  392

Query  601  EILLSQRTSTANLISQQCHKLSQIRRIFARMK  506
            EI+ S+  STA+LI+ Q  KL++IR  +AR++
Sbjct  393  EIVFSENPSTASLIADQSQKLNKIREKYARLR  424



>ref|NP_001145882.1| uncharacterized protein LOC100279398 precursor [Zea mays]
 gb|ACN33727.1| unknown [Zea mays]
Length=426

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANN+ P IDFAT HSYPDQW+   D Q+QL FL  WL+AHI D++ +L+K
Sbjct  257  SGYQVGTDFIANNRAPGIDFATVHSYPDQWLGGLDAQAQLRFLGAWLDAHIADARAVLRK  316

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL+AEFG+S  DPG++  QRDA++ TVY  +Y SA+ GG AAG LFWQLL +GMD++ D
Sbjct  317  PLLVAEFGESRHDPGYSGGQRDAVFGTVYARVYDSARAGGPAAGALFWQLLAEGMDSYGD  376

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMK  506
            GYE++L Q  STA +I+ Q  +L  + R F R +
Sbjct  377  GYEVVLPQAPSTAGVIATQSRRLQGLARAFVRAR  410



>ref|XP_002456093.1| hypothetical protein SORBIDRAFT_03g030340 [Sorghum bicolor]
 gb|EES01213.1| hypothetical protein SORBIDRAFT_03g030340 [Sorghum bicolor]
Length=432

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANNQ P +DFAT HSYPDQW+   D  SQL FL  WL+AHI D+Q +L+K
Sbjct  262  SGYQVGTDFIANNQAPGVDFATVHSYPDQWLPGLDAPSQLRFLGAWLDAHIADAQAVLRK  321

Query  787  PLLIAEFGKSWKDPGFNP-TQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFR  611
            PLL+AEFGKS +DPG++   QRDA++  VY  +Y+SA+ GG AAG LFWQLLT+GMD++ 
Sbjct  322  PLLVAEFGKSRRDPGYSGDGQRDAVFAAVYAKVYNSARAGGPAAGALFWQLLTEGMDSYG  381

Query  610  DGYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGR  494
            DGYE++L Q  ST  +I+ Q  +L  + R F R + + R
Sbjct  382  DGYEVVLRQAPSTTGVITTQSRRLQGLVRAFVRARKVQR  420



>tpg|DAA58240.1| TPA: putative endo-1,4-beta-mannosidase family protein isoform 
1 [Zea mays]
 tpg|DAA58241.1| TPA: putative endo-1,4-beta-mannosidase family protein isoform 
2 [Zea mays]
Length=426

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +GTDFIANN+ P IDFAT HSYPDQW+   D Q+QL FL  WL+AHI D++ +L+K
Sbjct  257  SGYQVGTDFIANNRAPGIDFATVHSYPDQWLGGLDAQAQLRFLGAWLDAHIADARAVLRK  316

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL+AEFG+S  DPG++  QRDA++ TVY  +Y SA+ GG AAG LFWQLL +GMD++ D
Sbjct  317  PLLVAEFGESRHDPGYSGGQRDAVFGTVYARVYDSARAGGPAAGALFWQLLAEGMDSYGD  376

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMK  506
            GYE++L Q  STA +I+ Q  +L  + R F R +
Sbjct  377  GYEVVLPQAPSTAGVIATQSRRLQGLARAFVRAR  410



>dbj|BAJ87939.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 121/170 (71%), Gaps = 8/170 (5%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIANN++P IDFAT HSYPDQW+SSSDDQ+Q  FL  WL+AHI D+Q  L+KPLLI
Sbjct  152  VGTDFIANNRVPGIDFATVHSYPDQWLSSSDDQAQRNFLGRWLDAHIADAQGTLRKPLLI  211

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
            AEFGKS +DPGF+  QRDA +  VY  IY SA++GG   GGLFWQL+ DGMD++ DGY++
Sbjct  212  AEFGKSQRDPGFSSAQRDAQFGMVYAKIYQSARKGGPTVGGLFWQLMADGMDSYGDGYQV  271

Query  595  LLSQR-TSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKAN-RGKQIGN  452
            + ++   ST  +I+ +  KL  + + FAR +      RAK +  GK  G 
Sbjct  272  IFAEAPASTTGVITYESRKLKMLGKAFARAE------RAKGDASGKVTGG  315



>ref|XP_003545272.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=429

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 119/166 (72%), Gaps = 2/166 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            +F++GTDFI NNQIP IDFAT HSYPDQW+  S ++ Q+ FL  WLN HI+DSQ I +KP
Sbjct  256  SFHVGTDFITNNQIPGIDFATVHSYPDQWLPGSSNEDQILFLVRWLNDHIQDSQNI-QKP  314

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L AEFG + K+   + T RD  +  VY  IYSSA   GAA GGLFWQLL +GMD+FRDG
Sbjct  315  VLFAEFGVATKNISTDSTLRDQFFNLVYSAIYSSASDSGAAVGGLFWQLLAEGMDSFRDG  374

Query  604  YEILLSQRTSTANLISQQCHKLSQIR-RIFARMKNLGRLRRAKANR  470
            YE+ L +  STA LI+Q+  KL++IR +IF R+KN  +  +A+  R
Sbjct  375  YEVPLDESCSTATLIAQESEKLNRIRMKIFPRVKNSKKWNKAREVR  420



>ref|XP_010911335.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Elaeis 
guineensis]
Length=303

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NN I  IDFAT H+YPDQW+SS  + +Q+AFL++W+ +H +DS  I+KKP
Sbjct  158  GYEVGTDFISNNMISGIDFATIHAYPDQWISSGSEDAQMAFLKSWIQSHTDDSGAIIKKP  217

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+I EFG+S K  G+   +R+A+Y  VY  I+ SA+ GG+ AGGLFWQ+LT+GMD+ +DG
Sbjct  218  LMITEFGRSSKTSGYTEGERNAVYWAVYNMIFDSAREGGSCAGGLFWQVLTEGMDDLKDG  277

Query  604  YEILLSQRTSTANLISQQCHKLS  536
            YEI+LS+ +STA +ISQQ  ++S
Sbjct  278  YEIILSESSSTATIISQQSRRIS  300



>ref|XP_010418656.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=171

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ +  IDFA+ HSYPD+W  + D++S++ FLRNWL AHIED+Q ILKKPL+I
Sbjct  18   LGTDFIANHNVDAIDFASIHSYPDKWFPNLDEKSRMDFLRNWLEAHIEDAQNILKKPLII  77

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA+++  Y  +Y+SA++GGA  G  FW L++DGMDNF D   I
Sbjct  78   GEFGKPNITPGYTQDQRDAVFKATYDIVYASAQKGGAGTGAWFWHLISDGMDNFSDSLAI  137

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +LS  +STAN+IS++  KL  I
Sbjct  138  VLSDNSSTANIISEESRKLRLI  159



>gb|KHN20963.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=417

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            +F++GTDFI NNQIP IDFAT HSYPDQW+  S ++ Q+ FL  WLN HI+DSQ I +KP
Sbjct  243  SFHVGTDFITNNQIPGIDFATVHSYPDQWLPGSSNEDQILFLVRWLNDHIQDSQNI-QKP  301

Query  784  LLIAEFGKSWKDPGF-NPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            +L AEFG + K+    + T RD  +  VY  IYSSA   GAA GGLFWQLL +GMD+FRD
Sbjct  302  VLFAEFGVATKNISTEDSTLRDQFFNLVYSAIYSSASDSGAAVGGLFWQLLAEGMDSFRD  361

Query  607  GYEILLSQRTSTANLISQQCHKLSQIR-RIFARMKNLGRLRRAKANR  470
            GYE+ L +  STA LI+Q+  KL++IR +IF R+KN  +  +A+  R
Sbjct  362  GYEVPLDESCSTATLIAQESEKLNRIRMKIFPRVKNSKKWNKAREVR  408



>gb|KHN12693.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=389

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            +F++GTDFI NNQIP IDFAT HSYPDQW+  S ++ Q+ FL  WLN HI+DSQ I +KP
Sbjct  214  SFHVGTDFITNNQIPGIDFATVHSYPDQWLPGSSNEDQILFLVRWLNDHIQDSQNI-QKP  272

Query  784  LLIAEFGKSWKDPGF-NPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            +L AEFG + K+    + T RD  +  VY  IYSSA   GAA GGLFWQLL +GMD+FRD
Sbjct  273  VLFAEFGVATKNISTEDSTLRDQFFNLVYSAIYSSASDSGAAVGGLFWQLLAEGMDSFRD  332

Query  607  GYEILLSQRTSTANLISQQCHKLSQIR-RIFARMKNLGRLRRAKANR  470
            GYE+ L +  STA LI+Q+  KL++IR ++F R+KN  +  +A+  R
Sbjct  333  GYEVPLDESCSTATLIAQESQKLNRIRMKMFPRVKNSKKWNKARDVR  379



>ref|XP_010490700.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=220

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 112/157 (71%), Gaps = 7/157 (4%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ +  +DFA+ HSYPD W  + D+++++ FLRNWL AHIED+Q ILKKPL+I
Sbjct  67   LGTDFIANHNVDAVDFASIHSYPDIWFPNLDEKARMDFLRNWLEAHIEDAQNILKKPLII  126

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA+++  Y  +Y+SA++GGAA G  FW L++DGM NF+D   I
Sbjct  127  GEFGKLTTTPGYTQDQRDAVFKATYDIVYASAQKGGAATGAWFWHLISDGMSNFKDSLAI  186

Query  595  LLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRR  485
            +LS  +STAN+IS++  KL   R IF +    G+L R
Sbjct  187  VLSDNSSTANIISEESRKL---RLIFGK----GKLSR  216



>ref|XP_003549439.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=432

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            +F++GTDFI NNQIP IDFAT HSYPDQW+  S ++ Q+ FL  WLN HI+DSQ I +KP
Sbjct  257  SFHVGTDFITNNQIPGIDFATVHSYPDQWLPGSSNEDQILFLVRWLNDHIQDSQNI-QKP  315

Query  784  LLIAEFGKSWKDPGF-NPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            +L AEFG + K+    + T RD  +  VY  IYSSA   GAA GGLFWQLL +GMD+FRD
Sbjct  316  VLFAEFGVATKNISTEDSTLRDQFFNLVYSAIYSSASDSGAAVGGLFWQLLAEGMDSFRD  375

Query  607  GYEILLSQRTSTANLISQQCHKLSQIR-RIFARMKNLGRLRRAKANR  470
            GYE+ L +  STA LI+Q+  KL++IR ++F R+KN  +  +A+  R
Sbjct  376  GYEVPLDESCSTATLIAQESQKLNRIRMKMFPRVKNSKKWNKARDVR  422



>ref|XP_010911765.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9, partial 
[Elaeis guineensis]
Length=298

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + IGTDFIANN +P IDFAT H+YPDQW+S S++    AFL++W+ +H +D+   LKKP
Sbjct  155  GYEIGTDFIANNMVPEIDFATIHAYPDQWISGSNEAQN-AFLKSWVQSHTDDAGAFLKKP  213

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+I EFGKS K  G+   +RD L+  +Y  IY SA+ GG  AGGLFWQ+L  GMDNF DG
Sbjct  214  LMITEFGKSSKTSGYTVGERDTLFSDMYSEIYGSARAGGPCAGGLFWQVLAPGMDNFGDG  273

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YEI+ SQ  ST ++I+QQ H++S +
Sbjct  274  YEIIFSQCPSTTSIIAQQSHRISSL  298



>ref|XP_010673216.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=418

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 112/160 (70%), Gaps = 1/160 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N    GT+FI NNQ+P+IDFAT H YPDQW+S S  ++QL FL  W+  HI DS  ILKK
Sbjct  259  NNIQAGTNFITNNQVPSIDFATVHCYPDQWLSGSTGEAQLLFLSQWVQQHILDSLNILKK  318

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P++ AEFGKS+K  G+  + R+ LY   Y +IY+SA  GG A GGLFWQLL +GMDNFRD
Sbjct  319  PVVFAEFGKSYKVAGYTSSDRNQLYNITYSSIYTSASEGGPATGGLFWQLLANGMDNFRD  378

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLR  488
            GYEI+L +  +   +I  + HKLS++++ +++++N    R
Sbjct  379  GYEIVLGEEPNITGIIFGESHKLSRLKK-YSQVRNTEEAR  417



>gb|EPS69785.1| endo-beta-mannanase [Genlisea aurea]
Length=565

 Score =   160 bits (405),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 112/163 (69%), Gaps = 4/163 (2%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N F +GTDF+ NNQIP +DFAT HSY DQ + S  +++QL+FL+ W+  HI DSQ IL+K
Sbjct  254  NYFQVGTDFLRNNQIPGVDFATVHSYADQCLGSQSNENQLSFLKKWIATHIRDSQRILRK  313

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKR--ggaaagGLFWQLLTDGMDNF  614
            PLL+AEFGKS +D G+   +RD ++RTVY  I  S  R  GG   GGLFWQLL +GMDN 
Sbjct  314  PLLLAEFGKSSRDKGYTIQERDEVFRTVYSAIIHSCARGGGGVVGGGLFWQLLGEGMDNL  373

Query  613  RDGYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRR  485
            RDGYEI+LS+  STA LI+    K  +I  +   +KN   +RR
Sbjct  374  RDGYEIVLSESPSTAKLIADYSQKFDEIPSLV--LKNYSSVRR  414



>ref|XP_008799989.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=424

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
              +  GTDFIANN+IP IDFAT H+YPDQW+  S + +QL FL+ W+ +HI D+  +L+K
Sbjct  254  GGYEAGTDFIANNEIPEIDFATIHAYPDQWIPGSSELAQLVFLQRWMQSHIGDADAVLRK  313

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PL+I EFGKS +  G+   +RDA+YRTVY  I++SA  GG   GGLFWQLL  GMD FRD
Sbjct  314  PLVITEFGKSSRLSGYTVCKRDAMYRTVYSAIHASASSGGPCRGGLFWQLLAQGMDGFRD  373

Query  607  GYEILLSQRTSTANLISQQCHKLSQI  530
            GYEI+ S+     N+IS+   ++S +
Sbjct  374  GYEIIFSESPLIENIISRHSRRISSL  399



>ref|XP_008804040.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=389

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFIANN +P IDFAT H+YPDQW+S S++   +AFL++W+ +H +D+   L KP
Sbjct  246  GYEVGTDFIANNMVPEIDFATIHAYPDQWISGSNEAQ-MAFLKSWVQSHTDDAGAFLGKP  304

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+I EFGK  K  G+   +RDAL+  VY  IY SA+ GG  AGGLFWQ+L  GMDNF DG
Sbjct  305  LMITEFGKCSKTSGYTVGERDALFSDVYGEIYGSARAGGPCAGGLFWQVLAPGMDNFGDG  364

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YEI+ S+  ST ++I+QQ H++S +
Sbjct  365  YEIIFSECPSTTSIIAQQSHRISSL  389



>ref|XP_004495835.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Cicer arietinum]
Length=401

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N+  IGTDFI+NNQ+P IDFAT H YPDQW+  S++ +Q AF+  W+ AHI+DS  IL K
Sbjct  254  NSLQIGTDFISNNQVPEIDFATIHLYPDQWLQGSNETTQSAFVDKWIEAHIQDSNTILVK  313

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+L+ EFG S K PG++  +RD+ Y  +Y  IY SA RGG+ AGGLFWQL++ GM N  D
Sbjct  314  PILVTEFGMSSKSPGYSIGKRDSYYNKIYNDIYRSAIRGGSCAGGLFWQLMSQGMGNMGD  373

Query  607  GYEILLSQRTSTANLISQQCHKLSQI  530
            GYE++  +  STA LI QQ  K+S+I
Sbjct  374  GYEVIFEETPSTALLIKQQSLKMSKI  399



>ref|XP_010914840.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Elaeis 
guineensis]
Length=425

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
                +GTDFIANNQIP IDFAT H+YPDQW+  S +Q+QL FL++W+ +HI D+  +++K
Sbjct  257  GGCEVGTDFIANNQIPEIDFATIHAYPDQWIPGSSEQAQLVFLQHWIQSHIGDADAVVRK  316

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PL+I EFGKS +  G+   +RD +YR VY +IY+SA+ GG   GGLFWQLL  GMD FRD
Sbjct  317  PLVITEFGKSSRLSGYTVRKRDTMYRMVYNSIYASARSGGPCRGGLFWQLLIQGMDGFRD  376

Query  607  GYEILLSQRTSTANLISQQCHKLSQI  530
            GYEI+ S+     N+IS+Q  + S +
Sbjct  377  GYEIIFSECPLIENIISRQSRRTSSL  402



>dbj|BAD17132.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 dbj|BAD17320.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
Length=398

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFIANN +P +DFAT HSYPDQW+S +    Q+AF+R W+  HI DS  +L+KP
Sbjct  251  GYTVGTDFIANNLVPAVDFATIHSYPDQWVSGASSDEQVAFMRKWMADHIRDSAAVLRKP  310

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFG S +  G+    RDA +RTVY  +Y+SA+ GGA AGGLFWQ++  GM+++ DG
Sbjct  311  LLVTEFGWSARSNGYTVAARDAYFRTVYDAVYASAREGGACAGGLFWQVMAPGMESWTDG  370

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YE++L +  STA++++ QC +++ +
Sbjct  371  YEVVLERSKSTADVVAHQCARIAGL  395



>ref|NP_001048226.2| Os02g0766900 [Oryza sativa Japonica Group]
 sp|Q6Z310.2|MAN9_ORYSJ RecName: Full=Putative mannan endo-1,4-beta-mannosidase 9; AltName: 
Full=Beta-mannanase 9; AltName: Full=Endo-beta-1,4-mannanase 
9; AltName: Full=OsMANP; AltName: Full=OsMan9; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|EAY87657.1| hypothetical protein OsI_09068 [Oryza sativa Indica Group]
 gb|EAZ24735.1| hypothetical protein OsJ_08506 [Oryza sativa Japonica Group]
 dbj|BAF10140.2| Os02g0766900 [Oryza sativa Japonica Group]
Length=407

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFIANN +P +DFAT HSYPDQW+S +    Q+AF+R W+  HI DS  +L+KP
Sbjct  260  GYTVGTDFIANNLVPAVDFATIHSYPDQWVSGASSDEQVAFMRKWMADHIRDSAAVLRKP  319

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFG S +  G+    RDA +RTVY  +Y+SA+ GGA AGGLFWQ++  GM+++ DG
Sbjct  320  LLVTEFGWSARSNGYTVAARDAYFRTVYDAVYASAREGGACAGGLFWQVMAPGMESWTDG  379

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YE++L +  STA++++ QC +++ +
Sbjct  380  YEVVLERSKSTADVVAHQCARIAGL  404



>ref|XP_006444660.1| hypothetical protein CICLE_v10020376mg [Citrus clementina]
 gb|ESR57900.1| hypothetical protein CICLE_v10020376mg [Citrus clementina]
 gb|KDO86723.1| hypothetical protein CISIN_1g015179mg [Citrus sinensis]
Length=412

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            +GTDFI NNQIP +DFAT H YP+QW+   ++ D+ QLAF+  W+ AHI+DS  ILKKP+
Sbjct  265  VGTDFITNNQIPDVDFATIHIYPEQWLPPGNTSDEIQLAFVNRWIQAHIQDSDSILKKPI  324

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            LI EFGKS+K PG++  +R++ ++ VY  IY  AK  G   GGLFWQL+T GM NF DGY
Sbjct  325  LIGEFGKSYKYPGYSEQKRNSYFQKVYDAIYDCAKSKGPCGGGLFWQLMTQGMTNFGDGY  384

Query  601  EILLSQRTSTANLISQQCHKLSQIRRI  521
            E++L    STAN+I+QQ  +L+ +  I
Sbjct  385  EVVLESSPSTANIINQQSLRLAVLSSI  411



>ref|XP_012083050.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Jatropha 
curcas]
 gb|KDP28371.1| hypothetical protein JCGZ_14142 [Jatropha curcas]
Length=401

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFI+NNQ+P IDFAT H YP+ W+ +S ++ Q AF+  W+ AHI+DS  +LKKPL+I
Sbjct  259  VGTDFISNNQVPGIDFATIHLYPETWLPNSSEEEQAAFVDKWIKAHIQDSNIVLKKPLII  318

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS K PGF+ ++RD+ +  +Y  IY+SAK GG   GG+FWQL+  GM+++ DGY++
Sbjct  319  GEFGKSSKYPGFSLSKRDSYFGVIYSAIYNSAKSGGPFCGGIFWQLMVQGMESWGDGYQV  378

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +L +  STA++I+QQ  KLS I
Sbjct  379  VLEESPSTASVIAQQSRKLSAI  400



>ref|XP_010490914.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X1 
[Camelina sativa]
Length=417

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ +  IDFA+ HSYPD+W  + D++S++ FLRNWL AHIED+Q ILKKPL+I
Sbjct  264  LGTDFIANHNVDAIDFASIHSYPDKWFPNLDEKSRMDFLRNWLEAHIEDAQNILKKPLII  323

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA+++  Y  +Y+SA++GGA  G  FW L++DGMDNF D   I
Sbjct  324  GEFGKPNITPGYTQDQRDAVFKATYDIVYASAQKGGAGTGAWFWHLISDGMDNFSDSLAI  383

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +LS  +STAN+IS++  KL  I
Sbjct  384  VLSDNSSTANIISEESRKLRLI  405



>ref|XP_010490985.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X2 
[Camelina sativa]
Length=417

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ +  IDFA+ HSYPD+W  + D++S++ FLRNWL AHIED+Q ILKKPL+I
Sbjct  264  LGTDFIANHNVDAIDFASIHSYPDKWFPNLDEKSRMDFLRNWLEAHIEDAQNILKKPLII  323

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA+++  Y  +Y+SA++GGA  G  FW L++DGMDNF D   I
Sbjct  324  GEFGKPNITPGYTQDQRDAVFKATYDIVYASAQKGGAGTGAWFWHLISDGMDNFSDSLAI  383

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +LS  +STAN+IS++  KL  I
Sbjct  384  VLSDNSSTANIISEESRKLRLI  405



>ref|XP_006491440.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Citrus sinensis]
Length=412

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            +GTDFI NNQIP +DFAT H YP+QW+   ++ D+ QLAF+  W+ AHI+DS  ILKKP+
Sbjct  265  VGTDFITNNQIPDVDFATIHIYPEQWLPPGNTSDEIQLAFVNRWIQAHIQDSDSILKKPI  324

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            LI EFGKS+K PG++  +R++ ++ VY  IY  AK  G   GGLFWQL+T GM NF DGY
Sbjct  325  LIGEFGKSYKYPGYSEQKRNSYFQKVYDAIYDCAKSKGPCGGGLFWQLMTQGMTNFGDGY  384

Query  601  EILLSQRTSTANLISQQCHKLSQIRRI  521
            E++L    STAN+I QQ  +L+ +  I
Sbjct  385  EVVLESSPSTANIIHQQSLRLAVLSSI  411



>ref|XP_010490811.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=417

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 113/161 (70%), Gaps = 7/161 (4%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ +  +DFA+ HSYPD W  + D+++++ FLRNWL AHIED+Q ILKKPL+I
Sbjct  264  LGTDFIANHNVDAVDFASIHSYPDIWFPNLDEKARMDFLRNWLEAHIEDAQNILKKPLII  323

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA+++  Y  +Y+SA++GGAA G  FW L++DGM NF+D   I
Sbjct  324  GEFGKLTTTPGYTQDQRDAVFKATYDIVYASAQKGGAATGAWFWHLISDGMSNFKDSLAI  383

Query  595  LLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKAN  473
            +LS  +STAN+IS++  KL   R IF +    G+L R   N
Sbjct  384  VLSDNSSTANIISEESRKL---RLIFGK----GKLSRKIIN  417



>ref|XP_007160733.1| hypothetical protein PHAVU_001G012600g [Phaseolus vulgaris]
 gb|ESW32727.1| hypothetical protein PHAVU_001G012600g [Phaseolus vulgaris]
Length=415

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 3/161 (2%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+  S ++ Q  FL +WLN HI+D+Q I +KP+
Sbjct  255  FQVGTDFIANNQIPGIDFATVHSYPDQWLPGSSNEEQTLFLVSWLNDHIKDAQSI-QKPV  313

Query  781  LIAEFGKSWKDPGFNPTQ-RDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L AEFG + K+   + T  RD  Y  VY  IYSSA  GGAA GGLFW LL +GMD F DG
Sbjct  314  LFAEFGVARKNMSSDSTAIRDQFYNLVYSAIYSSASDGGAATGGLFWHLLAEGMDAFNDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIR-RIFARMKNLGRLRR  485
            YE+ L + +STA LI+Q+  KL++IR +  +R+KN  R  R
Sbjct  374  YEVPLDENSSTATLIAQESQKLNRIRMKKSSRVKNKARKVR  414



>ref|XP_010246810.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Nelumbo nucifera]
Length=423

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + ++ GTDFI+NNQI  IDFAT H+YPD W S SD  +QL FL+ WL  HI+DS   L K
Sbjct  267  HGYSFGTDFISNNQIAQIDFATIHAYPDIWFSDSDYGAQLNFLQTWLQVHIQDSNSSLGK  326

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PL++AEFGKS +  G+N +QRD  + T+Y  IY SA+ GG   GGLFWQ+L  GMD FRD
Sbjct  327  PLIVAEFGKSSRTSGYNSSQRDTYFDTLYSNIYDSAQSGGPCTGGLFWQVLYLGMDKFRD  386

Query  607  GYEILLSQRTSTANLISQQCHKLSQI  530
            GYE++L++  STA++I+QQ  +LS++
Sbjct  387  GYEVILAESPSTASIIAQQSRRLSKL  412



>ref|XP_006386209.1| hypothetical protein POPTR_0002s03490g [Populus trichocarpa]
 gb|ERP64006.1| hypothetical protein POPTR_0002s03490g [Populus trichocarpa]
Length=283

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 111/164 (68%), Gaps = 7/164 (4%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFIANNQIP IDFA  HSYPDQW++ S + SQ +FL NWLN HI+D+Q IL+K +L  
Sbjct  119  GTDFIANNQIPGIDFAAAHSYPDQWLTCSGEASQESFLNNWLNDHIQDAQSILQKQVLFT  178

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS +    N  QRD L    Y  +   A      AGG+FWQLLT+GMD+FRD +E++
Sbjct  179  EFGKSLRTS--NDNQRDQLLYIQYCLVNGGAA-----AGGMFWQLLTEGMDSFRDWHEVV  231

Query  592  LSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQ  461
             SQ  STA++I  Q  K + IR+++AR++N+ +  RAK  R  Q
Sbjct  232  FSQNPSTASIIVDQSPKFNWIRKMYARLRNIEKWERAKDMRTLQ  275



>ref|XP_008799988.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=397

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N +  G+DFI++NQ+P IDF T H YPD W+++   + QL FL+NW   H+ DS  ILKK
Sbjct  245  NGYVEGSDFISHNQVPGIDFTTIHGYPDTWLANWTSEEQLRFLQNWTQIHVSDSSAILKK  304

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL  EFGKS +  G    QRDALY  VY + ++SA+  G   GGLFWQLL  GMD  RD
Sbjct  305  PLLFTEFGKSLEPRGSTANQRDALYGQVYESAFASARDEGPLGGGLFWQLLAQGMDGLRD  364

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRR  524
            GYEI+L+Q  STA++ISQ   ++S++ R
Sbjct  365  GYEIVLTQHRSTASIISQISRRVSELNR  392



>gb|KHN46504.1| Mannan endo-1,4-beta-mannosidase 5 [Glycine soja]
Length=349

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDF++N+ I  IDFAT H+YPD W++  +D  Q+AF++ W+ +H EDS+ ILKKP
Sbjct  201  GFQVGTDFVSNHLIKEIDFATIHAYPDNWLTGQNDTMQMAFMQRWMTSHWEDSRTILKKP  260

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+  EFGKS KDPG++   RD+    VY +IYS A+ GG  AGGL WQLL +GMD + DG
Sbjct  261  LVFTEFGKSKKDPGYSIHARDSFMNVVYSSIYSFAQNGGTFAGGLVWQLLDEGMDPYDDG  320

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            YEI+LSQ  ST+++ISQQ  K+  +  I
Sbjct  321  YEIVLSQNPSTSSVISQQSSKMVALEHI  348



>ref|XP_006836841.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Amborella trichopoda]
 gb|ERM99694.1| hypothetical protein AMTR_s00099p00070100 [Amborella trichopoda]
Length=419

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 105/150 (70%), Gaps = 0/150 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI NN +  +DFAT H+YPD W+S   D++QLAF++ W+ +H  DS+ +LKKP
Sbjct  256  GYQVGTDFITNNLVREVDFATIHAYPDIWLSGQSDEAQLAFMQRWMQSHWRDSKRVLKKP  315

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+ AEFGKS KDPG+N   RD+   ++Y  IY  A+ GG   GGL WQL+ +GM++F DG
Sbjct  316  LVFAEFGKSKKDPGYNIGARDSFLNSIYRNIYQLARSGGTIGGGLIWQLMAEGMESFYDG  375

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFA  515
            YEI+LSQ  ST  +IS Q HK+S + R+  
Sbjct  376  YEIVLSQSPSTYGVISGQSHKMSALGRLHG  405



>ref|XP_010486712.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=407

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ I  IDFA+ HSYPD W  + D++S++ FLRNWL AHIED+Q ILKKPL+I
Sbjct  264  LGTDFIANHNIDAIDFASIHSYPDIWFPNLDEKSRMDFLRNWLEAHIEDAQNILKKPLII  323

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA+++  Y  +Y+SA++GGAA G  FW L++D MDNF+D   I
Sbjct  324  GEFGKLTTTPGYTQDQRDAVFKATYDIVYASAQKGGAATGAWFWHLISDDMDNFKDSLAI  383

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +LS  +STAN+IS++  KL  I
Sbjct  384  VLSDNSSTANIISEESRKLRMI  405



>ref|XP_010464779.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=417

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ +  IDFA+ HSYPD W  + D++S++ FLRNWL AHIED+Q ILKKPL+I
Sbjct  264  LGTDFIANHNVDAIDFASIHSYPDLWFPNLDEKSRMDFLRNWLEAHIEDAQNILKKPLII  323

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA+++  Y  +Y+SA++GGA  G  FW L++DGMDNF D   I
Sbjct  324  GEFGKPNITPGYTQDQRDAVFKATYDIVYASAQKGGAGTGAWFWHLISDGMDNFSDSLAI  383

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +LS  +STAN+IS++  KL  I
Sbjct  384  VLSDNSSTANIISEESRKLRLI  405



>ref|XP_003591288.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES61539.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=402

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N   +GTDFI+NNQIP IDFAT H YPDQW+  S++ +Q  F+  W+ AHI+DS  +L K
Sbjct  253  NTAQVGTDFISNNQIPQIDFATIHIYPDQWIQGSEETTQNVFVDKWIGAHIQDSNTVLGK  312

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P++IAEFGKS K  G++  +RD+ ++ VY  I +SA  GG+ AGG+FWQLL+ GMDN  D
Sbjct  313  PIIIAEFGKSSKSAGYSIDKRDSYFKKVYNAISTSAISGGSCAGGIFWQLLSQGMDNMGD  372

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRR  524
            GYE++     ST+ +I QQ  K+S IR+
Sbjct  373  GYEVIFENSLSTSQVIKQQSLKMSSIRK  400



>ref|XP_006300225.1| hypothetical protein CARUB_v10016461mg [Capsella rubella]
 gb|EOA33123.1| hypothetical protein CARUB_v10016461mg [Capsella rubella]
Length=434

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ I  IDFA+ HSYPD W  + D++S+L FLR WL AHIED+Q +L+KPL+I
Sbjct  264  LGTDFIANHNIDAIDFASIHSYPDLWFPNLDEKSRLDFLRKWLEAHIEDAQNVLRKPLII  323

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRD +++  Y T+Y SA++GGAA G  FW L++DGMDNF+D   I
Sbjct  324  GEFGKPTNTPGYTQDQRDTVFKATYDTVYESAQKGGAATGAWFWHLISDGMDNFKDSLAI  383

Query  595  LLSQRTSTANLISQQCHKLSQIRR  524
            +LS  +ST N+IS+   KLS + R
Sbjct  384  VLSDNSSTVNIISEDSRKLSLLFR  407



>gb|KJB41765.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=370

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYIL  794
            N+++IGTDFI+NNQIP +DFAT H YP+QW+  ++S +++QL F+  W+ AH  D   +L
Sbjct  222  NSYSIGTDFISNNQIPEVDFATIHIYPEQWLPSTNSSEEAQLGFVDKWIEAHTMDCNSVL  281

Query  793  KKPLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNF  614
            KKPL+I EFGKS+K PG++  +R+  ++ +Y  IYSSA+ GG+  GGLFWQLL+ GMDN 
Sbjct  282  KKPLVIGEFGKSFKLPGYSLEKRNEYFQRIYKAIYSSARNGGSCDGGLFWQLLSLGMDNM  341

Query  613  RDGYEILLSQRTSTANLISQQCHKLSQI  530
             DGY+++L Q  STA++I+QQ   LS +
Sbjct  342  GDGYQVVLEQSPSTASVIAQQSRLLSSL  369



>ref|XP_010943133.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Elaeis 
guineensis]
Length=411

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 106/145 (73%), Gaps = 1/145 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDF +NNQ+P IDF T HSYPDQW+  S D +QLAF+++W+ AHIEDS   L+KP
Sbjct  254  GYEVGTDFTSNNQVPEIDFTTIHSYPDQWIPGSSDDAQLAFMKSWIQAHIEDST-TLQKP  312

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
             +++EFG+S +  G+    RD+ ++TVY  IYSSAK GG   GGLFWQ+L +GMD F+DG
Sbjct  313  FIVSEFGRSSRSSGYTVDVRDSYFKTVYDAIYSSAKSGGPCTGGLFWQVLAEGMDGFKDG  372

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YE++ S+  ST ++I+++   +S +
Sbjct  373  YEVIFSESPSTTSIITRESSMISSL  397



>ref|XP_003540598.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Glycine max]
Length=407

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDF++N+ I  IDFAT H+YPD W++  +D  Q+AF++ W+ +H EDS+ ILKKP
Sbjct  259  GFQVGTDFVSNHLIKEIDFATIHAYPDNWLTGQNDTMQMAFMQRWMTSHWEDSRTILKKP  318

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+  EFGKS KDPG++   RD+    VY +IYS A+ GG  AGGL WQLL +GMD + DG
Sbjct  319  LVFTEFGKSKKDPGYSIHARDSFMNVVYSSIYSFAQNGGTFAGGLVWQLLDEGMDPYDDG  378

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            YEI+LSQ  ST+++ISQQ  K+  +  I
Sbjct  379  YEIVLSQNPSTSSVISQQSSKMVALEHI  406



>ref|XP_004969435.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Setaria italica]
Length=428

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 121/175 (69%), Gaps = 3/175 (2%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            + + +G DF+ANN++P +DFAT H+YPDQW+   D  SQL FL  WL+AHI D+  +L+K
Sbjct  254  SGYQVGADFLANNRVPGVDFATVHAYPDQWLPGLDAPSQLRFLGAWLDAHIADAGRVLRK  313

Query  787  PLLIAEFGKSWKDPGFNP--TQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNF  614
            PLL+AEFGKS +DPG+     QRDA++  VY  +Y SA+ GGAAAG LFWQLL +GMD++
Sbjct  314  PLLVAEFGKSRRDPGYGGGDAQRDAVFGAVYAKVYESARAGGAAAGALFWQLLAEGMDSY  373

Query  613  RDGYEILLSQR-TSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRGKQIGN  452
             DGYE++L +  +STA +I+ Q  +L  + R FAR +     +   + +G + GN
Sbjct  374  GDGYEVVLGRAPSSTAGVIATQSRRLQGLARAFARARKAQHQQGKASGKGAKGGN  428



>ref|XP_002454605.1| hypothetical protein SORBIDRAFT_04g034200 [Sorghum bicolor]
 gb|EES07581.1| hypothetical protein SORBIDRAFT_04g034200 [Sorghum bicolor]
Length=411

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
              + +GTDFI+NN IP IDFAT HSYPDQW+  + + +Q+AF+R W+ +H  D+  +L+K
Sbjct  262  GGYAVGTDFISNNLIPGIDFATIHSYPDQWVPGASNDAQVAFMRRWMASHAGDAAAVLRK  321

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL+AEFG S +  G+  + RDA +R VY  IY+SA  GG  AGGLFWQ++  GM+++ D
Sbjct  322  PLLVAEFGWSARSNGYTVSMRDAYFRMVYDAIYASASAGGPLAGGLFWQVMVPGMESWTD  381

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRI  521
            GY+++L +  STA+++SQ+C +++ + ++
Sbjct  382  GYDVVLDRSPSTADVVSQECARITGLNQV  410



>ref|XP_010035363.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Eucalyptus 
grandis]
 gb|KCW46729.1| hypothetical protein EUGRSUZ_K00551 [Eucalyptus grandis]
Length=402

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            IGTDFI+NNQ+P +DFAT H YP+QW+ S+ +  Q AF+  W+  HI+DS  IL KP+++
Sbjct  260  IGTDFISNNQLPQVDFATMHLYPEQWLPSASEGEQAAFVDKWVQVHIQDSNTILNKPIIL  319

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS    G++  +RD+ +  +Y  IY+SA + G+ AGGLFWQLL  GMD+F DGYE+
Sbjct  320  GEFGKSSNSSGYSLAKRDSYFGRLYDAIYTSASKQGSCAGGLFWQLLAQGMDDFSDGYEV  379

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +L Q  STA++I+QQ  K+S +
Sbjct  380  ILEQSPSTASVIAQQSRKMSSL  401



>ref|XP_002515142.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47126.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=404

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFI+NN+IP IDFAT H YP+QW+ +S ++ Q AF+  W+ AHIEDS  ++ KPL+I 
Sbjct  263  GTDFISNNRIPDIDFATIHLYPEQWLPNSSEEEQAAFVNKWVQAHIEDSNLVIGKPLIIG  322

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K PG++  +RD+ +  +Y  IYSSA   G  AGGLFWQL+  GMD++ DGYE++
Sbjct  323  EFGKSSKIPGYSLEKRDSYFVKIYDAIYSSAITRGPYAGGLFWQLMAQGMDSWGDGYEVV  382

Query  592  LSQRTSTANLISQQCHKLSQI  530
            L   +STA++I+QQ  KLS I
Sbjct  383  LEDCSSTASIIAQQSGKLSSI  403



>ref|XP_010914857.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Elaeis guineensis]
Length=444

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N +  GTDFI++NQ+  IDFAT H+YPD W+++     QL FL+NW   H+ DS  ILKK
Sbjct  258  NGYVFGTDFISHNQVQGIDFATIHAYPDLWLANWSSGDQLRFLQNWTQIHVSDSSTILKK  317

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL  EFGKS K PG    QRDA Y  VY + + SA+  G   GGLFWQLL  GMD  RD
Sbjct  318  PLLFTEFGKSLKPPGSTVNQRDAFYGQVYGSAFVSAEDEGPLGGGLFWQLLAQGMDGLRD  377

Query  607  GYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKA  476
             YEI+ +++ STA++ISQ   ++S + +  ++M  +    +A+A
Sbjct  378  SYEIVPTEQRSTASIISQISRRISGLNKTHSKMGRVEEGTKAQA  421



>gb|KJB41764.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=411

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYIL  794
            N+++IGTDFI+NNQIP +DFAT H YP+QW+  ++S +++QL F+  W+ AH  D   +L
Sbjct  263  NSYSIGTDFISNNQIPEVDFATIHIYPEQWLPSTNSSEEAQLGFVDKWIEAHTMDCNSVL  322

Query  793  KKPLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNF  614
            KKPL+I EFGKS+K PG++  +R+  ++ +Y  IYSSA+ GG+  GGLFWQLL+ GMDN 
Sbjct  323  KKPLVIGEFGKSFKLPGYSLEKRNEYFQRIYKAIYSSARNGGSCDGGLFWQLLSLGMDNM  382

Query  613  RDGYEILLSQRTSTANLISQQCHKLSQI  530
             DGY+++L Q  STA++I+QQ   LS +
Sbjct  383  GDGYQVVLEQSPSTASVIAQQSRLLSSL  410



>gb|KHG12601.1| Mannan endo-1,4-beta-mannosidase 4 [Gossypium arboreum]
Length=411

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYIL  794
            N+++IGTDFI+NNQIP +DFAT H YP+QW+  ++S +++QL F+  W+ AH  D   +L
Sbjct  263  NSYSIGTDFISNNQIPEVDFATIHIYPEQWLPSTNSSEEAQLGFVDKWIEAHTMDCNSVL  322

Query  793  KKPLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNF  614
            KKPL+I EFGKS+K PG++  +R+  ++ +Y  IYSSA+ GG+  GGLFWQLL+ GMDN 
Sbjct  323  KKPLVIGEFGKSFKLPGYSLEKRNEYFQRIYKAIYSSARNGGSCDGGLFWQLLSLGMDNM  382

Query  613  RDGYEILLSQRTSTANLISQQCHKLSQI  530
             DGY+++L Q  STA++I+QQ   LS +
Sbjct  383  GDGYQVILEQSPSTASVIAQQSRLLSSL  410



>ref|XP_006407494.1| hypothetical protein EUTSA_v10020842mg [Eutrema salsugineum]
 gb|ESQ48947.1| hypothetical protein EUTSA_v10020842mg [Eutrema salsugineum]
Length=408

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ I  IDFA+ H+YPD W  + D++S+  +LR WL  HIED+Q ILKKPL++
Sbjct  262  LGTDFIANHNIDAIDFASFHAYPDSWFPNIDEKSRSDYLRKWLEGHIEDAQNILKKPLIL  321

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA++   +  IY+SA++GG AAG LFW L++DGM+NF+DG  I
Sbjct  322  GEFGKPTTTPGYTQAQRDAVFNATFDIIYASAQKGGPAAGALFWHLISDGMNNFKDGLSI  381

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +LS ++ST N+I QQ  KL  I
Sbjct  382  VLSDKSSTVNIIGQQSRKLGLI  403



>gb|KJB41766.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=411

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYIL  794
            N+++IGTDFI+NNQIP +DFAT H YP+QW+  ++S +++QL F+  W+ AH  D   +L
Sbjct  263  NSYSIGTDFISNNQIPEVDFATIHIYPEQWLPSTNSSEEAQLGFVDKWIEAHTMDCNSVL  322

Query  793  KKPLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNF  614
            KKPL+I EFGKS+K PG++  +R+  ++ +Y  IYSSA+ GG+  GGLFWQLL+ GMDN 
Sbjct  323  KKPLVIGEFGKSFKLPGYSLEKRNEYFQRIYKAIYSSARNGGSCDGGLFWQLLSLGMDNM  382

Query  613  RDGYEILLSQRTSTANLISQQCHKLSQI  530
             DGY+++L Q  STA++I+QQ   LS +
Sbjct  383  GDGYQVVLEQSPSTASVIAQQSRLLSSL  410



>ref|XP_006356570.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Solanum tuberosum]
Length=435

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 106/159 (67%), Gaps = 1/159 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI+++ I  IDFAT H+Y DQW+S   D +Q  F++ W+ +H +DS+ ILKKP
Sbjct  260  GFQVGTDFISSHLIKEIDFATIHAYTDQWLSGQSDDAQATFMQRWMTSHWQDSRTILKKP  319

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPG+N   RD+    VY  +Y+ AK GG   G L WQL+  GMDNF DG
Sbjct  320  LVLAEFGKSSKDPGYNQNARDSFMSLVYRNVYNFAKAGGTMGGSLVWQLVAQGMDNFDDG  379

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLR  488
            Y I+L+Q  STA LIS Q H ++ +  +     NLG++ 
Sbjct  380  YSIILAQNPSTAGLISGQSHAMTTLAHL-VNSPNLGQVH  417



>gb|KCW46726.1| hypothetical protein EUGRSUZ_K00548, partial [Eucalyptus grandis]
Length=380

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFI+NNQ+P +DFAT H YPDQWM S+ +  Q+AF   W+  HI+DS  ILKKP+++
Sbjct  237  VGTDFISNNQVPQVDFATIHLYPDQWMPSASEGEQVAFADKWVQVHIQDSNTILKKPIIL  296

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS    G++  +RD+ +  +Y  IY+SA   G+ AG LFWQL   GMD+F DGY +
Sbjct  297  GEFGKSSNSSGYSVEKRDSYFGRLYDAIYTSASNQGSGAGALFWQLFVQGMDSFGDGYVV  356

Query  595  LLSQRTSTANLISQQCHKLSQIRR  524
            +L Q  STA++I++Q  ++S + R
Sbjct  357  ILKQSPSTASVIARQSRRMSALPR  380



>ref|XP_007051341.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007051342.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95498.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95499.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
Length=412

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWM--sssddqsQLAFLRNWLNAHIEDSQYIL  794
            N+  IGTDFI+NNQIP +DFAT H YP+QW+  ++S +++QLAF+  W+ AHI D   +L
Sbjct  264  NSSPIGTDFISNNQIPDVDFATIHLYPEQWLPSTNSSEEAQLAFVDKWIQAHILDCNSLL  323

Query  793  KKPLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNF  614
            +KPLLI EFGKS+K PG++  +R+  ++ +Y  IY+SA+ GG+ AGGLFWQL + GMDN 
Sbjct  324  RKPLLIGEFGKSFKLPGYSLEKRNYYFQKIYGAIYNSARSGGSCAGGLFWQLFSLGMDNM  383

Query  613  RDGYEILLSQRTSTANLISQQCHKLSQI  530
             DGY+++L Q  STA++I+QQ  KLS +
Sbjct  384  GDGYQVVLEQSPSTAHVIAQQSQKLSSL  411



>ref|XP_003591290.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES61541.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=458

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 103/148 (70%), Gaps = 0/148 (0%)
 Frame = -2

Query  970  LNAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILK  791
            LN+  +GTDFI+NNQIP IDFAT H YPD+W+  S++ ++  F+  W+ AHI+DS  ILK
Sbjct  311  LNSVKVGTDFISNNQIPQIDFATIHVYPDEWLQGSNETAKSHFVDEWIEAHIQDSNTILK  370

Query  790  KPLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFR  611
            KPL+IAEFGKS K  G++   RD  ++ VY  I  SA  GG+ AGG+FWQLL+ GMD + 
Sbjct  371  KPLVIAEFGKSSKSHGYSIAIRDNYFKKVYNAISRSAINGGSCAGGIFWQLLSQGMDTYG  430

Query  610  DGYEILLSQRTSTANLISQQCHKLSQIR  527
            DGYE++     ST  +I QQ  K+S I+
Sbjct  431  DGYEVVFENCPSTGEIIKQQSMKMSHIK  458



>ref|XP_010038519.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Eucalyptus 
grandis]
Length=403

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFI+NNQ+P +DFAT H YPDQWM S+ +  Q+AF   W+  HI+DS  ILKKP+++
Sbjct  260  VGTDFISNNQVPQVDFATIHLYPDQWMPSASEGEQVAFADKWVQVHIQDSNTILKKPIIL  319

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS    G++  +RD+ +  +Y  IY+SA   G+ AG LFWQL   GMD+F DGY +
Sbjct  320  GEFGKSSNSSGYSVEKRDSYFGRLYDAIYTSASNQGSGAGALFWQLFVQGMDSFGDGYVV  379

Query  595  LLSQRTSTANLISQQCHKLSQIRR  524
            +L Q  STA++I++Q  ++S + R
Sbjct  380  ILKQSPSTASVIARQSRRMSALPR  403



>ref|XP_008800333.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=398

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 107/146 (73%), Gaps = 1/146 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NN I  IDF T H+YPDQW+S S+D   +AFL++W+ +HI+DS  +++KP
Sbjct  254  GYEVGTDFISNNMISEIDFTTIHAYPDQWISGSEDAQ-MAFLKSWIQSHIDDSSAVIRKP  312

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
             +I EFG+S K  G+   +R+A Y  VY  I+ SA+ GG+ AGGLFWQ+L  GMD+F+DG
Sbjct  313  FMITEFGRSSKTSGYTEGERNAFYWAVYNMIFDSAREGGSCAGGLFWQVLAKGMDDFKDG  372

Query  604  YEILLSQRTSTANLISQQCHKLSQIR  527
            YEI+LS+ +S   +ISQQ  ++S ++
Sbjct  373  YEIILSKSSSITAIISQQSRRISSLQ  398



>ref|XP_006649074.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9-like [Oryza 
brachyantha]
Length=409

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFIAN  +P +DFAT HSYPDQW++ +    Q+AF+R WL +HI+D+  +L+KP
Sbjct  252  GYTVGTDFIANTLVPAVDFATIHSYPDQWVAGASSDEQVAFMRRWLASHIQDAAAVLRKP  311

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+ EFG S +  G+    RDA +R V+  +Y+SA+ GG  AGGLFWQ++  GM+++ DG
Sbjct  312  LLVTEFGWSARSNGYAVAARDAYFRMVFDAVYASARAGGPCAGGLFWQVMAPGMESWTDG  371

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YE++L +  STA++++ QC +++ +
Sbjct  372  YEVVLERSPSTASVVAHQCARIAGL  396



>ref|XP_010112044.1| Mannan endo-1,4-beta-mannosidase 5 [Morus notabilis]
 gb|EXC32463.1| Mannan endo-1,4-beta-mannosidase 5 [Morus notabilis]
Length=403

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 101/146 (69%), Gaps = 0/146 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI NNQI  IDF T H+YPD W+S  +D  Q+AF++ WL  H  DS+ ILKKP
Sbjct  256  GYQVGTDFITNNQIKEIDFTTIHAYPDIWLSGQNDNLQMAFVQKWLTTHWTDSRTILKKP  315

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+ +EFGKS KDPG++ + RDA   T+Y  IY  A+ GG   GGL WQ++  GMD++ DG
Sbjct  316  LVFSEFGKSKKDPGYSESARDAFLYTLYTKIYELARSGGGIGGGLVWQIMAQGMDSYYDG  375

Query  604  YEILLSQRTSTANLISQQCHKLSQIR  527
            YEI+LSQ  S A +ISQQ  K++ + 
Sbjct  376  YEIVLSQNPSAAAVISQQSRKMTALE  401



>gb|KDO37208.1| hypothetical protein CISIN_1g048104mg, partial [Citrus sinensis]
Length=316

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NN I  IDF T H+YPDQW+   +  +Q+ F++ WL +H  DS+ ILKKP
Sbjct  146  GYQVGTDFISNNMIKEIDFTTIHAYPDQWLPGKNYYAQMQFVQKWLESHWTDSKTILKKP  205

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+ +EFGKS K+ GF+   RD+   T+Y  IY+ A+ GGA  GG+ WQL+ +GM  + DG
Sbjct  206  LVFSEFGKSCKEAGFSINVRDSFLNTIYMNIYNLARNGGAIGGGMVWQLMAEGMQPYFDG  265

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKANRG  467
            YEI+LSQ  ST ++I+QQ +K++ +  I   M +L  L     N G
Sbjct  266  YEIVLSQNPSTRSVIAQQSNKMTALAHILTCMDSLKMLISLPKNIG  311



>gb|KFK38477.1| hypothetical protein AALP_AA3G118100 [Arabis alpina]
Length=413

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ +  IDFA+ H+YPD W  + D++S+L +L+NW+  H+ED+Q ILKKPL++
Sbjct  259  LGTDFIANHNLDAIDFASIHAYPDSWFPNLDEKSRLDYLKNWIEGHLEDAQNILKKPLIL  318

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA++     TIY+SA++GG A G LFW L++D M NF+D   I
Sbjct  319  GEFGKPSNTPGYTLAQRDAVFNVALDTIYASAQKGGPATGALFWHLISDNMTNFKDSLSI  378

Query  595  LLSQRTSTANLISQQCHKLSQIRRIFARMKNLGR  494
            +LS +TST ++I QQ HKL   R I  + K L R
Sbjct  379  VLSDKTSTVSIIGQQSHKL---RLIGGKGKLLSR  409



>ref|XP_011007449.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=406

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            F +GTDFIANNQIP IDFAT HSYPDQW+ +S ++SQ +FL +WLN HI+DSQ IL+KP+
Sbjct  255  FLVGTDFIANNQIPDIDFATVHSYPDQWLPNSGEESQESFLNSWLNNHIQDSQNILRKPV  314

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L AEFGKS +    N  QRD L+ TVY  IYSSA  GGAAAGG+FWQLL +GMD+FRDGY
Sbjct  315  LFAEFGKSLRTS--NDNQRDRLFNTVYSAIYSSASSGGAAAGGMFWQLLAEGMDSFRDGY  372

Query  601  EILLSQRTSTANLISQQCHKL  539
            E++ SQ  ST ++I  Q  KL
Sbjct  373  EVVFSQNPSTTSVIVDQSQKL  393



>ref|XP_004303778.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Fragaria 
vesca subsp. vesca]
Length=418

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 102/143 (71%), Gaps = 0/143 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            G+DFIANN IP IDFA+ H Y +QW+  + +++Q  F+  W+  HIED   +++KPL+I 
Sbjct  267  GSDFIANNLIPEIDFASIHIYAEQWLQGASEEAQADFVDKWVRVHIEDCNSVVRKPLIIG  326

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS+K PG+   +R+  +  +Y  IY SA   GA AGGLFWQLL  GMDN RDGY+++
Sbjct  327  EFGKSYKLPGYTVEKRNTYFGKLYDVIYGSASSDGACAGGLFWQLLAQGMDNVRDGYDVV  386

Query  592  LSQRTSTANLISQQCHKLSQIRR  524
            L +  STA++I+QQ HKL+++ R
Sbjct  387  LEESPSTASVIAQQSHKLTELTR  409



>ref|NP_187700.1| mannan endo-1,4-beta-mannosidase 3 [Arabidopsis thaliana]
 sp|Q9SG94.1|MAN3_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 3; AltName: Full=Beta-mannanase 
3; AltName: Full=Endo-beta-1,4-mannanase 3; 
Short=AtMAN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF19560.1|AC011708_3 putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|AEE74967.1| mannan endo-1,4-beta-mannosidase 3 [Arabidopsis thaliana]
Length=414

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+++  IDFA+ HSYPD W  + D++S+L  LR WL  H+ED+Q ILKKPL++
Sbjct  262  LGTDFIANHKLDAIDFASIHSYPDLWFPNLDEKSRLNLLRKWLECHLEDAQNILKKPLIL  321

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA++   + TIY SA++GG AAG LFW +++DGM+NF+D   I
Sbjct  322  GEFGKPTNTPGYTQAQRDAVFNATFDTIYESAEKGGPAAGALFWHVISDGMNNFKDPLSI  381

Query  595  LLSQRTSTANLISQQCHKLSQIR  527
            +LS+ ++T N+I+++  KL  IR
Sbjct  382  VLSENSTTVNIITEESRKLGLIR  404



>ref|XP_006588317.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Glycine max]
 gb|KHN11733.1| Mannan endo-1,4-beta-mannosidase 5 [Glycine soja]
Length=407

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDF++N+ I  IDFAT H+YPD W++  +D  Q+AF++ W+ +H EDS+ ILKKP
Sbjct  259  GFQVGTDFVSNHLIKEIDFATIHAYPDNWLTGQNDTMQMAFMQRWMTSHWEDSRTILKKP  318

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+  EFGKS KD G++ + RD+    VY +IYS A+ GG  AGGL WQLL +GMD + DG
Sbjct  319  LVFTEFGKSKKDQGYSISARDSFMNVVYSSIYSFAQNGGTFAGGLVWQLLDEGMDPYDDG  378

Query  604  YEILLSQRTSTANLISQQCHKL  539
            YEI+LSQ  ST+++ISQQ  K+
Sbjct  379  YEIVLSQNPSTSSVISQQSSKM  400



>ref|XP_008805818.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=390

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 106/145 (73%), Gaps = 9/145 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTD+I+NN+I  IDFAT H+YPDQW+S SDD   +AFLR+W+ +HI+D+  IL KP
Sbjct  254  GYEVGTDYISNNKIAEIDFATIHAYPDQWISGSDDAQ-MAFLRSWIQSHIDDAGAILGKP  312

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+I EFG+         T++D+ Y TVY  IY+SA+ GG  AGGLFWQ+L  GMDNFRDG
Sbjct  313  LMITEFGRK--------TEQDSFYGTVYNMIYNSARAGGPCAGGLFWQMLAQGMDNFRDG  364

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YEI+ S+  S A++ISQQ H ++ +
Sbjct  365  YEIIFSESPSMASIISQQSHMIASL  389



>gb|ACG41070.1| 1,4-beta-D-mannan endohydrolase precursor [Zea mays]
Length=406

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
              + +GTDFI+NN IP +DFAT HSYPDQW+  + D +Q+AF+R W+ +H  D+  +L+K
Sbjct  260  GGYTVGTDFISNNLIPGVDFATIHSYPDQWVPGASDGAQVAFMRRWMASHAGDAAAVLRK  319

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL+AEFG S +   +  + RDA +R VY  IY+SA+ GG  AGGLFWQ++  GM+++ D
Sbjct  320  PLLVAEFGWSARSNSYTVSMRDAYFRMVYEAIYASARAGGPLAGGLFWQVMVPGMESWTD  379

Query  607  GYEILLSQRTSTANLISQQCHKLSQI  530
            GY+++L +  STA ++ Q+C +++ +
Sbjct  380  GYDVVLDRSPSTAAVVGQECSRMTGL  405



>ref|XP_009785223.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=146

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = -2

Query  850  LAFLRNWLNAHIEDSQYILKKPLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRg  671
            L FL +WLN HI+D+Q ILKKPL+ AEFGK++K  GF P QRD ++ TVY +IY SAK G
Sbjct  16   LNFLNDWLNVHIQDAQSILKKPLIFAEFGKTYKGAGFTPEQRDIVFNTVYSSIYWSAKGG  75

Query  670  gaaagGLFWQLLTDGMDNFRDGYEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRL  491
            GAAAGGLFWQLL++GMD +RDGYEI+ S+  S + +I QQ  +L++IR+++AR+ N+ + 
Sbjct  76   GAAAGGLFWQLLSEGMDLYRDGYEIIFSESPSVSEIILQQSQRLNKIRKMYARLVNVEKW  135

Query  490  RRA--KANRG  467
            +RA  K N G
Sbjct  136  KRARDKINHG  145



>gb|AFK43830.1| unknown [Lotus japonicus]
Length=405

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFI+NNQ+P IDFAT H YPDQW++ SD+ +Q AF+  W+ A I+DS  +LKKP+L+A
Sbjct  264  GTDFISNNQVPQIDFATIHLYPDQWLAGSDEAAQQAFVDRWVQARIQDSNDVLKKPILLA  323

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFG+S K PG+   +R+  +  +Y  IY SA+ GG+ AGGLFWQL + GM+NF DGYE++
Sbjct  324  EFGRSSKLPGYAVEKRNGYFVKLYNFIYGSARSGGSCAGGLFWQLESTGMENFSDGYEVI  383

Query  592  LSQRTSTANLISQQCHKLSQIR  527
              +  STA++I QQ  K+S + 
Sbjct  384  FEESPSTADIIKQQSRKISSLE  405



>ref|XP_009763332.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
sylvestris]
Length=409

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+++ I  IDFAT H+Y DQW+S  +D +Q+AF++ W+ +H +DS  ILKKP
Sbjct  259  GYQVGTDFISSHLIKEIDFATIHAYTDQWLSGQNDNAQMAFMQRWITSHWQDSSTILKKP  318

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPGFN   RD    +VY  IY+ AK GG   G L WQL+  GM+N  DG
Sbjct  319  LVLAEFGKSSKDPGFNLNARDTYMSSVYRNIYNYAKSGGTMGGSLVWQLVAQGMENIDDG  378

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I+L+Q  STA +IS Q H ++ +  +
Sbjct  379  YSIILAQNPSTAGIISGQSHAMTTLAHL  406



>ref|XP_007216338.1| hypothetical protein PRUPE_ppa020168mg, partial [Prunus persica]
 gb|EMJ17537.1| hypothetical protein PRUPE_ppa020168mg, partial [Prunus persica]
Length=391

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            G+DFIA N +P IDFAT H Y DQW+S   +++Q  F+  W+ AHI+D   ++KKPLL+A
Sbjct  253  GSDFIATNLLPQIDFATIHIYADQWLSGESEEAQAGFVDRWVQAHIQDCNTVVKKPLLVA  312

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS+K PG+   +RDA +  +Y  IYSSA RGG+  GGLFWQL+   MD F DGYE++
Sbjct  313  EFGKSYKLPGYVLQKRDAYFGKIYSDIYSSASRGGSCVGGLFWQLMAPNMDTFGDGYEVV  372

Query  592  LSQRTSTANLISQQCHKLS  536
            L Q  +TA +I+QQ  KL+
Sbjct  373  LEQSPTTATVIAQQSRKLN  391



>ref|XP_008664308.1| PREDICTED: LOW QUALITY PROTEIN: putative mannan endo-1,4-beta-mannosidase 
9 [Zea mays]
Length=418

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
              + +GTDFI+NN IP +DFAT HSYPDQW+  + D +Q+AF+R W+ +H  D+  +L+K
Sbjct  261  GGYTVGTDFISNNLIPGVDFATIHSYPDQWVPGASDGAQVAFMRRWMASHAGDAAAVLRK  320

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL+AEFG S +   +  + RDA +R VY  IY+SA+ GG  AGGLFWQ++  GM+++ D
Sbjct  321  PLLVAEFGWSARSNSYTVSMRDAYFRMVYEAIYASARAGGPLAGGLFWQVMVPGMESWTD  380

Query  607  GYEILLSQRTSTANLISQQCHKLS  536
            GY+++L +  STA ++ Q+C +++
Sbjct  381  GYDVVLDRXPSTAAVVGQECSRIT  404



>ref|XP_006356569.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Solanum tuberosum]
Length=438

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 1/159 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +GTDFI+++ I  IDFAT H+Y DQW+S   D +Q  F++ W+ +H +DS+ ILKKP
Sbjct  263  GFQVGTDFISSHLIKEIDFATIHAYTDQWLSGQSDDAQATFMQRWMISHWQDSRTILKKP  322

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPG++   RD     VY  +Y+ AK GG   G L WQL+  GMDNF DG
Sbjct  323  LVLAEFGKSSKDPGYSQNARDTFMSLVYRNVYNFAKAGGTMGGSLVWQLVAQGMDNFDDG  382

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLR  488
            Y I+L+Q  STA LIS Q H ++ +  +     NLG++ 
Sbjct  383  YSIILAQNPSTAGLISGQSHAMTTLAHL-VNSPNLGQVH  420



>ref|XP_008245064.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Prunus mume]
Length=429

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 101/146 (69%), Gaps = 0/146 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            G+DFIA N +P IDFAT H Y DQW+S   +++Q  F+  W+ AHI D   ++KKPLL+A
Sbjct  278  GSDFIATNLLPQIDFATIHIYADQWLSGESEEAQAGFVDGWVQAHIRDCNTVVKKPLLVA  337

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS+K PG+   +RDA +  +Y  I+SSA RGG+  GGLFWQL+   MD F DGYE++
Sbjct  338  EFGKSYKLPGYVLQKRDAYFGKIYSDIFSSASRGGSCVGGLFWQLMAPNMDTFGDGYEVV  397

Query  592  LSQRTSTANLISQQCHKLSQIRRIFA  515
            L Q  +TA +I+QQ  KL+ ++   A
Sbjct  398  LEQSPTTATVIAQQSRKLNGLKASLA  423



>ref|XP_009785881.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Nicotiana sylvestris]
Length=405

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ I  IDFAT H+Y DQW+S  +D +Q+AF++ W+ +H +D++ IL+KP
Sbjct  255  GYQVGTDFISNHLIKEIDFATIHAYTDQWLSGQNDDAQMAFMQRWMTSHWQDAKNILRKP  314

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPGF+   RD    T+Y  IYS AK GG   G L WQL+  GM+N+ DG
Sbjct  315  LVLAEFGKSSKDPGFSQNARDTFMSTIYRNIYSFAKDGGTMGGSLIWQLMAQGMENYDDG  374

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I+L+Q  S+A +I+ Q H ++ +  +
Sbjct  375  YCIVLAQNPSSAGIITGQSHAMTALAHL  402



>ref|XP_006478472.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Citrus sinensis]
Length=410

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NN I  IDF T H+YPDQW+   +  +Q+ F++ WL +H  DS+ ILKKP
Sbjct  246  GYQVGTDFISNNMIKEIDFTTIHAYPDQWLPGKNYYAQMQFVQKWLESHWTDSKTILKKP  305

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+ +EFGKS K+ GF+   RD+   T+Y  IY+ A+ GGA  GG+ WQL+ +GM  + DG
Sbjct  306  LVFSEFGKSCKEAGFSINVRDSFLNTIYMNIYNLARNGGAIGGGMVWQLMAEGMQPYFDG  365

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL  500
            YEI+LSQ  ST ++I+QQ +K++ +  I    KNL
Sbjct  366  YEIVLSQNPSTRSVIAQQSNKMTALAHILTYGKNL  400



>gb|AAN34823.1| endo-beta-mannanase [Daucus carota]
Length=410

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 101/145 (70%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ I  IDFAT H+YPD W++  ++ +Q+AF+  W+ +H  D+Q ILKKP
Sbjct  262  GYQVGTDFISNHLIKEIDFATIHAYPDIWLAKQNEDAQMAFMGRWMESHSTDAQTILKKP  321

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+IAEFGKS KDPGF  + RD     VY +IY SA+ GG   GGL WQ+L  GM  + DG
Sbjct  322  LVIAEFGKSSKDPGFTSSARDLYMGAVYSSIYKSARNGGTLGGGLVWQVLAQGMQPYGDG  381

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YEI+L+   +TA +IS+Q H ++ +
Sbjct  382  YEIVLADNPTTAAVISRQSHAMAAL  406



>ref|XP_009616057.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Nicotiana tomentosiformis]
Length=411

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ +  IDFAT H+Y DQW+S  +D +Q+AF++ W+ +H +D++ IL+KP
Sbjct  261  GYQVGTDFISNHLVKEIDFATIHAYTDQWLSGQNDDAQMAFMQRWMTSHWQDAKNILRKP  320

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPGF+   RD    T+Y  IYS AK GG   G L WQL+  GM+N+ DG
Sbjct  321  LVLAEFGKSSKDPGFSQNARDTFMSTIYRNIYSFAKDGGTMGGSLIWQLMAQGMENYDDG  380

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I+L+Q  ST+ +I+ Q H ++ +  +
Sbjct  381  YCIVLAQNPSTSGIITGQSHAMNALAHL  408



>ref|XP_002884818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61077.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=415

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +GTDFIAN+ +  IDFA+ HSYPD W  + D++S+L FLR WL  H+ED+Q IL+KPL++
Sbjct  262  LGTDFIANHNLDAIDFASIHSYPDLWFPNLDEKSRLDFLRKWLVDHLEDAQNILRKPLIL  321

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGK    PG+   QRDA++   + TIY SA++GG AAG LFW +++DGM+NF+D   I
Sbjct  322  GEFGKPTNIPGYTQAQRDAVFNATFDTIYESAQKGGPAAGALFWHVISDGMNNFKDPLSI  381

Query  595  LLSQRTSTANLISQQCHKLSQIR  527
            +LS+ ++T N+I+++  KL  IR
Sbjct  382  VLSENSTTVNIITEESRKLGLIR  404



>gb|KEH43148.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=403

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N+F +GTDFI+NNQIP IDFAT H YPD W+  S+++++ AF+  W+ AH +DS  IL K
Sbjct  257  NSFPVGTDFISNNQIPQIDFATIHLYPDTWLQGSNERAKSAFVDKWIEAHFKDSNTILGK  316

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+++ EFGKS K PGF    RD  ++ VY  I +SA  GG+ AGG+FWQL++ GMD++ D
Sbjct  317  PIIVQEFGKSSKSPGFTVAIRDNYFKKVYNAIATSAMSGGSCAGGIFWQLMSQGMDSYGD  376

Query  607  GYEILLSQRTSTANLISQQCHKLSQIR  527
            G E++     STA +I QQ   +S+I+
Sbjct  377  GNEVIFENNPSTAEVIKQQSVTMSKIK  403



>ref|XP_008805817.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=390

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 9/145 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTD+I+NN+I  IDFAT H YPDQW+S SDD   +AFLR+W+ +HI+D+  IL KP
Sbjct  254  GYEVGTDYISNNKISEIDFATIHVYPDQWISGSDDAQ-MAFLRSWIQSHIDDAGAILGKP  312

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+I EFG+         T++D+ Y  VY  IY+SA+ GG  AGGLFWQ+L  GMDNFRDG
Sbjct  313  LMITEFGRK--------TEQDSFYWAVYNMIYNSARAGGPCAGGLFWQMLAQGMDNFRDG  364

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YEI+ S+  S AN+ISQQ H ++ +
Sbjct  365  YEIIFSESPSMANIISQQSHLIASL  389



>ref|XP_010911540.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Elaeis guineensis]
Length=390

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 103/145 (71%), Gaps = 9/145 (6%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTD+I+NN+I  IDFAT H+YPDQW+S SDD   +AFLR+W+ +HI+D+   L KP
Sbjct  254  GYEVGTDYISNNKISEIDFATIHAYPDQWISGSDDAQ-MAFLRSWIQSHIDDAGATLGKP  312

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+I EFG+         T+RD+ Y  VY  IY+SA+ GG   GGLFWQ+L  GMDNFRDG
Sbjct  313  LMITEFGRK--------TERDSFYWAVYNMIYNSARAGGPCTGGLFWQMLAQGMDNFRDG  364

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YEI+ S+  S A++ISQQ H ++ +
Sbjct  365  YEIIFSESPSMASIISQQSHMIASL  389



>ref|XP_003573047.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Brachypodium 
distachyon]
Length=413

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  961  FNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPL  782
            + +GTDF++NN +P +DFAT HSYPDQW+  + + +Q+ F+R W+ AH+ED+  + +KPL
Sbjct  268  YTVGTDFVSNNLVPAVDFATIHSYPDQWLPGASNAAQVEFMRRWMAAHMEDAAAV-RKPL  326

Query  781  LIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGY  602
            L+AEFG S +  G+    RD+ Y+ VY  IY+SAK GG +AGG+FWQ++  GM+ + DGY
Sbjct  327  LVAEFGWSARSNGYTVPARDSYYQMVYDAIYASAKAGGPSAGGMFWQVMAPGMEGWTDGY  386

Query  601  EILLSQRTSTANLISQQCHKLSQI  530
            +++L +  STA +++Q+C +++ +
Sbjct  387  DVVLERSPSTAKIVAQECARIAGV  410



>ref|XP_011085841.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Sesamum 
indicum]
Length=400

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFIANN+IP IDFAT H YPDQW+S S+D++Q  F+  W+ AHI DS+ I++KP
Sbjct  254  GYEVGTDFIANNRIPQIDFATIHLYPDQWVSGSNDEAQNEFVEKWIQAHINDSKSIIRKP  313

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+++EFGKS +  G+    RD  +  ++  +Y  A+R G   G LFWQ++ +GM+N+ DG
Sbjct  314  LVVSEFGKSSRSSGYTVEARDRYFGLIFNRVYGCARRRGPCGGALFWQVMAEGMENWSDG  373

Query  604  YEILLSQRTSTANLISQQCHKLSQIRR  524
            YE++L Q  +T  +I+QQ  ++S + +
Sbjct  374  YEVVLEQSPTTVGVINQQSRRISSLNQ  400



>gb|ABC87082.1| 1,4-beta-D-mannan endohydrolase precursor [Hordeum vulgare subsp. 
vulgare]
Length=380

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
             +++ GTDFI NN+IPT+DFAT HSYPDQW+  S  + Q+ F++ W+ +HIED+   L+K
Sbjct  234  GSYSAGTDFIGNNRIPTVDFATIHSYPDQWVPGSTSEQQVEFMKKWMASHIEDAAAALRK  293

Query  787  PLLIAEFGKSWKDPGFNPT-QRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFR  611
            PLL+AEFG  WK  G      RD   R VY  IY+S K GG  AGGLFWQ++  GM+++ 
Sbjct  294  PLLVAEFG--WKSSGNAAVAARDDYLRMVYDAIYASVKGGGPCAGGLFWQVMAPGMESWA  351

Query  610  DGYEILLSQRTSTANLISQQCHKLSQI  530
            DGYE++L + ++TA ++SQ+C ++  I
Sbjct  352  DGYEVVLERSSTTAAVVSQECARIGGI  378



>ref|XP_006441716.1| hypothetical protein CICLE_v10023981mg, partial [Citrus clementina]
 gb|ESR54956.1| hypothetical protein CICLE_v10023981mg, partial [Citrus clementina]
Length=400

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NN I  IDF T H+YPDQW+   +D +Q+ F++ WL +H  DS+ ILKKP
Sbjct  236  GYQVGTDFISNNMIKEIDFTTIHAYPDQWLPGKNDYAQMQFVQKWLASHWTDSKTILKKP  295

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+ +EFGKS K+ GF+   RD+   T+Y  IY+ A+ GGA  GG+ WQL+ +GM  + DG
Sbjct  296  LVFSEFGKSSKEAGFSINVRDSFLNTIYMNIYNLARNGGAIGGGMVWQLMAEGMQPYFDG  355

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNL  500
            YEI+LSQ  ST ++I QQ +K++ +  I    KNL
Sbjct  356  YEIVLSQNPSTRSVIVQQSNKMTALAHILTYGKNL  390



>emb|CDP11090.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI +N +  +DFAT H+YPDQW+S  DD++QL F++ W+++H EDS+ ILKKP
Sbjct  200  GYQVGTDFIGSNLLRDVDFATIHAYPDQWLSGKDDKAQLVFMQRWMSSHWEDSRTILKKP  259

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+IAEFGKS +DPG++ + RD     VY   Y  A+ GG  +G L WQL+  GMD++ DG
Sbjct  260  LVIAEFGKSSRDPGYSLSARDDYMSNVYRITYGFARSGGTMSGSLIWQLMAQGMDSYDDG  319

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKAN  473
            Y ++L +  ST  ++S+Q H +S +  + A   +     R +A+
Sbjct  320  YAVVLGRNPSTTAIMSRQAHAMSALSHLLAGADDAHSHARGQAH  363



>emb|CDP20988.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI +N +  +DFAT H+YPDQW+S  DD++QL F++ W+++H EDS+ ILKKP
Sbjct  200  GYQVGTDFIRSNLLRDVDFATIHAYPDQWLSGKDDKAQLVFMQRWVSSHWEDSRTILKKP  259

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+IAEFGKS +DPG++ + RD     VY   YS A+ GG  +G L WQL+  GMD++ DG
Sbjct  260  LVIAEFGKSSRDPGYSLSARDDYMSNVYRITYSFARSGGTMSGSLIWQLMAQGMDSYDDG  319

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKNLGRLRRAKAN  473
            Y ++L +  ST  ++S+Q H +S +  + A   +     R +A+
Sbjct  320  YAVVLGRNPSTTAIMSRQAHAMSALSHLLAGADDAHSHARGQAH  363



>gb|KEH17608.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=312

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +G+DF++NN +  IDF T H+YPD W++  +D  Q+ F++ W+ +H++DS+ ILKKP
Sbjct  160  GFQVGSDFVSNNLVKDIDFGTIHAYPDNWLAGQNDTMQMEFMQRWITSHLQDSRTILKKP  219

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+  EFG S  D G++   RD+   TVY +IYS A+ GG  AGGL WQLL +GMD++ DG
Sbjct  220  LVFTEFGMSKNDSGYSIEARDSFMNTVYSSIYSLAQNGGTFAGGLVWQLLDEGMDSYDDG  279

Query  604  YEILLSQRTSTANLISQQCHKL  539
            YEI+L+Q  ST+++ISQQ  K+
Sbjct  280  YEIVLTQNPSTSSVISQQSSKM  301



>gb|KHN43366.1| Mannan endo-1,4-beta-mannosidase 1 [Glycine soja]
Length=345

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 102/145 (70%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NNQ+P IDF T H YPDQW+S+S++ ++  F+  W+ AHI+DS  IL KP
Sbjct  200  GYQVGTDFISNNQVPEIDFTTIHLYPDQWVSNSNESAKDDFVSKWVQAHIQDSNDILGKP  259

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L  EFGKS K  G++  +RD  +  +Y  I++SA  GG  AGGLFWQL+T GMD+  DG
Sbjct  260  ILFTEFGKSSKSLGYSVDKRDNYFEKIYNFIFNSASNGGPCAGGLFWQLMTQGMDDLHDG  319

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
             EI+  +  STAN+I+QQ  K+S +
Sbjct  320  NEIICDENPSTANVITQQSKKMSNL  344



>gb|KEH43147.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=403

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 100/147 (68%), Gaps = 0/147 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
            N+  +GTDFI+NNQIP IDFAT H YPD W+  S++ ++ AF+  W+ AH  DS  IL K
Sbjct  257  NSLPVGTDFISNNQIPQIDFATIHLYPDTWLQGSNETAKSAFVDKWIEAHFHDSNTILGK  316

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            P+++ EFGKS K PGF+   RD+ ++ VY  I  SA  GG+ AGG+FW LL+ GMD + D
Sbjct  317  PIIVQEFGKSSKTPGFSIAIRDSYFKKVYNAISKSAMSGGSCAGGIFWLLLSQGMDTYGD  376

Query  607  GYEILLSQRTSTANLISQQCHKLSQIR  527
            GYE++     STA +I QQ   +S+I+
Sbjct  377  GYEVIFENNPSTAEVIKQQSVTMSKIK  403



>ref|XP_011025293.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Populus euphratica]
Length=404

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
             ++ +GTDFI+NNQIP IDFAT H YP+QW+ +S +  Q +F+  W+ AH++DS  +L+K
Sbjct  258  GSYLVGTDFISNNQIPHIDFATIHLYPEQWLQNSSEDEQASFVDRWIQAHVQDSSSVLRK  317

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PL+I EFGKS K PG +  +RD  +  +Y  IY+S  RGG   GGLFWQLL  GM+++ D
Sbjct  318  PLVIGEFGKSSKLPGNSLQKRDTYFVKIYSDIYNSVIRGGPFTGGLFWQLLAQGMESWGD  377

Query  607  GYEILLSQRTSTANLISQQCHKLSQI  530
            GYE++L +  STAN+I  Q  KL  +
Sbjct  378  GYEVVLEESPSTANIIDLQSRKLKSL  403



>ref|XP_009601553.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
tomentosiformis]
Length=416

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+++ I  IDFAT H+Y DQW+S  +D +Q+AF++ W+ +H +DS  ILKKP
Sbjct  260  GYQVGTDFISSHLIKEIDFATIHAYTDQWLSGQNDDAQMAFMQRWITSHWQDSSTILKKP  319

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KD GFN   RD    +VY  IY+ AK GG   G L WQL+  GM+N  DG
Sbjct  320  LVLAEFGKSSKDRGFNLNARDTFMSSVYRNIYNYAKSGGTMGGSLVWQLVAQGMENIDDG  379

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I+L+Q  STA +IS Q H ++ +  +
Sbjct  380  YSIILAQNPSTAGIISGQSHAMTTLAHL  407



>ref|XP_009616037.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
tomentosiformis]
Length=440

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI++N I  IDFAT H+Y DQW+S   D +Q  F++ W+ +H +DS+ ILKKP
Sbjct  259  GYQVGTDFISSNLIREIDFATIHAYTDQWLSGQSDDAQGVFMQRWMTSHWQDSRTILKKP  318

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPG+N   RD    +VY  +Y+ AK GG  AG L WQL+   M NF DG
Sbjct  319  LVLAEFGKSSKDPGYNQNVRDTFMSSVYRNVYNFAKAGGTMAGSLIWQLVAQDMSNFDDG  378

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I+L+Q  STA LIS Q H ++ +  +
Sbjct  379  YSIILAQNPSTAGLISGQSHAMTALAHL  406



>ref|XP_003626162.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES82380.1| mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=429

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NNQ+P IDF T H YP+ W+SSSD+ +Q AF+  W+  HI+DS+ IL KP
Sbjct  284  GYGVGTDFISNNQVPEIDFTTIHLYPESWVSSSDEAAQNAFVDKWVQDHIQDSKDILNKP  343

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +LI EFGKS K  G+N  +R++ +  ++  +Y SA  GGA AGGLFWQ +  G+D+FRDG
Sbjct  344  ILITEFGKSSKYSGYNVEKRNSYFEKLFNFVYDSASNGGACAGGLFWQFIAQGLDSFRDG  403

Query  604  YEILLSQRTSTANLISQQCHKLSQIR  527
            YE++L +  ST  +ISQQ  ++S ++
Sbjct  404  YEVILEENPSTVTVISQQSKRMSNLK  429



>ref|XP_002302695.1| hypothetical protein POPTR_0002s18530g [Populus trichocarpa]
 gb|EEE81968.1| hypothetical protein POPTR_0002s18530g [Populus trichocarpa]
Length=415

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            GTDFI+NNQIP IDFAT H YP+QW+ +S +  Q +F+  W+ AH++DS  +L KPL+I 
Sbjct  263  GTDFISNNQIPHIDFATIHLYPEQWLPNSSEDEQASFVDRWIQAHVQDSSSVLGKPLIIG  322

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS K PG +  +RD  +  +Y  IY+S  RGG   GGLFWQLL +GM+++ DGYE++
Sbjct  323  EFGKSLKLPGNSLQKRDTYFVKIYSDIYNSVTRGGPFTGGLFWQLLAEGMESWGDGYEVV  382

Query  592  LSQRTSTANLISQQCHKL  539
            L +  STAN+I  Q  KL
Sbjct  383  LEESPSTANIIDLQSRKL  400



>ref|XP_009785847.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
sylvestris]
Length=443

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI++N I  IDFAT H+Y DQW+S   D +Q  F++ W+ +H +DS+ ILKKP
Sbjct  257  GYQVGTDFISSNLIREIDFATIHAYTDQWLSGQSDDAQGVFMQRWMTSHWQDSRTILKKP  316

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPG+N   RD    +VY  +Y+ AK GG  AG L WQL+   M NF DG
Sbjct  317  LVLAEFGKSSKDPGYNQNVRDTFMSSVYRNVYNFAKAGGTMAGSLIWQLVAQDMSNFDDG  376

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I+L+Q  STA LIS Q H ++ +  +
Sbjct  377  YSIILAQNPSTAGLISGQSHAMTALAHL  404



>ref|XP_010689012.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=444

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            IGTDF+ NN IPT+DFA+ H YPDQW++  + + +L F+R W+++HIED +  LKKP+++
Sbjct  285  IGTDFVRNNDIPTVDFASIHMYPDQWLTVDNLEDKLEFVRKWVSSHIEDGEKQLKKPVML  344

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFG S ++  F+P QRD L++ VY  IY SAK+ G+ AG L WQL  +GMD+F D + I
Sbjct  345  TEFGLSSQNKDFDPAQRDRLFKVVYDIIYKSAKKNGSGAGSLLWQLFVEGMDDFHDDFGI  404

Query  595  LLSQRTSTANLISQQCHKLS---QIRRIFARMKNLGRLRR  485
            +  +R ST ++I++Q  +L+   Q   +   +KNL +  R
Sbjct  405  IPWRRQSTYDVITRQSCRLALLHQRSNLEGNLKNLCQRSR  444



>ref|NP_001234473.1| Mannan endo-1,4-beta-mannosidase 2 precursor [Solanum lycopersicum]
 sp|Q6YM50.1|MAN5_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 5; AltName: Full=Beta-mannanase 
5; AltName: Full=Endo-beta-1,4-mannanase 5; 
AltName: Full=LeMAN5; Flags: Precursor [Solanum lycopersicum]
 sp|Q9FZ03.2|MAN2_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 2; AltName: Full=Beta-mannanase 
2; AltName: Full=Endo-beta-1,4-mannanase 2; 
AltName: Full=LeMAN2; Flags: Precursor [Solanum lycopersicum]
 gb|AAG00315.2|AF184238_1 (1-4)-beta-mannan endohydrolase precursor [Solanum lycopersicum]
 gb|AAM26920.1| mannan endo-1,4-beta-mannanase precursor [Solanum lycopersicum]
Length=414

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ I  IDFAT H+Y DQW+S   D +Q+ F++ W+ +H +D++ ILKKP
Sbjct  264  GYQVGTDFISNHLIKEIDFATIHAYTDQWLSGQSDDAQMIFMQKWMTSHWQDAKNILKKP  323

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS +DPG+N   RD    T+Y  IYS AK GG   G L WQL+  GM+N+ DG
Sbjct  324  LVLAEFGKSSRDPGYNQNIRDTFMSTIYRNIYSLAKDGGTMGGSLIWQLVAQGMENYEDG  383

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I L +  STA +I+ Q H ++ +  +
Sbjct  384  YCIELGKNPSTAGIITSQSHAMTALAHL  411



>emb|CDP21695.1| unnamed protein product [Coffea canephora]
Length=392

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI++N +  +DFAT H+YPDQW+S  DD++QL F++ W+++H EDS+ ILKKP
Sbjct  200  GYQVGTDFISSNLLRDVDFATIHAYPDQWLSGKDDKAQLVFMQRWMSSHWEDSRTILKKP  259

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+IAEFGKS +DPG++   RD     VY   Y  A+ GG  +G L WQL+  GMD++ DG
Sbjct  260  LVIAEFGKSSRDPGYSLRARDDYMSNVYRITYGYARSGGTMSGSLIWQLMAQGMDSYDDG  319

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFA  515
            Y ++L +  ST  ++S+Q H +S +  + A
Sbjct  320  YAVVLGRNPSTTAIMSRQAHAMSALSHLVA  349



>ref|XP_006356528.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Solanum tuberosum]
Length=413

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            ++ +GTDFI+N+ I  IDFAT H+Y DQW+S   D +Q+ F++ W+ +H +D++ ILKKP
Sbjct  263  SYQVGTDFISNHLIKEIDFATIHAYTDQWLSGQSDDAQMIFMQRWMTSHWQDAKNILKKP  322

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS +DPG+N   RD    T+Y  IYS AK GG   G L WQL+  GM+N+ DG
Sbjct  323  LVLAEFGKSSRDPGYNQNIRDTFMSTIYRNIYSLAKDGGTMGGSLIWQLVAQGMENYEDG  382

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I L +  STA +I+ Q H ++ +  +
Sbjct  383  YCIELGKNPSTAGIITSQSHAMTALAHL  410



>ref|XP_003605853.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES88050.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=411

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             F +G+DF++NN +  IDF T H+YPD W++  +D  Q+ F++ W+ +H++DS+ ILKKP
Sbjct  259  GFQVGSDFVSNNLVKDIDFGTIHAYPDNWLAGQNDTMQMEFMQRWITSHLQDSRTILKKP  318

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+  EFG S  D G++   RD+   TVY +IYS A+ GG  AGGL WQLL +GMD++ DG
Sbjct  319  LVFTEFGMSKNDSGYSIEARDSFMNTVYSSIYSLAQNGGTFAGGLVWQLLDEGMDSYDDG  378

Query  604  YEILLSQRTSTANLISQQCHKL  539
            YEI+L+Q  ST+++ISQQ  K+
Sbjct  379  YEIVLTQNPSTSSVISQQSSKM  400



>gb|EYU45795.1| hypothetical protein MIMGU_mgv1a0212342mg, partial [Erythranthe 
guttata]
Length=188

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFIANN +  IDF T H YPDQW+  S+D+ Q  F+  W+  HI+DS+ ++ KP
Sbjct  40   GYEVGTDFIANNLVHHIDFTTIHLYPDQWVPGSNDEVQAEFVHKWIQTHIDDSKSVIGKP  99

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +++ EFGKS +  G+N   RD  +  ++ ++YS A+ GG   G LFWQ++  GM ++ DG
Sbjct  100  IMVTEFGKSSRSSGYNVEARDNYFSNIFNSVYSCARTGGPCGGALFWQVMAQGMGDWSDG  159

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            YE++L Q  ST  +ISQQ  ++S + +I
Sbjct  160  YEVVLEQSPSTIGVISQQSRQISSLNQI  187



>ref|XP_002983364.1| hypothetical protein SELMODRAFT_234217 [Selaginella moellendorffii]
 gb|EFJ15706.1| hypothetical protein SELMODRAFT_234217 [Selaginella moellendorffii]
Length=344

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = -2

Query  958  NIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLL  779
            N+G+DF+ +NQIP+IDFAT HSYPD W+  +   +QL FL +W+  HI+D+  +L+KP+L
Sbjct  199  NLGSDFLRHNQIPSIDFATVHSYPDLWLPGASIDAQLQFLSSWVQEHIDDATTVLQKPVL  258

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMD-NFRDGY  602
             AEFGKS + PG+   QRD    T+Y T+Y+SA+ GGAAAG L WQL  DGM   + DG+
Sbjct  259  FAEFGKSDRLPGYVVGQRDRFLSTLYSTVYASARTGGAAAGSLVWQLFADGMSPAWDDGF  318

Query  601  EILLSQRTSTANLISQQCHKLSQIRR  524
            +I +SQ  STA +I+ Q  +LS + R
Sbjct  319  QIFVSQSPSTAQIIAAQSRRLSSLNR  344



>gb|KHN14221.1| Mannan endo-1,4-beta-mannosidase 1 [Glycine soja]
Length=403

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 102/145 (70%), Gaps = 1/145 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + IGTDFI+NNQ+P IDF T H YP QWMS  ++ +Q  F+ NW+  HI+D+  +L+KP
Sbjct  259  GYQIGTDFISNNQVPEIDFTTIHLYP-QWMSRFNETAQDVFINNWVQVHIQDANDVLRKP  317

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L++EFG S K  G+   +R++L+  +Y  IY SA   G+ AGGLFWQLL  GMD+FRDG
Sbjct  318  ILLSEFGLSSKISGYGVEKRNSLFEKLYNLIYKSASNRGSCAGGLFWQLLAKGMDDFRDG  377

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YE++  +  ST N+I++Q  K+S +
Sbjct  378  YEVVFEETPSTTNIITKQSKKMSSL  402



>ref|XP_003521650.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Glycine max]
Length=415

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 102/145 (70%), Gaps = 1/145 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + IGTDFI+NNQ+P IDF T H YP QWMS  ++ +Q  F+ NW+  HI+D+  +L+KP
Sbjct  271  GYQIGTDFISNNQVPEIDFTTIHLYP-QWMSRFNETAQDVFINNWVQVHIQDANDVLRKP  329

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            +L++EFG S K  G+   +R++L+  +Y  IY SA   G+ AGGLFWQLL  GMD+FRDG
Sbjct  330  ILLSEFGLSSKISGYGVEKRNSLFEKLYNLIYKSASNRGSCAGGLFWQLLAKGMDDFRDG  389

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YE++  +  ST N+I++Q  K+S +
Sbjct  390  YEVVFEETPSTTNIITKQSKKMSSL  414



>emb|CAC51690.3| endo-beta-1,4-mannanase [Lactuca sativa]
Length=410

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI NN +  +DFAT H YPDQW+  + D+++  F+  W+NAHIED   IL+KP
Sbjct  252  GYEVGTDFITNNGVNNVDFATIHMYPDQWVPGASDEARAKFVEKWINAHIEDCDSILRKP  311

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LLIAEFGKS    G+    RD  +  ++ T Y SA+  G+ +G  FWQ++ +GMDN+ DG
Sbjct  312  LLIAEFGKSSWSSGYTVEARDEYFGGIFNTAYESARNRGSCSGTTFWQVMAEGMDNWGDG  371

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            Y+++L Q  STA +I++Q  ++S +
Sbjct  372  YQVVLDQNPSTAAIIAKQSQRISSL  396



>ref|XP_008372937.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Malus 
domestica]
Length=288

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = -2

Query  952  GTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLIA  773
            G++FIA+N +P  DFAT H Y +QW+  + ++ Q  F+  W+  HIED   ++KKPL++ 
Sbjct  145  GSEFIASNLLPDSDFATIHIYAEQWLPETSEEGQAGFVDKWVQQHIEDCNTVVKKPLVLG  204

Query  772  EFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEIL  593
            EFGKS++ PG+ P +R+A +R +Y  IY+SA  GG+  GG+FWQL+  GMD F DGYE++
Sbjct  205  EFGKSYRLPGYTPGKRNAYFRKLYEYIYTSASSGGSLVGGIFWQLIAQGMDTFGDGYEVV  264

Query  592  LSQRTSTANLISQQCHKLSQI  530
            L +  +TAN+I+ Q  KL ++
Sbjct  265  LEESPTTANVIAYQSSKLGRL  285



>ref|XP_002960673.1| hypothetical protein SELMODRAFT_403117 [Selaginella moellendorffii]
 gb|EFJ38212.1| hypothetical protein SELMODRAFT_403117 [Selaginella moellendorffii]
Length=401

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = -2

Query  958  NIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLL  779
            N+G+DF+ +NQIP+IDFAT HSYPD W+  +   +QL FL +W+  HI+D+  +L+KP+L
Sbjct  256  NLGSDFLRHNQIPSIDFATVHSYPDLWLPGASIDAQLQFLSSWVQEHIDDATAVLQKPVL  315

Query  778  IAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMD-NFRDGY  602
             AEFGKS + PG+   QRD    T+Y T+Y+SA+ GGAAAG L WQL  DGM   + DG+
Sbjct  316  FAEFGKSDRLPGYVVGQRDRFLSTLYSTVYASARTGGAAAGSLVWQLFADGMSPAWDDGF  375

Query  601  EILLSQRTSTANLISQQCHKLSQIRR  524
            +I +SQ  STA +I+ Q  +LS + R
Sbjct  376  QIFVSQSPSTAQIIAAQSRRLSSLNR  401



>ref|XP_003634618.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
5-like [Vitis vinifera]
Length=403

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ I  IDF+T H+YPD W+S  DD SQ+AF+  W  +H+ DS+ I+KKP
Sbjct  257  GYQVGTDFISNHLIREIDFSTIHAYPDIWLSGKDDSSQMAFMLRWTTSHLTDSETIIKKP  316

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            ++ +EFGKS  DPG++P+ RD+    VY  IY+ A R G   GGL WQL+ +GM ++ DG
Sbjct  317  MVFSEFGKSSXDPGYSPSARDSFLNAVYTNIYNFA-RSGGIGGGLVWQLMAEGMQSYDDG  375

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            YEI+LSQ  ST+ LI+QQ +K+  +  I
Sbjct  376  YEIVLSQNPSTSGLITQQSNKMIALDHI  403



>ref|XP_006296763.1| hypothetical protein CARUB_v10015594mg [Capsella rubella]
 gb|EOA29661.1| hypothetical protein CARUB_v10015594mg [Capsella rubella]
Length=416

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 94/142 (66%), Gaps = 0/142 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            +G DFIAN+ I  IDFA+ H  PD W    D  ++L FL+ WL  HIED+Q ILKKPL++
Sbjct  263  VGADFIANHNIDAIDFASIHCAPDLWFQKLDQNTRLNFLKKWLEGHIEDAQNILKKPLIV  322

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFG     PG+   +RDA++   Y  IY+SA++GG+  G LFW L+TDGM N++D   I
Sbjct  323  GEFGVGTDVPGYTLAKRDAIFTATYEIIYASAQKGGSGGGALFWDLITDGMSNYKDPSAI  382

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            LLS+ +ST N+IS+   KL  I
Sbjct  383  LLSEGSSTVNIISEATRKLGSI  404



>emb|CDP20125.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 108/164 (66%), Gaps = 3/164 (2%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI NN I  IDFAT H+YPD W+S   D +Q+ F+R W+ +H  DS+ ILKKP
Sbjct  263  GYQVGTDFITNNLIKEIDFATIHAYPDIWLSGQSDGAQMMFMRRWMTSHSTDSKTILKKP  322

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPG++   R++    +Y  IY  A+R G  AGGL WQ+L +GM  + DG
Sbjct  323  LVLAEFGKSSKDPGYSLYARESFMAAIYGDIYRFARR-GGIAGGLVWQILAEGMQPYADG  381

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKN--LGRLRRAK  479
            YEI+LSQ  ST  +ISQQ  +++ +  + +   N    +LR +K
Sbjct  382  YEIVLSQNPSTGRIISQQSRQMTSLDHMSSNRTNSQSNKLRNSK  425



>emb|CAC08208.1| (1-4)-beta-mannan endohydrolase [Coffea arabica]
Length=427

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 108/164 (66%), Gaps = 3/164 (2%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI NN I  IDFAT H+YPD W+S   D +Q+ F+R W+ +H  DS+ ILKKP
Sbjct  263  GYQVGTDFITNNLIKEIDFATIHAYPDIWLSGQSDGAQMMFMRRWMTSHSTDSKTILKKP  322

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L++AEFGKS KDPG++   R++    +Y  IY  A+R G  AGGL WQ+L +GM  + DG
Sbjct  323  LVLAEFGKSSKDPGYSLYARESFMAAIYGDIYRFARR-GGIAGGLVWQILAEGMQPYADG  381

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRIFARMKN--LGRLRRAK  479
            YEI+LSQ  ST  +ISQQ  +++ +  + +   N    +LR +K
Sbjct  382  YEIVLSQNPSTGRIISQQSRQMTSLDHMSSNRTNSQSNKLRNSK  425



>ref|XP_002272344.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Vitis vinifera]
 emb|CBI17040.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ I  IDF T H+YPD W++  DD +Q+AFL+ W  +H+ DS+ I+KKP
Sbjct  256  GYQVGTDFISNHLIREIDFTTIHAYPDIWLNGKDDNAQMAFLQTWTTSHLTDSRTIIKKP  315

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            ++ AEFGKS KDPG++   RD+    VY  IYSSA R G   GGL WQ++ +GM+++ DG
Sbjct  316  MIFAEFGKSSKDPGYSINARDSFLNAVYTNIYSSA-RSGGMGGGLVWQIMAEGMESYYDG  374

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            YEI+LS+  ST+++I+QQ  +++ +
Sbjct  375  YEIVLSKNPSTSSVITQQSRRMAAL  399



>ref|XP_008778491.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=451

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDF++NNQ+  +DF T HSYPDQW+  S D +QLAF+++W+ +HIEDS   L+KP
Sbjct  294  GYEVGTDFLSNNQVSEVDFTTIHSYPDQWIPGSSDDAQLAFMKSWIQSHIEDSA-ALQKP  352

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+++EFGKS K  G+    RD  ++TVY +IYSSAK GG   GGLFWQ+L +GMD FRDG
Sbjct  353  LIVSEFGKSSKSSGYTVDVRDFYFKTVYDSIYSSAKSGGPCTGGLFWQVLAEGMDGFRDG  412

Query  604  YEILL  590
            YEI+ 
Sbjct  413  YEIIF  417



>ref|XP_008778492.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=411

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDF++NNQ+  +DF T HSYPDQW+  S D +QLAF+++W+ +HIEDS   L+KP
Sbjct  254  GYEVGTDFLSNNQVSEVDFTTIHSYPDQWIPGSSDDAQLAFMKSWIQSHIEDSA-ALQKP  312

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+++EFGKS K  G+    RD  ++TVY +IYSSAK GG   GGLFWQ+L +GMD FRDG
Sbjct  313  LIVSEFGKSSKSSGYTVDVRDFYFKTVYDSIYSSAKSGGPCTGGLFWQVLAEGMDGFRDG  372

Query  604  YEILL  590
            YEI+ 
Sbjct  373  YEIIF  377



>gb|KHN43394.1| Mannan endo-1,4-beta-mannosidase 4 [Glycine soja]
Length=344

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 98/142 (69%), Gaps = 2/142 (1%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            IGTDFI+NN +  +DFAT H YP+QW+  S++ +Q+AF+  WL  HI+D++ +L KP+++
Sbjct  204  IGTDFISNNLVHQVDFATMHLYPEQWLPGSNEAAQVAFVDKWLQTHIQDAKNVLAKPIVV  263

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS K   ++  +RD     +Y  IYSSA  GG  AGGLFWQL+  GMD FRDGYE+
Sbjct  264  GEFGKSLKS--YSVVERDNYLSKMYNAIYSSASSGGPCAGGLFWQLMAQGMDGFRDGYEV  321

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +  +  ST  +I QQ HK+S I
Sbjct  322  VFEESPSTTRIIDQQSHKMSSI  343



>ref|XP_009789472.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X2 
[Nicotiana sylvestris]
Length=342

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 102/145 (70%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ I  IDFAT H+Y DQW+S   D++QLA+++ W+ +H ED++ ILKKP
Sbjct  193  GYQVGTDFISNHLINEIDFATIHAYTDQWVSGQSDEAQLAWMQRWVTSHWEDAKTILKKP  252

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+++EFGKS +D G+N   RD    +VY  IY+ AK GG+ AG L WQL+  GM+N+ DG
Sbjct  253  LVLSEFGKSSRDQGYNLNSRDTFMGSVYRNIYNLAKEGGSMAGSLVWQLMAHGMENYDDG  312

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            Y I+L Q  ST  +IS Q H ++ +
Sbjct  313  YCIVLGQNPSTTGIISGQSHAMTTL  337



>gb|EYU22710.1| hypothetical protein MIMGU_mgv1a023976mg, partial [Erythranthe 
guttata]
Length=383

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NN I  IDFAT H+YPD W+S   +  Q+ F+  W+  H  D++ +LKKP
Sbjct  237  GYQVGTDFISNNLITDIDFATIHAYPDIWLSGKSENEQMGFMERWMANHWNDARTVLKKP  296

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+IAEFGKS KD GF+  +RD     VY  IY  A+ GG  +G L WQL+  GMD + DG
Sbjct  297  LVIAEFGKSSKDVGFSLNERDLYMGNVYRDIYRFARTGGTMSGSLVWQLMAQGMDEYNDG  356

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            Y+I+LSQ  STA ++S+Q H ++ +
Sbjct  357  YDIVLSQSPSTAGIMSRQSHAMNAL  381



>dbj|BAK05001.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=433

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
             +++ GTDFI NN+IPT+DFAT HSYPDQW+  S  + Q+ F++ W+ +HIED+   L+K
Sbjct  287  GSYSAGTDFIGNNRIPTVDFATIHSYPDQWVPGSTSEQQVEFMKKWMASHIEDAAAALRK  346

Query  787  PLLIAEFGKSWKDPGFNPT-QRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFR  611
            PLL+AEFG  WK  G      RD   R VY  IY+S K GG  AGGLFWQ++   M+++ 
Sbjct  347  PLLVAEFG--WKSSGNAAVAARDDYLRMVYDAIYASVKGGGPCAGGLFWQVMAPRMESWA  404

Query  610  DGYEILLSQRTSTANLISQQCHKLSQI  530
            DGYE++L + ++TA ++SQ+C ++  I
Sbjct  405  DGYEVVLERSSTTAAVVSQECARIGGI  431



>ref|XP_004955228.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9-like [Setaria 
italica]
Length=410

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -2

Query  967  NAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKK  788
              +++GTDFI+NN I  IDFAT HSYPDQW+  + ++ Q+AF+R W+ +H  DS   L+K
Sbjct  260  GGYSVGTDFISNNLIAGIDFATIHSYPDQWLPGASNEDQVAFMRRWMASHAGDSAAALRK  319

Query  787  PLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRD  608
            PLL+AEFG S +   +  + RDA +  VY  IY+SA+ GG  AGGLFWQ++  GM+ + D
Sbjct  320  PLLVAEFGWSARSNAYTVSARDAYFGIVYDAIYASARGGGPLAGGLFWQVMEAGMEGWTD  379

Query  607  GYEILLSQRTSTANLISQQCHKLSQI  530
            GY+++L +  STA ++S++C +++ +
Sbjct  380  GYDVVLGRSPSTAAVVSRECARITSL  405



>ref|XP_009593808.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI N+ I  IDFAT H+Y DQW+S   D +QLA+++ W+ +H ED++ ILKKP
Sbjct  258  GYQVGTDFIINHLINEIDFATIHAYTDQWVSGQSDDAQLAWMQRWVTSHWEDAKTILKKP  317

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+++EFGKS +D G+N + RD    +VY  IY+ AK  G  AG L WQL+  GM+N+ DG
Sbjct  318  LVLSEFGKSSRDQGYNLSSRDTFMSSVYRNIYNLAKEEGTMAGSLVWQLMAQGMENYDDG  377

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I+L Q  STA +IS Q H ++ +  +
Sbjct  378  YCIVLGQNPSTAGIISGQSHAMTTLANL  405



>gb|EMT21291.1| Putative mannan endo-1,4-beta-mannosidase 9 [Aegilops tauschii]
Length=429

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             +  GTDFI+NN IPT+DFAT H YPDQW+  S   +Q+ F + W+ +HIED+   L+KP
Sbjct  281  GYTGGTDFISNNHIPTVDFATIHIYPDQWLPGSSSHAQVEFTKRWMASHIEDAGKALRKP  340

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            LL+AE G S +  G+    RD  +R VY  IY+S K GG  AGGLFW ++  GM+++ DG
Sbjct  341  LLVAELGWSARSGGYTVAARDGYFRMVYDAIYASVKGGGPCAGGLFWHVMAPGMESWTDG  400

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            Y+++  +  +TA ++SQ+C K+ +I
Sbjct  401  YDVVFERSPTTAAVVSQECAKIHRI  425



>gb|KCW46727.1| hypothetical protein EUGRSUZ_K00550, partial [Eucalyptus grandis]
Length=373

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            IGTDFI+N Q+P +DF+T H YPDQW+ +  ++ Q AF   W+  HI+DS  IL KP+++
Sbjct  231  IGTDFISNTQVPQVDFSTIHLYPDQWLPNPSEKDQDAFADKWVQDHIQDSNTILNKPIIL  290

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS K  G+   +RD+ +  +Y  IY+SA   G+ AGGLFWQ+L  GMDNF DGY +
Sbjct  291  GEFGKSSKSSGYTIEKRDSYFGRLYDAIYASASNQGSCAGGLFWQVLAQGMDNFNDGYGV  350

Query  595  LLSQRTSTANLISQQCHKL  539
            +L Q  STA++I+ Q  ++
Sbjct  351  ILEQSPSTASVIAHQSRRM  369



>emb|CBI17044.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ I  IDF+T H+YPD W+S  DD SQ+AF+  W+ +H+ DS+ I+ KP
Sbjct  303  GYQVGTDFISNHLIKEIDFSTIHAYPDIWLSGKDDSSQMAFMLRWMTSHLTDSETIINKP  362

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            ++ +EFGKS KDPG++ + RD+    VY  IY+ A R G   GGL WQL+ +GM ++ DG
Sbjct  363  MVFSEFGKSSKDPGYSLSARDSFLNAVYTNIYNFA-RSGGIGGGLVWQLMAEGMQSYDDG  421

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            YEI+LSQ  ST+++I+QQ +K++ + R+
Sbjct  422  YEIVLSQNPSTSSVITQQSNKMAVLDRV  449



>ref|XP_002884819.1| hypothetical protein ARALYDRAFT_478424 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61078.1| hypothetical protein ARALYDRAFT_478424 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 98/147 (67%), Gaps = 0/147 (0%)
 Frame = -2

Query  970  LNAFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILK  791
            ++A  +G DFIAN+ I  IDFA+ H   D W+   +  S+L F+R WL  HIED+Q ILK
Sbjct  233  VSANRVGADFIANHNIDAIDFASMHCGTDLWLPKLNQNSRLEFIRRWLQGHIEDAQNILK  292

Query  790  KPLLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFR  611
            KPL++AEFG     PG+    RDA++ T Y  IY+SA++GG A G LFW+L++DGM NF 
Sbjct  293  KPLILAEFGLGTDTPGYTLANRDAVFTTTYDIIYASAQKGGPAVGALFWELISDGMSNFA  352

Query  610  DGYEILLSQRTSTANLISQQCHKLSQI  530
                I+LS ++ST N+IS+Q  KL  I
Sbjct  353  GPSSIILSDKSSTVNIISEQSRKLGLI  379



>ref|XP_009760858.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Nicotiana sylvestris]
Length=411

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
            ++ +GTDFI+N+ I  IDFAT H+Y DQW+S  +D++QLA+++ W+ +H ED++ ILKKP
Sbjct  258  SYQVGTDFISNHLINEIDFATIHAYTDQWVSGQNDEAQLAWMQRWVTSHWEDARTILKKP  317

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+++EFGKS +D G+N + RD    +VY  IY+ AK GG  AG L WQL+  GM+N+ DG
Sbjct  318  LVLSEFGKSSRDQGYNLSSRDTFMSSVYRNIYNLAKEGGTMAGSLVWQLMAQGMENYDDG  377

Query  604  YEILLSQRTSTANLISQQCHKLSQIRRI  521
            Y I+L Q  ST  +IS Q H ++ +  +
Sbjct  378  YCIVLGQNPSTTGIISGQSHAMTTLANL  405



>ref|XP_010038521.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Eucalyptus 
grandis]
Length=402

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            IGTDFI+N Q+P +DF+T H YPDQW+ +  ++ Q AF   W+  HI+DS  IL KP+++
Sbjct  260  IGTDFISNTQVPQVDFSTIHLYPDQWLPNPSEKDQDAFADKWVQDHIQDSNTILNKPIIL  319

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS K  G+   +RD+ +  +Y  IY+SA   G+ AGGLFWQ+L  GMDNF DGY +
Sbjct  320  GEFGKSSKSSGYTIEKRDSYFGRLYDAIYASASNQGSCAGGLFWQVLAQGMDNFNDGYGV  379

Query  595  LLSQRTSTANLISQQCHKL  539
            +L Q  STA++I+ Q  ++
Sbjct  380  ILEQSPSTASVIAHQSRRM  398



>ref|XP_003554587.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Glycine max]
Length=410

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 98/142 (69%), Gaps = 2/142 (1%)
 Frame = -2

Query  955  IGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKPLLI  776
            IGTDFI+NN +  +DFAT H YP+QW+  S++ +Q+AF+  WL  HI+D++ +L KP+++
Sbjct  270  IGTDFISNNLVHQVDFATMHLYPEQWLPGSNEAAQVAFVDKWLQTHIQDAKNVLAKPIVV  329

Query  775  AEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDGYEI  596
             EFGKS K   ++  +RD     +Y  IYSSA  GG  AGGLFWQL+  GMD FRDGYE+
Sbjct  330  GEFGKSLKS--YSVVERDNYLSKMYNAIYSSASSGGPCAGGLFWQLMAQGMDGFRDGYEV  387

Query  595  LLSQRTSTANLISQQCHKLSQI  530
            +  +  ST  +I QQ HK+S I
Sbjct  388  VFEESPSTTRIIDQQSHKMSSI  409



>ref|XP_009789471.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X1 
[Nicotiana sylvestris]
Length=407

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 102/145 (70%), Gaps = 0/145 (0%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+N+ I  IDFAT H+Y DQW+S   D++QLA+++ W+ +H ED++ ILKKP
Sbjct  258  GYQVGTDFISNHLINEIDFATIHAYTDQWVSGQSDEAQLAWMQRWVTSHWEDAKTILKKP  317

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSAKRggaaagGLFWQLLTDGMDNFRDG  605
            L+++EFGKS +D G+N   RD    +VY  IY+ AK GG+ AG L WQL+  GM+N+ DG
Sbjct  318  LVLSEFGKSSRDQGYNLNSRDTFMGSVYRNIYNLAKEGGSMAGSLVWQLMAHGMENYDDG  377

Query  604  YEILLSQRTSTANLISQQCHKLSQI  530
            Y I+L Q  ST  +IS Q H ++ +
Sbjct  378  YCIVLGQNPSTTGIISGQSHAMTTL  402



>emb|CDP19235.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NN+I  +DFAT H YPDQW+ +S+D++Q  F+  W+  HI+DS+Y+L+KP
Sbjct  269  GYQVGTDFISNNRIVQVDFATIHLYPDQWVPNSNDETQAQFVDRWIKEHIDDSKYLLEKP  328

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSA--KRggaaagGLFWQLLTDGMDNFR  611
            LL+ EFGKS + PG+   +RDA    +Y TIY+ A  + GG   G LFWQ++  GM+++ 
Sbjct  329  LLLTEFGKSSRSPGYQVAKRDAYLSHIYDTIYACAATRGGGVCGGNLFWQVMAPGMESWG  388

Query  610  DGYEILLSQRTSTANLISQQCHKLSQI  530
            DGYEI+L +  ST  +I+QQ ++LS +
Sbjct  389  DGYEIVLEENPSTVGVIAQQSNRLSSL  415



>emb|CAC08442.1| (1-4)-beta-mannan endohydrolase [Coffea arabica]
Length=416

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = -2

Query  964  AFNIGTDFIANNQIPTIDFATTHSYPDQWMsssddqsQLAFLRNWLNAHIEDSQYILKKP  785
             + +GTDFI+NN+I  +DFAT H YPDQW+ +S+D++Q  F+  W+  HI+DS+Y+L+KP
Sbjct  269  GYQVGTDFISNNRIVQVDFATIHLYPDQWVPNSNDETQAQFVDRWIKEHIDDSKYLLEKP  328

Query  784  LLIAEFGKSWKDPGFNPTQRDALYRTVYYTIYSSA--KRggaaagGLFWQLLTDGMDNFR  611
            LL+ EFGKS + PG+   +RDA    +Y TIY+ A  + GG   G LFWQ++  GM+++ 
Sbjct  329  LLLTEFGKSSRSPGYQVAKRDAYLSHIYDTIYACAATRGGGVCGGNLFWQVMAPGMESWG  388

Query  610  DGYEILLSQRTSTANLISQQCHKLSQI  530
            DGYEI+L +  ST  +I+QQ ++LS +
Sbjct  389  DGYEIVLEENPSTVGVIAQQSNRLSSL  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2377925492388