BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5542

Length=810
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775388.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    392   5e-130   Nicotiana sylvestris
ref|XP_009775389.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    392   8e-130   Nicotiana sylvestris
gb|AII20189.1|  glucose-6-phosphate isomerase                           391   2e-129   Nicotiana tabacum [American tobacco]
ref|NP_001275223.1|  glucose-6-phosphate isomerase                      387   4e-128   Solanum tuberosum [potatoes]
ref|XP_009598843.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    387   8e-128   Nicotiana tomentosiformis
ref|XP_004152701.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    383   3e-126   Cucumis sativus [cucumbers]
ref|XP_003618419.1|  Glucose-6-phosphate isomerase                      382   8e-126   Medicago truncatula
ref|XP_011083695.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    381   1e-125   Sesamum indicum [beniseed]
ref|XP_007221807.1|  hypothetical protein PRUPE_ppa003512mg             380   2e-125   Prunus persica
emb|CAD79590.1|  cytosolic phosphoglucose isomerase                     369   2e-125   Lopezia grandiflora
sp|P54243.1|G6PI_OENME  RecName: Full=Glucose-6-phosphate isomera...    376   1e-123   Oenothera sinuata var. hirsuta
emb|CAB55566.1|  cytosolic phosphoglucose isomerase                     376   2e-123   Clarkia gracilis
sp|P54236.1|G6PI1_CLAFR  RecName: Full=Glucose-6-phosphate isomer...    375   2e-123   Clarkia franciscana [Presidio clarkia]
ref|XP_002510371.1|  glucose-6-phosphate isomerase, putative            374   6e-123   
gb|AFK39110.1|  unknown                                                 374   6e-123   Medicago truncatula
sp|P54241.1|G6PI2_CLACO  RecName: Full=Glucose-6-phosphate isomer...    374   9e-123   Clarkia concinna [red ribbons]
emb|CAC85683.1|  cytosolic phosphoglucose isomerase                     372   1e-122   Clarkia similis
emb|CAC85684.1|  cytosolic phosphoglucose isomerase                     372   1e-122   Clarkia similis
gb|EYU45143.1|  hypothetical protein MIMGU_mgv1a003701mg                373   1e-122   Erythranthe guttata [common monkey flower]
emb|CAC86122.1|  cytosolic phosphoglucose isomerase                     373   2e-122   Clarkia modesta
sp|P54242.1|G6PI2_CLAXA  RecName: Full=Glucose-6-phosphate isomer...    373   2e-122   Clarkia xantiana [gusight clarkia]
sp|P54237.1|G6PI1_CLAMI  RecName: Full=Glucose-6-phosphate isomer...    372   3e-122   Clarkia mildrediae
emb|CAB55567.1|  cytosolic phosphoglucose isomerase                     372   4e-122   Clarkia gracilis
sp|P54234.1|G6PI1_CLAAR  RecName: Full=Glucose-6-phosphate isomer...    372   4e-122   Clarkia arcuata
sp|P54240.1|G6PI1_CLAXA  RecName: Full=Glucose-6-phosphate isomer...    372   5e-122   Clarkia xantiana [gusight clarkia]
sp|P54239.1|G6PI1_CLAWI  RecName: Full=Glucose-6-phosphate isomer...    372   6e-122   Clarkia williamsonii
sp|P34797.1|G6PI3_CLALE  RecName: Full=Glucose-6-phosphate isomer...    362   9e-122   Clarkia lewisii
sp|P54235.1|G6PI1_CLACO  RecName: Full=Glucose-6-phosphate isomer...    371   1e-121   Clarkia concinna [red ribbons]
emb|CAC84508.1|  cytosolic phosphoglucose isomerase                     370   1e-121   Clarkia delicata
emb|CAC82578.1|  cytosolic phosphoclucose isomerase                     371   1e-121   Clarkia epilobioides
emb|CAC84514.1|  cytosolic phosphoglucose isomerase                     369   3e-121   Clarkia delicata
gb|EPS71211.1|  glucose-6-phosphate isomerase                           369   5e-121   Genlisea aurea
emb|CAC85685.1|  cytosolic phosphoglucose isomerase                     367   6e-121   Clarkia similis
ref|XP_012071828.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    369   6e-121   Jatropha curcas
gb|EYU45142.1|  hypothetical protein MIMGU_mgv1a003701mg                369   8e-121   Erythranthe guttata [common monkey flower]
sp|P29333.1|G6PI2_CLALE  RecName: Full=Glucose-6-phosphate isomer...    369   9e-121   Clarkia lewisii
emb|CAC85686.1|  cytosolic phosphoglucose isomerase                     367   1e-120   Clarkia similis
emb|CAC82579.1|  cytosolic phosphoclucose isomerase                     368   1e-120   Clarkia epilobioides
sp|P34796.1|G6PI1_CLALE  RecName: Full=Glucose-6-phosphate isomer...    368   2e-120   Clarkia lewisii
ref|XP_004489355.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    367   2e-120   
emb|CAC84511.1|  cytosolic phosphoglucose isomerase                     365   5e-120   Clarkia delicata
sp|P54238.1|G6PI1_CLARO  RecName: Full=Glucose-6-phosphate isomer...    367   5e-120   Clarkia rostrata
emb|CDP07527.1|  unnamed protein product                                352   2e-119   Coffea canephora [robusta coffee]
ref|XP_007017512.1|  Sugar isomerase (SIS) family protein isoform 3     363   4e-119   
ref|NP_001265881.1|  glucose-6-phosphate isomerase                      364   5e-119   Solanum lycopersicum
ref|XP_010677508.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    364   5e-119   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006837344.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    364   7e-119   Amborella trichopoda
ref|XP_007017511.1|  Sugar isomerase (SIS) family protein isoform 2     363   1e-118   
ref|XP_008220896.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    363   1e-118   Prunus mume [ume]
emb|CAB55568.1|  cytosolic phosphoglucose isomerase                     348   4e-117   Clarkia gracilis
gb|KJB14509.1|  hypothetical protein B456_002G128400                    358   7e-117   Gossypium raimondii
ref|XP_010106007.1|  Glucose-6-phosphate isomerase, cytosolic 1         358   8e-117   
ref|XP_008444704.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    358   8e-117   Cucumis melo [Oriental melon]
ref|XP_010313627.1|  PREDICTED: glucose-6-phosphate isomerase iso...    358   1e-116   Solanum lycopersicum
ref|XP_007017510.1|  Sugar isomerase family protein isoform 1           362   1e-116   
ref|XP_007136588.1|  hypothetical protein PHAVU_009G057500g             358   2e-116   Phaseolus vulgaris [French bean]
gb|KHN34179.1|  Glucose-6-phosphate isomerase, cytosolic 1              357   2e-116   Glycine soja [wild soybean]
gb|KDO84534.1|  hypothetical protein CISIN_1g007374mg                   353   2e-116   Citrus sinensis [apfelsine]
gb|KHN45846.1|  Glucose-6-phosphate isomerase, cytosolic                357   3e-116   Glycine soja [wild soybean]
ref|XP_003554193.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    357   3e-116   Glycine max [soybeans]
ref|XP_006434973.1|  hypothetical protein CICLE_v10000722mg             357   3e-116   Citrus clementina [clementine]
gb|AEH27532.1|  putative glucose-6-phosphateisomerase                   344   3e-116   Amorphophallus konjac [devil's-tongue]
ref|XP_002282774.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    357   5e-116   Vitis vinifera
ref|XP_002312387.2|  hypothetical protein POPTR_0008s11770g             357   5e-116   Populus trichocarpa [western balsam poplar]
ref|XP_006582469.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph...    353   5e-116   
ref|NP_001242028.1|  uncharacterized protein LOC100807719               356   6e-116   Glycine max [soybeans]
ref|XP_008357232.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    347   7e-116   
ref|XP_010060937.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    355   1e-115   Eucalyptus grandis [rose gum]
ref|XP_006473486.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    355   1e-115   Citrus sinensis [apfelsine]
ref|XP_008377333.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    355   2e-115   Malus domestica [apple tree]
gb|KHN22258.1|  Glucose-6-phosphate isomerase, cytosolic                354   3e-115   Glycine soja [wild soybean]
ref|XP_009365601.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    354   4e-115   Pyrus x bretschneideri [bai li]
emb|CAD24788.1|  cytosolic phosphoglucose isomerase                     354   4e-115   Clarkia heterandra
gb|KJB14513.1|  hypothetical protein B456_002G128400                    354   5e-115   Gossypium raimondii
ref|XP_010263691.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    354   5e-115   Nelumbo nucifera [Indian lotus]
gb|KDO84533.1|  hypothetical protein CISIN_1g007374mg                   355   6e-115   Citrus sinensis [apfelsine]
ref|XP_008377470.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    347   8e-115   
ref|XP_004291883.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    353   1e-114   Fragaria vesca subsp. vesca
ref|XP_009364475.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    352   2e-114   Pyrus x bretschneideri [bai li]
ref|XP_008377422.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    351   5e-114   
ref|XP_007151167.1|  hypothetical protein PHAVU_004G023500g             348   5e-113   Phaseolus vulgaris [French bean]
ref|XP_011021922.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    348   6e-113   Populus euphratica
gb|KCW67833.1|  hypothetical protein EUGRSUZ_F01561                     347   3e-112   Eucalyptus grandis [rose gum]
ref|XP_010254873.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    345   1e-111   Nelumbo nucifera [Indian lotus]
gb|AAY85660.1|  cytosolic glucose-6-phosphate isomerase                 345   2e-111   Helianthus annuus
sp|O82059.2|G6PI_SPIOL  RecName: Full=Glucose-6-phosphate isomera...    341   5e-110   Spinacia oleracea
ref|XP_009407687.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    340   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK24817.1|  unknown                                                 331   5e-109   Picea sitchensis
dbj|BAB83916.1|  cytosolic phosphoglucose isomerase                     327   3e-108   Dryopteris caudipinna
emb|CAC85668.1|  cytosolic phosphoglucose isomerase                     321   2e-107   Clarkia similis
ref|XP_008353564.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    325   2e-107   
ref|XP_010519111.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    333   8e-107   Tarenaya hassleriana [spider flower]
dbj|BAA23180.1|  cytosolic phosphoglucose isomerase                     331   3e-106   Dioscorea tokoro [shan bei xie]
dbj|BAA23177.1|  cytosolic phosphoglucose isomerase                     331   4e-106   Dioscorea tokoro [shan bei xie]
dbj|BAA23176.1|  phosphoglucose isomerase                               331   4e-106   Dioscorea tokoro [shan bei xie]
dbj|BAA23179.1|  cytosolic phosphoglucose isomerase                     331   5e-106   Dioscorea tokoro [shan bei xie]
dbj|BAA23181.1|  cytosolic phosphoglucose isomerase                     331   5e-106   Dioscorea tokoro [shan bei xie]
dbj|BAA23185.2|  phosphoglucose isomerase                               331   5e-106   Dioscorea tokoro [shan bei xie]
emb|CDX95171.1|  BnaC09g16990D                                          318   5e-106   
dbj|BAC77713.1|  cytosolic phosphoglucose isomerase                     330   6e-106   Arabidopsis halleri subsp. gemmifera
gb|KJB14514.1|  hypothetical protein B456_002G128400                    330   1e-105   Gossypium raimondii
ref|XP_010942803.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    330   1e-105   Elaeis guineensis
ref|XP_010442128.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    329   1e-105   Camelina sativa [gold-of-pleasure]
sp|Q9FXM4.1|G6PI_ARALP  RecName: Full=Glucose-6-phosphate isomera...    329   2e-105   Arabidopsis lyrata subsp. petraea
ref|XP_002865489.1|  glucose-6-phosphate isomerase                      328   3e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_010481956.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    328   3e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010481955.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    328   3e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010494215.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    328   4e-105   Camelina sativa [gold-of-pleasure]
sp|Q9FXM5.2|G6PI_ARAHG  RecName: Full=Glucose-6-phosphate isomera...    328   4e-105   Arabidopsis halleri subsp. gemmifera
ref|XP_010481952.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    328   4e-105   Camelina sativa [gold-of-pleasure]
dbj|BAA23182.1|  cytosolic phosphoglucose isomerase                     328   5e-105   Dioscorea tokoro [shan bei xie]
dbj|BAC77708.1|  cytosolic phosphoglucose isomerase                     327   9e-105   Arabidopsis halleri subsp. gemmifera
dbj|BAC77716.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis halleri subsp. gemmifera
dbj|BAC11915.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis halleri subsp. gemmifera
dbj|BAC77717.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis halleri subsp. gemmifera
gb|AAK50107.1|AF372970_1  AT5g42740/MJB21_12                            327   1e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17648.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC77720.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis halleri subsp. gemmifera
dbj|BAC77715.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis halleri subsp. gemmifera
dbj|BAB17654.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199088.1|  glucose-6-phosphate isomerase                         327   1e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC77710.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis halleri subsp. gemmifera
dbj|BAB17636.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC77714.1|  cytosolic phosphoglucose isomerase                     327   1e-104   Arabidopsis halleri subsp. gemmifera
dbj|BAC77709.1|  cytosolic phosphoglucose isomerase                     327   2e-104   Arabidopsis halleri subsp. gemmifera
dbj|BAB17649.1|  cytosolic phosphoglucose isomerase                     327   2e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17646.1|  cytosolic phosphoglucose isomerase                     327   2e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17635.1|  cytosolic phosphoglucose isomerase                     327   2e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17643.1|  cytosolic phosphoglucose isonerase                     327   2e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17637.1|  cytosolic phosphoglucose isomerase                     327   2e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC77719.1|  cytosolic phosphoglucose isomerase                     326   4e-104   Arabidopsis halleri subsp. gemmifera
dbj|BAC11914.1|  cytosolic phosphoglucose isomerase                     325   4e-104   Crucihimalaya himalaica
ref|XP_008783474.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    325   6e-104   Phoenix dactylifera
dbj|BAB17650.1|  cytosolic phosphoglucose isomerase                     325   6e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CAC85669.1|  cytosolic phosphoglucose isomerase                     311   7e-104   Clarkia similis
dbj|BAB17645.1|  cytosolic phosphoglucose isomerase                     325   8e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CAC85647.1|  cytosolic phosphoglucose isomerase                     309   4e-103   Clarkia similis
gb|KJB14511.1|  hypothetical protein B456_002G128400                    322   6e-103   Gossypium raimondii
ref|XP_006281946.1|  hypothetical protein CARUB_v10028158mg             322   6e-103   Capsella rubella
gb|AAC08411.1|  cytosolic phosphoglucose isomerase                      322   1e-102   Leavenworthia crassa
gb|AED99453.1|  PgiC protein                                            322   2e-102   Poa palustris
emb|CDY64430.1|  BnaA09g16190D                                          321   3e-102   Brassica napus [oilseed rape]
ref|XP_009114042.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    321   3e-102   Brassica rapa
dbj|BAB17639.1|  cytosolic phosphoglucose isomerase                     320   4e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AED99455.1|  PgiC2-3 protein                                         320   7e-102   Festuca ovina
emb|CAC85670.1|  cytosolic phosphoglucose isomerase                     306   1e-101   Clarkia similis
dbj|BAC11913.1|  cytosolic phosphoglucose isomerase                     319   2e-101   Turritis glabra
ref|XP_004981572.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    319   2e-101   Setaria italica
tpg|DAA51693.2|  TPA: glucose-6-phosphate isomerase, cytosolic(Ph...    306   2e-101   
gb|KDO84532.1|  hypothetical protein CISIN_1g007374mg                   318   4e-101   Citrus sinensis [apfelsine]
ref|XP_009381882.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    319   6e-101   
gb|EMS52088.1|  Glucose-6-phosphate isomerase, cytosolic                317   6e-101   Triticum urartu
gb|AED99454.1|  PgiC protein                                            317   1e-100   Festuca ovina
gb|ABE41790.1|  glucose-6-phosphate isomerase                           315   4e-100   Triticum aestivum [Canadian hard winter wheat]
gb|ABB90111.1|  phosphoglucoisomerase                                   314   7e-100   Festuca ovina
gb|AED99456.1|  PgiC2-4 protein                                         315   7e-100   Festuca ovina
dbj|BAA08149.1|  phosphoglucose isomerase (Pgi-b)                       315   7e-100   Oryza sativa [red rice]
ref|XP_006403357.1|  hypothetical protein EUTSA_v10003173mg             313   2e-99    
ref|NP_001057316.1|  Os06g0256500                                       313   2e-99    
gb|ABE41789.1|  glucose-6-phosphate isomerase                           313   3e-99    Hordeum vulgare [barley]
gb|AGT38452.1|  phosphoglucose isomerase                                312   9e-99    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051434.1|  Os03g0776000                                       312   1e-98    
gb|EEC76262.1|  hypothetical protein OsI_13718                          312   1e-98    Oryza sativa Indica Group [Indian rice]
gb|EMT10058.1|  Glucose-6-phosphate isomerase, cytosolic                311   1e-98    
ref|XP_002968611.1|  hypothetical protein SELMODRAFT_89539              310   3e-98    
ref|XP_001760206.1|  predicted protein                                  311   3e-98    
dbj|BAA08148.1|  phosphoglucose isomerase (Pgi-a)                       310   3e-98    Oryza sativa [red rice]
gb|ABK00059.1|  cytosolic glucose-6-phosphate isomerase                 311   4e-98    Marchantia polymorpha
ref|NP_001105368.1|  glucose-6-phosphate isomerase, cytosolic           310   8e-98    Zea mays [maize]
ref|XP_002975871.1|  hypothetical protein SELMODRAFT_104526             309   1e-97    
ref|XP_003569006.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    309   1e-97    Brachypodium distachyon [annual false brome]
gb|ABK00065.1|  cytosolic glucose-6-phosphate isomerase                 311   1e-97    Marchantia polymorpha
gb|EEC80343.1|  hypothetical protein OsI_22416                          310   1e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_002509192.1|  phosphoglucose isomerase                           306   3e-96    Micromonas commoda
ref|XP_006651865.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    313   5e-96    
ref|XP_003082100.1|  cytosolic phosphoglucose isomerase (ISS)           304   2e-95    
dbj|BAB17655.1|  cytosolic phosphoglucose isomerase                     302   4e-95    Arabidopsis halleri subsp. gemmifera
emb|CEF99714.1|  Phosphoglucose isomerase, C-terminal                   304   4e-95    Ostreococcus tauri
gb|ABK00069.1|  cytosolic glucose-6-phosphate isomerase                 300   5e-94    Chara vulgaris
ref|XP_001703279.1|  phosphoglucose isomerase                           302   5e-94    Chlamydomonas reinhardtii
ref|XP_007509641.1|  cytosolic phosphoglucose isomerase                 301   8e-94    Bathycoccus prasinos
ref|XP_002946940.1|  hypothetical protein VOLCADRAFT_103185             299   2e-93    Volvox carteri f. nagariensis
ref|XP_001420367.1|  predicted protein                                  298   4e-93    Ostreococcus lucimarinus CCE9901
ref|XP_003061563.1|  predicted protein                                  298   8e-93    Micromonas pusilla CCMP1545
ref|XP_001778143.1|  predicted protein                                  297   1e-92    
ref|XP_001782795.1|  predicted protein                                  296   2e-92    
gb|ACI29026.1|  glucose-6-phosphate isomerase                           295   2e-91    Dunaliella salina
gb|AAL04447.1|  cytosolic phosphoglucoisomerase                         278   6e-91    Beta vulgaris [beet]
gb|KIY94551.1|  glucose-6-phosphate isomerase                           276   3e-89    Monoraphidium neglectum
ref|XP_005650466.1|  cytosolic phosphoglucose isomerase                 286   1e-88    Coccomyxa subellipsoidea C-169
emb|CBK23535.2|  unnamed protein product                                285   4e-88    Blastocystis hominis
ref|XP_001754629.1|  predicted protein                                  284   9e-88    
gb|ABK00064.1|  cytosolic glucose-6-phosphate isomerase                 283   1e-87    Mesostigma viride
gb|KHG04166.1|  Glucose-6-phosphate isomerase, cytosolic                280   1e-86    Gossypium arboreum [tree cotton]
ref|XP_007151166.1|  hypothetical protein PHAVU_004G023500g             277   6e-86    Phaseolus vulgaris [French bean]
gb|ACB69778.1|  phosphoglucose isomerase                                274   2e-85    Poa pratensis subsp. angustifolia
ref|XP_008876241.1|  hypothetical protein H310_11362                    276   4e-85    Aphanomyces invadans
emb|CAD79585.1|  cytosolic phosphoglucose isomerase                     263   6e-85    Megacorax gracielanus
gb|KIZ06944.1|  glucose-6-phosphate isomerase                           276   7e-85    Monoraphidium neglectum
gb|ETP26016.1|  hypothetical protein F441_01181                         276   7e-85    Phytophthora parasitica CJ01A1
gb|ETK96016.1|  hypothetical protein L915_01139                         276   7e-85    Phytophthora parasitica
ref|XP_008890866.1|  hypothetical protein PPTG_01022                    275   8e-85    Phytophthora parasitica INRA-310
gb|ETP54025.1|  hypothetical protein F442_01139                         275   9e-85    Phytophthora parasitica P10297
ref|XP_009523844.1|  glucose-6-phosphate isomerase                      275   1e-84    Phytophthora sojae
emb|CAD79577.1|  cytosolic phosphoglucose isomerase                     261   1e-84    Hauya heydeana
gb|AAP51074.1|  glucose-6-phosphate isomerase                           273   5e-84    Phytophthora cactorum
ref|XP_005713157.1|  glucose-6-phosphate isomerase                      273   6e-84    Chondrus crispus [carageen]
ref|XP_002967787.1|  hypothetical protein SELMODRAFT_409075             285   1e-83    
gb|AAP51066.1|  glucose-6-phosphate isomerase                           273   1e-83    Phytophthora infestans [potato late blight]
gb|AAP51076.1|  glucose-6-phosphate isomerase                           273   1e-83    Phytophthora erythroseptica
gb|AAP51065.1|  glucose-6-phosphate isomerase                           273   1e-83    Phytophthora infestans [potato late blight]
gb|AAP51075.1|  glucose-6-phosphate isomerase                           272   1e-83    Phytophthora erythroseptica
gb|ABH11442.1|  cytosolic glucose-6-phosphate isomerase                 272   1e-83    Chondrus crispus [carageen]
gb|AAP51072.1|  glucose-6-phosphate isomerase                           272   1e-83    Phytophthora infestans [potato late blight]
gb|AAP51069.1|  glucose-6-phosphate isomerase                           272   2e-83    Phytophthora infestans [potato late blight]
gb|AAP51080.1|  glucose-6-phosphate isomerase                           272   2e-83    Phytophthora infestans [potato late blight]
gb|ACB69780.1|  phosphoglucose isomerase                                268   2e-83    Poa nemoralis
ref|XP_002908462.1|  glucose-6-phosphate isomerase                      272   2e-83    Phytophthora infestans T30-4
gb|AAP51068.1|  glucose-6-phosphate isomerase                           272   2e-83    Phytophthora infestans [potato late blight]
gb|ACB69781.1|  phosphoglucose isomerase                                268   2e-83    Poa nemoralis
gb|AAP51063.1|  glucose-6-phosphate isomerase                           272   2e-83    Phytophthora mirabilis
gb|AAP51071.1|  glucose-6-phosphate isomerase                           272   2e-83    Phytophthora infestans [potato late blight]
gb|ACB69779.1|  phosphoglucose isomerase                                268   2e-83    Poa chaixii
gb|ACB69786.1|  phosphoglucose isomerase                                268   2e-83    Poa palustris
gb|ACB69788.1|  phosphoglucose isomerase                                268   2e-83    Poa pratensis
gb|AAP51067.1|  glucose-6-phosphate isomerase                           271   2e-83    Phytophthora infestans [potato late blight]
gb|AAP51062.1|  glucose-6-phosphate isomerase                           271   2e-83    Phytophthora infestans [potato late blight]
gb|AAP51061.1|  glucose-6-phosphate isomerase                           271   2e-83    Phytophthora infestans [potato late blight]
gb|ACB69787.1|  phosphoglucose isomerase                                268   2e-83    Poa palustris
emb|CAC84504.1|  cytosolic phosphoglucose isomerase                     258   3e-83    Clarkia delicata
emb|CCA13931.1|  unnamed protein product                                271   5e-83    Albugo laibachii Nc14
emb|CAD79578.1|  cytosolic phosphoglucose isomerase                     266   5e-83    Ludwigia peploides
gb|AAP51060.1|  glucose-6-phosphate isomerase                           271   6e-83    Phytophthora infestans [potato late blight]
gb|ACB69784.1|  phosphoglucose isomerase                                267   7e-83    Poa pratensis
gb|AAP51079.1|  glucose-6-phosphate isomerase                           270   9e-83    Phytophthora infestans [potato late blight]
emb|CCI49830.1|  unnamed protein product                                268   1e-82    Albugo candida
emb|CAD79587.1|  cytosolic phosphoglucose isomerase                     264   1e-82    Hauya elegans
gb|ACB69777.1|  phosphoglucose isomerase                                266   2e-82    Poa pratensis subsp. angustifolia
emb|CAD79574.1|  cytosolic phosphoglucose isomerase                     256   2e-82    Fuchsia cylindracea
ref|XP_008611761.1|  glucose-6-phosphate isomerase, cytosolic 2         269   2e-82    Saprolegnia diclina VS20
ref|XP_009825599.1|  hypothetical protein H257_03289                    269   2e-82    Aphanomyces astaci
gb|AAP51070.1|  glucose-6-phosphate isomerase                           269   2e-82    Phytophthora infestans [potato late blight]
emb|CCI49829.1|  unnamed protein product                                269   3e-82    Albugo candida
emb|CAD79584.1|  cytosolic phosphoglucose isomerase                     263   3e-82    Epilobium brachycarpum
gb|AAP51077.1|  glucose-6-phosphate isomerase                           269   4e-82    Phytophthora erythroseptica
emb|CAD79571.1|  cytosolic phosphoglucose isomerase                     255   4e-82    Circaea cordata
gb|KDO30887.1|  glucose-6-phosphate isomerase                           268   4e-82    Saprolegnia parasitica CBS 223.65
gb|AAP51073.1|  glucose-6-phosphate isomerase                           268   4e-82    Phytophthora cactorum
gb|ACR55850.1|  cytosolic phosphoglucose isomerase                      258   1e-81    Achillea aspleniifolia
ref|XP_005851258.1|  hypothetical protein CHLNCDRAFT_138008             266   1e-81    Chlorella variabilis
gb|ACR55856.1|  cytosolic phosphoglucose isomerase                      257   1e-81    Achillea aspleniifolia
gb|ACR55891.1|  cytosolic phosphoglucose isomerase                      257   1e-81    Achillea ligustica
gb|ACB69785.1|  phosphoglucose isomerase                                263   4e-81    Poa pratensis
gb|ADB85510.1|  glucose-6-phosphate isomerase                           256   5e-81    Ostreococcus tauri
gb|ACB69783.1|  phosphoglucose isomerase                                262   6e-81    Poa pratensis
emb|CAI63207.1|  cytosolic phosphoglucose isomerase                     254   2e-80    Stephanomeria virgata subsp. virgata
gb|ABH11441.1|  cytosolic glucose-6-phosphate isomerase                 254   3e-80    Cyanophora paradoxa
gb|ABH11444.1|  cytosolic glucose-6-phosphate isomerase                 263   4e-80    Chondrus crispus [carageen]
emb|CAD79580.1|  cytosolic phosphoglucose isomerase                     261   4e-80    Oenothera lindheimeri
gb|ABH11446.1|  cytosolic glucose-6-phosphate isomerase                 261   5e-80    Cyanophora paradoxa
gb|AIY55214.1|  cytosolic phosphoglucose isomerase C2                   251   7e-80    Clarkia dudleyana
emb|CAD79581.1|  cytosolic phosphoglucose isomerase                     257   8e-80    Epilobium canum
emb|CAD79583.1|  cytosolic phosphoglucose isomerase                     257   1e-79    Epilobium brachycarpum
gb|ACR55876.1|  cytosolic phosphoglucose isomerase                      252   1e-79    Achillea asplenifolia x Achillea collina
ref|XP_005718631.1|  glucose-6-phosphate isomerase                      263   1e-79    Chondrus crispus [carageen]
gb|ADB85499.1|  glucose-6-phosphate isomerase                           252   2e-79    Chlamydomonas reinhardtii
ref|XP_011397571.1|  Glucose-6-phosphate isomerase, cytosolic           263   2e-79    Auxenochlorella protothecoides
emb|CBN74985.1|  conserved unknown protein                              261   3e-79    Ectocarpus siliculosus
gb|ADB85501.1|  glucose-6-phosphate isomerase                           251   5e-79    Chlorokybus atmophyticus
emb|CAD79582.1|  cytosolic phosphoglucose isomerase                     254   1e-78    Epilobium canum
ref|XP_008377469.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    246   2e-78    
gb|ADB85504.1|  glucose-6-phosphate isomerase                           249   2e-78    Closterium sp. EEC-2010
emb|CAC86121.1|  cytosolic phosphoglucose isomerase                     257   2e-78    Clarkia modesta
emb|CAB55569.1|  cytosolic phosphoglucose isomerase                     247   3e-78    Clarkia lassenensis
gb|ABH11437.1|  cytosolic glucose-6-phosphate isomerase                 258   3e-78    Lingulodinium polyedra
emb|CAD79579.1|  cytosolic phosphoglucose isomerase                     257   3e-78    Oenothera toumeyi
dbj|BAA23205.1|  phosphoglucose isomerase                               254   7e-78    Dioscorea quinquelobata
ref|XP_005707296.1|  glucose-6-phosphate isomerase                      258   2e-77    Galdieria sulphuraria
emb|CAD24784.1|  cytosolic phosphoglucose isomerase                     254   2e-77    Clarkia lingulata
emb|CDJ39851.1|  glucose-6-phosphate isomerase, putative                244   2e-77    
gb|AIY55213.1|  cytosolic phosphoglucose isomerase C2                   254   2e-77    
gb|AIY55212.1|  cytosolic phosphoglucose isomerase C1                   254   3e-77    
emb|CAC86123.1|  cytosolic phosphoglucose isomerase                     254   3e-77    
emb|CAC84505.1|  cytosolic phosphoglucose isomerase                     252   3e-77    
gb|ADB85506.1|  glucose-6-phosphate isomerase                           246   6e-77    
emb|CAD24783.1|  cytosolic phosphoglucose isomerase                     253   6e-77    
ref|XP_005845944.1|  hypothetical protein CHLNCDRAFT_135927             256   1e-76    
gb|ABH11438.1|  cytosolic glucose-6-phosphate isomerase                 254   1e-76    
emb|CDJ56388.1|  glucose-6-phosphate isomerase, putative                255   1e-76    
gb|AIY55211.1|  cytosolic phosphoglucose isomerase C1                   253   1e-76    
emb|CAD24787.1|  cytosolic phosphoglucose isomerase                     252   2e-76    
gb|EWM30292.1|  glucose-6-phosphate isomerase                           254   2e-76    
gb|AIY55208.1|  cytosolic phosphoglucose isomerase C1                   251   5e-76    
gb|ABH11443.1|  cytosolic glucose-6-phosphate isomerase                 252   4e-75    
emb|CDI80540.1|  glucose-6-phosphate isomerase, putative                248   2e-74    
gb|KDD75199.1|  phosphoglucose isomerase                                249   3e-74    
gb|ADI59420.1|  glucose-6-phosphate isomerase                           247   7e-74    
gb|ADB85505.1|  glucose-6-phosphate isomerase                           237   8e-74    
ref|XP_005537531.1|  glucose-6-phosphate isomerase                      249   8e-74    
ref|XP_001238687.1|  glucose-6-phosphate isomerase                      246   9e-74    
gb|ADB85497.1|  glucose-6-phosphate isomerase                           236   1e-73    
gb|ADB85495.1|  glucose-6-phosphate isomerase                           237   1e-73    
gb|ACB69782.1|  phosphoglucose isomerase                                242   2e-73    
gb|ACB69776.1|  phosphoglucose isomerase                                242   2e-73    
gb|ADB85500.1|  glucose-6-phosphate isomerase                           236   3e-73    
ref|XP_005537536.1|  glucose-6-phosphate isomerase                      249   3e-73    
ref|XP_010935387.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    235   3e-73    
ref|XP_003883126.1|  Glucose-6-phosphate isomerase,related              242   8e-73    
emb|CAI63193.1|  cytosolic phosphoglucose isomerase                     231   8e-73    
emb|CAI63180.1|  cytosolic phosphoglucose isomerase                     231   9e-73    
gb|ADI59419.1|  glucose-6-phosphate isomerase                           244   9e-73    
gb|AAD30265.1|AF065160_1  glucose-6-phosphate isomerase                 243   2e-72    
pdb|3UJH|A  Chain A, Crystal Structure Of Substrate-Bound Glucose...    243   2e-72    
ref|XP_002369127.1|  glucose-6-phosphate isomerase                      243   2e-72    
emb|CAI63189.1|  cytosolic phosphoglucose isomerase                     230   2e-72    
gb|ADB85494.1|  glucose-6-phosphate isomerase                           234   2e-72    
gb|ADB85514.1|  glucose-6-phosphate isomerase                           234   3e-72    
ref|XP_008888055.1|  glucose-6-phosphate isomerase GPI                  245   4e-72    
gb|ESS30496.1|  glucose-6-phosphate isomerase GPI                       244   5e-72    
gb|EPT30938.1|  glucose-6-phosphate isomerase GPI                       244   5e-72    
gb|EPR59303.1|  glucose-6-phosphate isomerase GPI                       244   6e-72    
emb|CAI63179.1|  cytosolic phosphoglucose isomerase                     232   9e-72    
gb|ADB85508.1|  glucose-6-phosphate isomerase                           231   1e-71    
emb|CAI63174.1|  cytosolic phosphoglucose isomerase                     231   1e-71    
emb|CAI63171.1|  cytosolic phosphoglucose isomerase                     231   1e-71    
emb|CAI63170.1|  cytosolic phosphoglucose isomerase                     231   1e-71    
emb|CAI63178.1|  cytosolic phosphoglucose isomerase                     231   1e-71    
emb|CAI63202.1|  cytosolic phosphoglucose isomerase                     231   2e-71    
ref|XP_005539460.1|  glucose-6-phosphate isomerase                      241   3e-71    
emb|CDJ62718.1|  glucose-6-phosphate isomerase, putative                241   5e-71    
gb|ADB85503.1|  glucose-6-phosphate isomerase                           230   7e-71    
emb|CAI63186.1|  cytosolic phosphoglucose isomerase                     229   1e-70    
ref|XP_001030231.2|  glucose-6-phosphate isomerase family protein       239   1e-70    
emb|CAI63169.1|  cytosolic phosphoglucose isomerase                     229   1e-70    
ref|XP_002185232.1|  isomerase glucose-6-phosphate isomerase            239   2e-70    
emb|CAI63188.1|  cytosolic phosphoglucose isomerase                     228   2e-70    
emb|CAI63175.1|  cytosolic phosphoglucose isomerase                     228   2e-70    
gb|EJK76543.1|  hypothetical protein THAOC_01690                        229   2e-70    
gb|ADB85515.1|  glucose-6-phosphate isomerase                           228   3e-70    
gb|ADB85496.1|  glucose-6-phosphate isomerase                           228   5e-70    
gb|EJY71796.1|  Glucose-6-phosphate isomerase                           237   8e-70    
gb|ADB85513.1|  glucose-6-phosphate isomerase                           224   8e-69    
gb|ADB85498.1|  glucose-6-phosphate isomerase                           224   9e-69    
ref|XP_002288430.1|  glucose-6-phosphate isomerase                      235   1e-68    
ref|XP_004030003.1|  hypothetical protein IMG5_169030                   229   3e-68    
gb|ADB85512.1|  glucose-6-phosphate isomerase                           223   3e-68    
gb|ADB85516.1|  glucose-6-phosphate isomerase                           223   4e-68    
gb|KDD74481.1|  phosphoglucose isomerase                                231   5e-68    
gb|ADB85507.1|  glucose-6-phosphate isomerase                           221   2e-67    
ref|XP_009033908.1|  hypothetical protein AURANDRAFT_69676              229   4e-67    
ref|XP_011129807.1|  glucose-6-phosphate isomerase                      228   2e-66    
emb|CDW86601.1|  glucose-6-phosphate isomerase                          228   2e-66    
ref|XP_002185275.1|  isomerase glucose-6-phosphate isomerase            228   3e-65    
ref|XP_002289565.1|  predicted protein                                  224   1e-63    
emb|CAC82581.1|  cytosolic phosphoclucose isomerase                     205   8e-63    
gb|KHG04167.1|  Glucose-6-phosphate isomerase, cytosolic                216   2e-62    
ref|XP_005703455.1|  glucose-6-phosphate isomerase                      215   6e-62    
emb|CDO66827.1|  glucose-6-phosphate isomerase                          214   3e-61    
gb|ADB85502.1|  glucose-6-phosphate isomerase                           204   4e-61    
gb|EWM29429.1|  cytosolic phosphoglucose isomerase                      220   5e-61    
gb|EUD71947.1|  glucose-6-phosphate isomerase                           214   5e-61    
gb|ABG36038.1|  cytosolic phosphoglucose isomerase                      203   6e-61    
gb|ABG36068.1|  cytosolic phosphoglucose isomerase                      203   6e-61    
emb|CDU21573.1|  glucose-6-phosphate isomerase, putative                213   7e-61    
gb|ABG36044.1|  cytosolic phosphoglucose isomerase                      203   7e-61    
gb|ABG36039.1|  cytosolic phosphoglucose isomerase                      203   7e-61    
gb|ABG36051.1|  cytosolic phosphoglucose isomerase                      202   9e-61    
gb|ABG36058.1|  cytosolic phosphoglucose isomerase                      202   9e-61    
gb|ABG36048.1|  cytosolic phosphoglucose isomerase                      202   9e-61    
gb|ABG36064.1|  cytosolic phosphoglucose isomerase                      202   9e-61    
gb|ABG36060.1|  cytosolic phosphoglucose isomerase                      202   9e-61    
gb|ABG36030.1|  cytosolic phosphoglucose isomerase                      202   9e-61    
gb|ABG36077.1|  cytosolic phosphoglucose isomerase                      202   1e-60    
gb|ABG36031.1|  cytosolic phosphoglucose isomerase                      202   1e-60    
gb|ABG36040.1|  cytosolic phosphoglucose isomerase                      202   1e-60    
gb|EWC73854.1|  glucose-6-phosphate isomerase                           213   1e-60    
ref|XP_001348515.1|  glucose-6-phosphate isomerase                      213   1e-60    
gb|ETW28474.1|  glucose-6-phosphate isomerase                           213   1e-60    
ref|XP_002787676.1|  glucose-6-phosphate isomerase, putative            212   1e-60    
gb|EUT78863.1|  glucose-6-phosphate isomerase                           212   2e-60    
pdb|3PR3|A  Chain A, Crystal Structure Of Plasmodium Falciparum G...    213   2e-60    
gb|ABG36046.1|  cytosolic phosphoglucose isomerase                      201   2e-60    
ref|XP_002777180.1|  glucose-6-phosphate isomerase, putative            209   2e-60    
gb|ABG36042.1|  cytosolic phosphoglucose isomerase                      201   2e-60    
gb|EAR82564.2|  glucose-6-phosphate isomerase                           201   3e-60    
ref|XP_725749.1|  phosphoglucose isomerase                              210   9e-60    
gb|ABG36057.1|  cytosolic phosphoglucose isomerase                      200   9e-60    
ref|XP_008625120.1|  glucose-6-phosphate isomerase                      210   9e-60    
gb|ADB85511.1|  glucose-6-phosphate isomerase                           201   1e-59    
ref|XP_001030227.1|  Glucose-6-phosphate isomerase                      199   1e-59    
dbj|BAM15604.1|  glucose-6-phosphate isomerase                          210   1e-59    
ref|XP_002775575.1|  glucose-6-phosphate isomerase, putative            209   2e-59    
ref|XP_626511.1|  glucose-6-phosphate isomerase, cytosolic (GPI) ...    208   4e-59    
ref|WP_031182000.1|  glucose-6-phosphate isomerase                      197   7e-59    
ref|XP_667249.1|  glucose-6-phosphate isomerase                         207   9e-59    
emb|CDR96067.1|  glucose-6-phosphate isomerase protein, putative        206   2e-58    
sp|P18240.1|G6PI_PLAFA  RecName: Full=Glucose-6-phosphate isomera...    207   2e-58    
ref|XP_002778568.1|  glucose-6-phosphate isomerase, putative            207   2e-58    
ref|XP_680147.1|  glucose-6-phosphate isomerase                         204   5e-58    
emb|CDU21159.1|  glucose-6-phosphate isomerase, putative                205   1e-57    
ref|WP_039655377.1|  glucose-6-phosphate isomerase                      194   1e-57    
gb|AIY55238.1|  cytosolic phosphoglucose isomerase C1                   194   2e-57    
gb|AEM65961.1|  glucose-6-phosphate isomerase                           191   2e-57    
ref|XP_001609553.1|  glucose-6-phosphate isomerase protein              203   2e-57    
gb|AEM65962.1|  glucose-6-phosphate isomerase                           190   5e-57    
dbj|BAN64298.1|  glucose-6-phosphate isomerase protein                  202   5e-57    
dbj|BAN64528.1|  glucose-6-phosphate isomerase protein                  202   6e-57    
dbj|BAA23175.1|  phosphoglucose isomerase                               199   6e-57    
emb|CAC82580.1|  cytosolic phosphoclucose isomerase                     200   9e-57    
ref|WP_043432851.1|  glucose-6-phosphate isomerase                      193   5e-56    
ref|WP_043408725.1|  glucose-6-phosphate isomerase                      194   6e-56    
ref|XP_008816941.1|  glucose-6-phosphate isomerase                      200   7e-56    
ref|XP_001616614.1|  glucose-6-phosphate isomerase                      200   9e-56    
ref|WP_030852741.1|  glucose-6-phosphate isomerase                      192   1e-55    
ref|XP_004224301.1|  glucose-6-phosphate isomerase                      200   1e-55    
ref|WP_030792318.1|  glucose-6-phosphate isomerase                      196   1e-55    
ref|WP_037776166.1|  glucose-6-phosphate isomerase                      189   2e-55    
gb|KJP88991.1|  glucose-6-phosphate isomerase                           197   6e-55    
ref|WP_034269526.1|  glucose-6-phosphate isomerase                      196   8e-55    
ref|WP_037757031.1|  glucose-6-phosphate isomerase                      196   8e-55    
gb|EFK99103.1|  LOW QUALITY PROTEIN: glucose-6-phosphate isomerase      192   1e-54    
ref|WP_030378789.1|  MULTISPECIES: glucose-6-phosphate isomerase        196   2e-54    
ref|WP_007492394.1|  glucose-6-phosphate isomerase                      196   2e-54    
ref|XP_004030610.1|  hypothetical protein IMG5_157010                   193   2e-54    
ref|WP_003989460.1|  glucose-6-phosphate isomerase                      195   2e-54    
ref|WP_006373291.1|  glucose-6-phosphate isomerase                      195   2e-54    
ref|WP_030933688.1|  glucose-6-phosphate isomerase                      195   2e-54    
ref|WP_020939320.1|  glucose-6-phosphate isomerase                      195   3e-54    
ref|WP_023551600.1|  glucose-6-phosphate isomerase                      195   3e-54    
ref|WP_015661254.1|  Glucose-6-phosphate isomerase 2                    195   3e-54    
ref|WP_037691540.1|  glucose-6-phosphate isomerase                      195   3e-54    
ref|WP_020131909.1|  glucose-6-phosphate isomerase                      195   4e-54    
ref|WP_022867575.1|  glucose-6-phosphate isomerase                      195   4e-54    
ref|WP_030767805.1|  glucose-6-phosphate isomerase                      194   5e-54    
ref|WP_043256418.1|  glucose-6-phosphate isomerase                      194   5e-54    
ref|WP_020943297.1|  glucose-6-phosphate isomerase                      194   5e-54    
ref|WP_039658405.1|  glucose-6-phosphate isomerase                      185   5e-54    
ref|WP_007445662.1|  glucose-6-phosphate isomerase                      189   5e-54    
ref|WP_028803433.1|  glucose-6-phosphate isomerase                      191   6e-54    
gb|EGJ78231.1|  putative glucose-6-phosphate isomerase                  194   6e-54    
ref|WP_006134380.1|  glucose-6-phosphate isomerase                      185   6e-54    
ref|WP_011597733.1|  MULTISPECIES: Glucose-6-phosphate isomerase 1      194   7e-54    
ref|WP_030996660.1|  glucose-6-phosphate isomerase                      194   9e-54    
ref|WP_036516302.1|  glucose-6-phosphate isomerase                      193   1e-53    
ref|WP_007301155.1|  Glucose-6-phosphate isomerase 1                    193   1e-53    
ref|WP_030979197.1|  glucose-6-phosphate isomerase                      186   1e-53    
ref|WP_018470529.1|  glucose-6-phosphate isomerase                      193   1e-53    
gb|EKX68300.1|  glucose-6-phosphate isomerase                           193   1e-53    
ref|WP_037770364.1|  glucose-6-phosphate isomerase                      186   2e-53    
ref|WP_037243667.1|  glucose-6-phosphate isomerase                      193   2e-53    
ref|WP_045560944.1|  glucose-6-phosphate isomerase                      193   2e-53    
ref|WP_015508056.1|  Glucose-6-phosphate isomerase                      193   2e-53    
gb|EKC95971.1|  glucose-6-phosphate isomerase                           193   2e-53    
ref|WP_003795496.1|  glucose-6-phosphate isomerase                      193   2e-53    
gb|AEF42026.1|  Glucose-6-phosphate isomerase                           193   2e-53    
ref|WP_030308406.1|  glucose-6-phosphate isomerase                      193   2e-53    
ref|WP_010637070.1|  glucose-6-phosphate isomerase                      193   2e-53    
ref|WP_037844885.1|  glucose-6-phosphate isomerase                      193   2e-53    
ref|WP_031177547.1|  MULTISPECIES: glucose-6-phosphate isomerase        193   2e-53    
ref|WP_018895208.1|  glucose-6-phosphate isomerase                      193   2e-53    
ref|WP_041452132.1|  glucose-6-phosphate isomerase                      192   2e-53    
ref|WP_045864276.1|  glucose-6-phosphate isomerase                      192   2e-53    
ref|WP_005238524.1|  glucose-6-phosphate isomerase                      192   2e-53    
ref|WP_030619207.1|  glucose-6-phosphate isomerase                      192   2e-53    
gb|AII05490.1|  glucose-6-phosphate isomerase                           192   2e-53    
ref|WP_010987702.1|  Glucose-6-phosphate isomerase 2                    192   2e-53    
ref|WP_010261375.1|  MULTISPECIES: glucose-6-phosphate isomerase        192   3e-53    
ref|WP_031065265.1|  glucose-6-phosphate isomerase                      192   3e-53    
ref|WP_006373518.1|  glucose-6-phosphate isomerase                      192   3e-53    
ref|WP_030049108.1|  glucose-6-phosphate isomerase                      191   3e-53    
ref|XP_002260652.1|  glucose-6-phosphate isomerase                      193   3e-53    
ref|WP_030695122.1|  glucose-6-phosphate isomerase                      192   3e-53    
ref|WP_031477415.1|  glucose-6-phosphate isomerase                      192   3e-53    
ref|WP_031520994.1|  glucose-6-phosphate isomerase                      192   4e-53    
ref|WP_036193711.1|  glucose-6-phosphate isomerase                      192   4e-53    
ref|WP_034509388.1|  glucose-6-phosphate isomerase                      192   4e-53    
ref|WP_030388923.1|  glucose-6-phosphate isomerase                      192   5e-53    
ref|WP_042539871.1|  glucose-6-phosphate isomerase                      187   5e-53    
ref|WP_014672004.1|  glucose-6-phosphate isomerase                      191   6e-53    
ref|WP_029289585.1|  glucose-6-phosphate isomerase                      191   6e-53    
ref|WP_006422740.1|  glucose-6-phosphate isomerase                      191   6e-53    
ref|WP_030358808.1|  MULTISPECIES: glucose-6-phosphate isomerase        191   6e-53    
ref|WP_043410958.1|  glucose-6-phosphate isomerase                      186   7e-53    
ref|WP_031007114.1|  glucose-6-phosphate isomerase                      191   7e-53    
ref|WP_023419986.1|  MULTISPECIES: glucose-6-phosphate isomerase        191   7e-53    
ref|WP_033526617.1|  glucose-6-phosphate isomerase                      191   9e-53    
ref|WP_030564715.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_033172318.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_023542515.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_004002140.1|  putative Glucose-6-phosphate isomerase             191   1e-52    
ref|WP_030670385.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_010849237.1|  glucosephosphate isomerase (Glucose-6-phosph...    191   1e-52    
ref|WP_018545751.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_015896196.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_030707018.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_037668566.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_044380855.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_030224633.1|  glucose-6-phosphate isomerase                      191   1e-52    
ref|WP_031046987.1|  glucose-6-phosphate isomerase                      187   2e-52    
ref|WP_020137613.1|  glucose-6-phosphate isomerase                      190   2e-52    



>ref|XP_009775388.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Nicotiana sylvestris]
Length=576

 Score =   392 bits (1008),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLK EVVSNH
Sbjct  376  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKDEVVSNH  435

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV +HLVSHKTFSGNRPSLSILLPSLNAYNIGQL
Sbjct  436  DELMSNFFAQPDALAYGKTPEQLQKENVAEHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  495

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLA+QVRKQL+ASRKKGES+EGFNFSTKTL+
Sbjct  496  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRKQLHASRKKGESVEGFNFSTKTLI  555

Query  270  SKYLEASSDIPADPPTALPKI  208
            + YLEAS+D+P+DP T LPKI
Sbjct  556  TTYLEASADVPSDPSTLLPKI  576



>ref|XP_009775389.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Nicotiana sylvestris]
 ref|XP_009775390.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Nicotiana sylvestris]
Length=568

 Score =   392 bits (1007),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLK EVVSNH
Sbjct  368  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKDEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV +HLVSHKTFSGNRPSLSILLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQKENVAEHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLA+QVRKQL+ASRKKGES+EGFNFSTKTL+
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRKQLHASRKKGESVEGFNFSTKTLI  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            + YLEAS+D+P+DP T LPKI
Sbjct  548  TTYLEASADVPSDPSTLLPKI  568



>gb|AII20189.1| glucose-6-phosphate isomerase [Nicotiana tabacum]
Length=568

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLK EVVSNH
Sbjct  368  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKDEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV +HLVSHKTFSGNRPSLSILLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQKENVAEHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLA+QVR+QL+ASRKKGES+EGFNFSTKTL+
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRRQLHASRKKGESVEGFNFSTKTLI  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            + YLEAS+D+P+DP T LPKI
Sbjct  548  TTYLEASADVPSDPSTLLPKI  568



>ref|NP_001275223.1| glucose-6-phosphate isomerase [Solanum tuberosum]
 gb|AAU00726.1| glucose-6-phosphate isomerase [Solanum tuberosum]
Length=568

 Score =   387 bits (995),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPY+TGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQP+YLK EVV+NH
Sbjct  368  IDGVPLPYQTGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPIYLKDEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKEN+P+HLVSHKTFSGNRP LSILLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQKENIPEHLVSHKTFSGNRPXLSILLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+W INSFDQWGVELGKSLATQVRKQL+ASRKKGES+EGFNFSTKTL+
Sbjct  488  LAIYEHRVAVQGFVWCINSFDQWGVELGKSLATQVRKQLHASRKKGESVEGFNFSTKTLI  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEAS+D+P+DP T LP I
Sbjct  548  TRYLEASADVPSDPSTLLPNI  568



>ref|XP_009598843.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nicotiana 
tomentosiformis]
 ref|XP_009598848.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nicotiana 
tomentosiformis]
Length=568

 Score =   387 bits (993),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQP+YLK EVVSNH
Sbjct  368  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPLYLKDEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV ++LVSHKTFSGNRPSLSILLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLRKENVAEYLVSHKTFSGNRPSLSILLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLA+QVRKQL+ASRKKGES+EGFNFSTKTL+
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRKQLHASRKKGESVEGFNFSTKTLI  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            + YLEAS+D+P+DP T LPKI
Sbjct  548  TTYLEASADVPSDPSTLLPKI  568



>ref|XP_004152701.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
sativus]
 ref|XP_011649618.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
sativus]
 gb|KGN62593.1| hypothetical protein Csa_2G361580 [Cucumis sativus]
Length=566

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  366  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  425

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENVP+HL+SHKTFSGNRPSLSILLPSLNAYNIGQL
Sbjct  426  DELMSNFFAQPDALAYGKTPEQLHKENVPEHLISHKTFSGNRPSLSILLPSLNAYNIGQL  485

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE IEGFN ST TLL
Sbjct  486  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLSASRTKGEPIEGFNHSTTTLL  545

Query  270  SKYLEASSDIPADPPTALPKI  208
             +YLEASSD+P+D PT LP+I
Sbjct  546  KRYLEASSDVPSDLPTLLPRI  566



>ref|XP_003618419.1| Glucose-6-phosphate isomerase [Medicago truncatula]
 gb|AES74637.1| glucose-6-phosphate isomerase [Medicago truncatula]
Length=568

 Score =   382 bits (980),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ ENV  HLVSHKTF+GNRPS+S+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQNENVAPHLVSHKTFTGNRPSVSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLNASR KGE I+GFNFST T++
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPIQGFNFSTTTMI  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+AS+D+PADPPT LP+I
Sbjct  548  TRYLQASADVPADPPTTLPQI  568



>ref|XP_011083695.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Sesamum 
indicum]
 ref|XP_011083696.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Sesamum 
indicum]
Length=568

 Score =   381 bits (979),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  368  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGELVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KEN+P+HL++HKTFSGNRPSLSILLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLLKENIPEHLITHKTFSGNRPSLSILLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAV+GF+WGINSFDQWGVELGKSLATQVRKQL+ASRKKGE++EGFNFST T+L
Sbjct  488  LAIYEHRVAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRKKGEAVEGFNFSTTTVL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
             +YLEAS+D+P +  T LPK+
Sbjct  548  KRYLEASADVPKEDCTILPKM  568



>ref|XP_007221807.1| hypothetical protein PRUPE_ppa003512mg [Prunus persica]
 gb|EMJ23006.1| hypothetical protein PRUPE_ppa003512mg [Prunus persica]
 gb|AGH25539.1| phosphoglucose isomerase [Prunus persica]
Length=568

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            I+GV LP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IEGVILPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+LQKENVP+HL+ HKTFSGNRPSLSIL PSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKHPEQLQKENVPEHLIPHKTFSGNRPSLSILFPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQLNASR KG+ IEGFN+ST TLL
Sbjct  488  LAIYEHRVAVQGFLWGINSFDQWGVELGKSLATQVRKQLNASRTKGQPIEGFNYSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
             KYLEASSDIPAD PT LP+I
Sbjct  548  KKYLEASSDIPADLPTLLPRI  568



>emb|CAD79590.1| cytosolic phosphoglucose isomerase, partial [Lopezia grandiflora]
Length=230

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYL+GEVV+NH
Sbjct  30   IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMKSQQPVYLRGEVVNNH  89

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HK F+GNRPSLSILLP+L+AY IGQL
Sbjct  90   DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKIFTGNRPSLSILLPTLDAYRIGQL  149

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQL+ASR  GE++EGFNFSTKTLL
Sbjct  150  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVNGEAVEGFNFSTKTLL  209

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+ +SD+PADP T LPKI
Sbjct  210  TRYLKETSDVPADPSTLLPKI  230



>sp|P54243.1|G6PI_OENME RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Oenothera sinuata 
var. hirsuta]
 emb|CAA61577.1| glucose-6-phosphate isomerase [Oenothera sinuata var. hirsuta]
Length=568

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPS+SILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSVSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQL+ASR KGES+EGFNFSTKTLL
Sbjct  488  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGESVEGFNFSTKTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+PA P T LPKI
Sbjct  548  TRYLEATSDVPAAPSTLLPKI  568



>emb|CAB55566.1| cytosolic phosphoglucose isomerase [Clarkia gracilis]
Length=568

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFNFSTKTLL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNFSTKTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+PADP T LP I
Sbjct  548  TRYLEATSDVPADPSTLLPNI  568



>sp|P54236.1|G6PI1_CLAFR RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia franciscana]
 emb|CAA61576.1| glucose-6-phosphate isomerase [Clarkia franciscana]
Length=568

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFNFSTKTLL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNFSTKTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+PADP T LP I
Sbjct  548  TRYLEATSDVPADPSTLLPNI  568



>ref|XP_002510371.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF52558.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
Length=568

 Score =   374 bits (961),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYL+GEVV+NH
Sbjct  368  MDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLEGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENVPQHL+ HKTFSGNRPS+SILL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTAEQLQKENVPQHLIPHKTFSGNRPSVSILLSSLDAYKIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQLNASR KGE +EGFNFST T+L
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPVEGFNFSTTTML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLE +S++PA P T LP+I
Sbjct  548  TRYLEETSEVPAKPQTLLPRI  568



>gb|AFK39110.1| unknown [Medicago truncatula]
Length=568

 Score =   374 bits (961),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEP TNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPETNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ ENV  HLVSHKTF+GNRPS+S+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQNENVAPHLVSHKTFTGNRPSVSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLNA R KGE I+GFNFS  T++
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNAFRTKGEPIQGFNFSATTMI  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+AS+D+PADPPT LP+I
Sbjct  548  TRYLQASADVPADPPTTLPQI  568



>sp|P54241.1|G6PI2_CLACO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia concinna]
 emb|CAA61571.1| glucose-6-phosphate isomerase [Clarkia concinna subsp. automixa]
Length=569

 Score =   374 bits (960),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 194/202 (96%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  VDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFNGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LA+YEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE++ EGFNFSTKTL
Sbjct  488  LAVYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEAVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YLEASSD+PADP T LPKI
Sbjct  548  LTRYLEASSDVPADPSTLLPKI  569



>emb|CAC85683.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=526

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  326  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  385

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPS+SILLP+L+AY IGQL
Sbjct  386  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSISILLPTLDAYRIGQL  445

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFNFSTKTLL
Sbjct  446  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNFSTKTLL  505

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+P DP T LP I
Sbjct  506  TRYLEATSDVPTDPSTLLPNI  526



>emb|CAC85684.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=526

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  326  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  385

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPS+SILLP+L+AY IGQL
Sbjct  386  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSISILLPTLDAYRIGQL  445

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFNFSTKTLL
Sbjct  446  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNFSTKTLL  505

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+P DP T LP I
Sbjct  506  TRYLEATSDVPTDPSTLLPNI  526



>gb|EYU45143.1| hypothetical protein MIMGU_mgv1a003701mg [Erythranthe guttata]
Length=568

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENVP HLV+HKTFSG+RPS+S+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLLKENVPHHLVTHKTFSGDRPSVSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAV+GF+WGINSFDQWGVELGKSLATQVRKQLNASRKK E +EGFNFST  LL
Sbjct  488  LAIYEHRVAVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRKKAEPVEGFNFSTTALL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEAS+DI  +  T LPK+
Sbjct  548  TRYLEASTDISKEDCTVLPKM  568



>emb|CAC86122.1| cytosolic phosphoglucose isomerase [Clarkia modesta]
Length=569

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 193/202 (96%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YLEA+SD+PADP T LPKI
Sbjct  548  LTRYLEATSDVPADPSTLLPKI  569



>sp|P54242.1|G6PI2_CLAXA RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia xantiana]
 emb|CAA56694.1| glucose-6-phosphate isomerase [Clarkia xantiana]
 emb|CAA61567.1| glucose-6-phosphate isomerase [Clarkia xantiana subsp. parviflora]
Length=569

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 193/202 (96%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YLEA+SD+PADP T LPKI
Sbjct  548  LTRYLEATSDVPADPSTLLPKI  569



>sp|P54237.1|G6PI1_CLAMI RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia mildrediae]
 emb|CAA61569.1| glucose-6-phosphate isomerase [Clarkia mildrediae]
Length=568

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKNENVAEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ SR KGE +EGFNFSTKTLL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVKGEPVEGFNFSTKTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEA+SD+PADP T LP I
Sbjct  548  TKYLEATSDVPADPSTLLPNI  568



>emb|CAB55567.1| cytosolic phosphoglucose isomerase [Clarkia gracilis]
Length=569

 Score =   372 bits (956),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 193/202 (96%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HK F+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLILHKIFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE++ EGFNFSTKTL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEAVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YLEA+SD+PADP T LPKI
Sbjct  548  LTRYLEATSDVPADPSTLLPKI  569



>sp|P54234.1|G6PI1_CLAAR RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia arcuata]
 emb|CAA61575.1| glucose-6-phosphate isomerase [Clarkia arcuata]
Length=568

 Score =   372 bits (955),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPS+SILLP+L+ Y IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSISILLPTLDGYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFNFSTKTLL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNFSTKTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
             +YLEA+SD+PADP T LP I
Sbjct  548  ERYLEATSDVPADPSTLLPNI  568



>sp|P54240.1|G6PI1_CLAXA RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia xantiana]
 emb|CAA56693.1| glucose-6-phosphate isomerase [Clarkia xantiana]
 emb|CAA61566.1| glucose-6-phosphate isomerase [Clarkia xantiana subsp. parviflora]
Length=568

 Score =   372 bits (955),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV +HL+ HKTF+GNRPS+SILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKNENVSEHLIPHKTFTGNRPSISILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFNFSTKTLL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNFSTKTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+PADP T LP I
Sbjct  548  TRYLEATSDVPADPSTLLPNI  568



>sp|P54239.1|G6PI1_CLAWI RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia williamsonii]
 emb|CAA61574.1| glucose-6-phosphate isomerase [Clarkia williamsonii]
Length=568

 Score =   372 bits (954),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPS+S+LLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSISLLLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ SR KGE +EGFNFSTKTLL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVKGEPVEGFNFSTKTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+PADP T LP I
Sbjct  548  TRYLEATSDVPADPSTLLPNI  568



>sp|P34797.1|G6PI3_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2B; Short=GPI; 
AltName: Full=PGI3; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI, 
partial [Clarkia lewisii]
 emb|CAA50403.1| cytosolic phosphoglucose isomerase [Clarkia lewisii]
Length=317

 Score =   362 bits (930),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 191/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  116  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  175

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT  +L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  176  DELMSNFFAQPDALAYGKTPAQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  235

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  236  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  295

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A++D+PADP T LP I
Sbjct  296  LTRYLQATTDVPADPSTLLPNI  317



>sp|P54235.1|G6PI1_CLACO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia concinna]
 emb|CAA61570.1| glucose-6-phosphate isomerase [Clarkia concinna subsp. automixa]
Length=569

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 192/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YLEA+SD+PADP T LP I
Sbjct  548  LTRYLEATSDVPADPSTLLPNI  569



>emb|CAC84508.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
 emb|CAC85681.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85682.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=527

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 192/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  326  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  385

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT EEL+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  386  DELMSNFFAQPDALAYGKTPEELKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  445

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  446  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  505

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A+SD+PADP T LP I
Sbjct  506  LTRYLQATSDVPADPSTLLPNI  527



>emb|CAC82578.1| cytosolic phosphoclucose isomerase [Clarkia epilobioides]
Length=569

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 192/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT EEL+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEELKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A+SD+PADP T LP I
Sbjct  548  LTRYLQATSDVPADPSTLLPNI  569



>emb|CAC84514.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=527

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 192/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  326  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  385

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  386  DELMSNFFAQPDALAYGKTPEQLRKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  445

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR  GE + EGFNFSTKTL
Sbjct  446  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVNGEPVEEGFNFSTKTL  505

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A+SD+PADP T LPKI
Sbjct  506  LTRYLKATSDVPADPSTLLPKI  527



>gb|EPS71211.1| glucose-6-phosphate isomerase [Genlisea aurea]
Length=569

 Score =   369 bits (948),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 187/201 (93%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENVP HL++HKTFSGNRPSLSILLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTAEQLRNENVPDHLITHKTFSGNRPSLSILLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLATQVRKQL+ASRKKGE+I GFNFST  LL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRKKGEAIRGFNFSTTKLL  547

Query  270  SKYLEASSDIP-ADPPTALPK  211
             KYL+ASS+ P  +  T LPK
Sbjct  548  EKYLQASSEDPHTEEITVLPK  568



>emb|CAC85685.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=516

 Score =   367 bits (943),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 191/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  315  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  374

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  375  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  434

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            L IYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  435  LGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  494

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A+SD+PADP T LP I
Sbjct  495  LTRYLQATSDVPADPSTLLPNI  516



>ref|XP_012071828.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Jatropha 
curcas]
 gb|KDP38492.1| hypothetical protein JCGZ_04417 [Jatropha curcas]
Length=568

 Score =   369 bits (947),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGR+IPCDFIGVVKSQQPVYL+GEVV+NH
Sbjct  368  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRIIPCDFIGVVKSQQPVYLEGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENVPQ+L+ HKTFSGNRPSLSILL +L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTAEQLQKENVPQNLIPHKTFSGNRPSLSILLSALDAYKIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRV VQGFIWGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFNFST +LL
Sbjct  488  LAIYEHRVVVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRTKGEPVEGFNFSTTSLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
             +YLE SSD+P +P T LP+I
Sbjct  548  KRYLEESSDVPKNPQTLLPRI  568



>gb|EYU45142.1| hypothetical protein MIMGU_mgv1a003701mg [Erythranthe guttata]
Length=569

 Score =   369 bits (947),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 188/202 (93%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQ-  454
            DELMSNFFAQPDALAYGKT E+L KENVP HLV+HKTFSG+RPS+S+LLPSLNAYNIGQ 
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLLKENVPHHLVTHKTFSGDRPSVSLLLPSLNAYNIGQV  487

Query  453  LLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTL  274
            LLAIYEHRVAV+GF+WGINSFDQWGVELGKSLATQVRKQLNASRKK E +EGFNFST  L
Sbjct  488  LLAIYEHRVAVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRKKAEPVEGFNFSTTAL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YLEAS+DI  +  T LPK+
Sbjct  548  LTRYLEASTDISKEDCTVLPKM  569



>sp|P29333.1|G6PI2_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2A; Short=GPI; 
AltName: Full=PGI3; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI 
[Clarkia lewisii]
 emb|CAA45616.1| glucose-6-phosphate isomerase [Clarkia lewisii]
 emb|CAA61565.1| glucose-6-phosphate isomerase [Clarkia lewisii]
Length=569

 Score =   369 bits (946),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 191/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT EEL+KENV +HL+ HKTF+GNRP LSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEELKKENVSEHLIPHKTFTGNRPCLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A++D+PADP T LP I
Sbjct  548  LTRYLQATTDVPADPSTLLPNI  569



>emb|CAC85686.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=527

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 191/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  326  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  385

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  386  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  445

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            L IYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  446  LGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  505

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A+SD+PADP T LP I
Sbjct  506  LTRYLQATSDVPADPSTLLPNI  527



>emb|CAC82579.1| cytosolic phosphoclucose isomerase [Clarkia epilobioides]
Length=569

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 191/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            L IYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EGFNFSTKTL
Sbjct  488  LGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A+SD+PADP T LP I
Sbjct  548  LTRYLQATSDVPADPSTLLPNI  569



>sp|P34796.1|G6PI1_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1A; Short=GPI; 
AltName: Full=PGI2; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI 
[Clarkia lewisii]
 emb|CAA50402.1| cytosolic phosphoglucose isomerase [Clarkia lewisii]
 emb|CAA61564.1| glucose-6-phosphate isomerase [Clarkia lewisii]
Length=569

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 191/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT EEL+KENV +HL+ HKTF+GNRPS+SILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEELKKENVSEHLIPHKTFTGNRPSISILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ SR KGE + EGFNFSTKTL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVKGEPVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A+SD+PADP T LP I
Sbjct  548  LTRYLQATSDVPADPSTLLPNI  569



>ref|XP_004489355.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489356.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004489357.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X3 [Cicer arietinum]
Length=568

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENVP HLV HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQKENVPPHLVPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLATQVRKQLNASR KGE I+GFNFST T+L
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPIQGFNFSTTTML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEAS+DIPADPPT LP+I
Sbjct  548  TRYLEASADIPADPPTTLPQI  568



>emb|CAC84511.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=526

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGEVV+NH
Sbjct  326  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMKSQQPVYLKGEVVNNH  385

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPS+SILLP+L+AY IGQL
Sbjct  386  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSISILLPTLDAYRIGQL  445

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ SR K + +EGFNFSTKTLL
Sbjct  446  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVKAKPVEGFNFSTKTLL  505

Query  270  SKYLEASSDIPADPPTALPKI  208
             +YLEA+SD+PADP T LP I
Sbjct  506  IRYLEATSDVPADPSTLLPNI  526



>sp|P54238.1|G6PI1_CLARO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia rostrata]
 emb|CAA61572.1| glucose-6-phosphate isomerase [Clarkia rostrata]
Length=570

 Score =   367 bits (941),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 191/202 (95%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  VDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT EEL+KENV +HL+ HKTF+GNRPS+SILLP+L+AY IGQ+
Sbjct  428  DELMSNFFAQPDALAYGKTPEELKKENVSEHLIPHKTFTGNRPSISILLPTLDAYRIGQV  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTL  274
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ SR KGE + EGFNFSTKTL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVKGEPVEEGFNFSTKTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+A+SD+PADP T LP I
Sbjct  548  LTRYLQATSDVPADPSTLLPNI  569



>emb|CDP07527.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   352 bits (904),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYL+GEVVSNH
Sbjct  10   IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLEGEVVSNH  69

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENVPQHLV HKTF GNRPS+S+LLPSL+AYNIGQL
Sbjct  70   DELMSNFFAQPDALAYGKTAEQLLKENVPQHLVPHKTFCGNRPSISLLLPSLSAYNIGQL  129

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQL+ SR+KGE IEGFNFST T+L
Sbjct  130  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHVSRRKGEPIEGFNFSTTTVL  189

Query  270  SKYLEASSDIPADPPTALPKI  208
            S+YL+AS+D+P+DP T LPK+
Sbjct  190  SRYLQASADVPSDPSTLLPKM  210



>ref|XP_007017512.1| Sugar isomerase (SIS) family protein isoform 3 [Theobroma cacao]
 gb|EOY14737.1| Sugar isomerase (SIS) family protein isoform 3 [Theobroma cacao]
Length=537

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGE+VSNH
Sbjct  337  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGELVSNH  396

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENVPQHL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  397  DELMSNFFAQPDALAYGKTSEQLLKENVPQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  456

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA YEHR+AV+GF+WGINSFDQWGVELGKSLATQVRKQL+ASR KG+ +EGFNFST TLL
Sbjct  457  LASYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRTKGDPVEGFNFSTTTLL  516

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEASSDIPADPPT LP+I
Sbjct  517  TRYLEASSDIPADPPTLLPRI  537



>ref|NP_001265881.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
 gb|ABE03628.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
Length=568

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPY+TGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQP+YLK EVV+NH
Sbjct  368  IDGVPLPYQTGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPIYLKDEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKEN+P+HLVSHKTFSGNRPSLSILLPSL+AYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQKENIPEHLVSHKTFSGNRPSLSILLPSLSAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASRKKGES+EGFNFSTK L+
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRKKGESVEGFNFSTKMLI  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEAS+D+P+DP T LP I
Sbjct  548  TRYLEASADVPSDPSTLLPNI  568



>ref|XP_010677508.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=568

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+ KSQQPVYLKGEVVSNH
Sbjct  368  IDGVVLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIAKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKTQEELQKENV   LV HKTFSGNRPS+S+LLPSL AYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKTQEELQKENVSPDLVPHKTFSGNRPSISLLLPSLTAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLA+QVRKQL+ASR  GE+I+GFNFST T+L
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLHASRSNGEAIQGFNFSTTTVL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYL+ SSD+PA+ PT LP++
Sbjct  548  TKYLQGSSDVPAELPTKLPQV  568



>ref|XP_006837344.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Amborella 
trichopoda]
 ref|XP_011621181.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Amborella 
trichopoda]
 ref|XP_011621182.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Amborella 
trichopoda]
 ref|XP_011621184.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Amborella 
trichopoda]
 ref|XP_011621185.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Amborella 
trichopoda]
 gb|ERN00198.1| hypothetical protein AMTR_s00111p00094320 [Amborella trichopoda]
Length=568

 Score =   364 bits (934),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP HL+ HKTFSGNRPS+ +LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLLSEKVPDHLIRHKTFSGNRPSICLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAV+GF WGINSFDQWGVELGKSLA+QVRKQLN SR KGE +EGFN+ST T+L
Sbjct  488  LAIYEHRVAVEGFTWGINSFDQWGVELGKSLASQVRKQLNLSRTKGEPVEGFNYSTTTML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEA S IP++P T LPK+
Sbjct  548  TKYLEAKSPIPSEPCTILPKV  568



>ref|XP_007017511.1| Sugar isomerase (SIS) family protein isoform 2 [Theobroma cacao]
 gb|EOY14736.1| Sugar isomerase (SIS) family protein isoform 2 [Theobroma cacao]
Length=568

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGE+VSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGELVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENVPQHL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTSEQLLKENVPQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA YEHR+AV+GF+WGINSFDQWGVELGKSLATQVRKQL+ASR KG+ +EGFNFST TLL
Sbjct  488  LASYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRTKGDPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEASSDIPADPPT LP+I
Sbjct  548  TRYLEASSDIPADPPTLLPRI  568



>ref|XP_008220896.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic, partial 
[Prunus mume]
Length=556

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            I+GV LP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IEGVILPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+LQKENVP+HL+ HKTFSGNRPSLSIL PSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKHPEQLQKENVPKHLIPHKTFSGNRPSLSILFPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQLNASR KG+ IEGFN+ST TLL
Sbjct  488  LAIYEHRVAVQGFLWGINSFDQWGVELGKSLATQVRKQLNASRTKGQPIEGFNYSTTTLL  547

Query  270  SKYLEASSD  244
             KYLEASSD
Sbjct  548  KKYLEASSD  556



>emb|CAB55568.1| cytosolic phosphoglucose isomerase, partial [Clarkia gracilis]
Length=256

 Score =   348 bits (894),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGEVV+NH
Sbjct  72   IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMKSQQPVYLKGEVVNNH  131

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  132  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  191

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE++EGFNFSTKTLL
Sbjct  192  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGETVEGFNFSTKTLL  251

Query  270  SKYLE  256
            ++YLE
Sbjct  252  TRYLE  256



>gb|KJB14509.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
 gb|KJB14510.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
 gb|KJB14512.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=568

 Score =   358 bits (920),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENV QHL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTAEQLLKENVSQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA YEHRV V+GF+WGINSFDQWGVELGKSLATQVRKQLNASR K E +EGFNFST TLL
Sbjct  488  LASYEHRVTVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKSEPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+ASSDIPA+PPT LP+I
Sbjct  548  TRYLQASSDIPAEPPTLLPRI  568



>ref|XP_010106007.1| Glucose-6-phosphate isomerase, cytosolic 1 [Morus notabilis]
 gb|EXC07277.1| Glucose-6-phosphate isomerase, cytosolic 1 [Morus notabilis]
Length=547

 Score =   358 bits (918),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 193/209 (92%), Gaps = 8/209 (4%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKG------  649
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKG      
Sbjct  339  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGLILASK  398

Query  648  --EVVSNHDELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSL  475
              EVVSNHDELMSNFFAQPDALAYGKT E+LQKENVPQHL+ HKTFSGNRPSLS+LLPSL
Sbjct  399  TSEVVSNHDELMSNFFAQPDALAYGKTIEQLQKENVPQHLIPHKTFSGNRPSLSLLLPSL  458

Query  474  NAYNIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGF  295
            NAYNIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQL+ASR KGE ++GF
Sbjct  459  NAYNIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRTKGEPVQGF  518

Query  294  NFSTKTLLSKYLEASSDIPADPPTALPKI  208
            N ST TLL++YLEASSD+P+D PT LP+I
Sbjct  519  NCSTTTLLTRYLEASSDVPSDLPTLLPRI  547



>ref|XP_008444704.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
 ref|XP_008444705.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
 ref|XP_008444706.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
Length=566

 Score =   358 bits (920),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  366  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  425

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENVP+HL+SHKTFSGNRPSLSILLPSL+AYNIGQL
Sbjct  426  DELMSNFFAQPDALAYGKTPEQLHKENVPEHLISHKTFSGNRPSLSILLPSLSAYNIGQL  485

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLATQVRKQLNASR KG+ IEGFN ST TLL
Sbjct  486  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKGQPIEGFNHSTTTLL  545

Query  270  SKYLEASSDIPADPPTALPKI  208
             +YLEASSD+P+D PT LP+I
Sbjct  546  KRYLEASSDVPSDLPTLLPRI  566



>ref|XP_010313627.1| PREDICTED: glucose-6-phosphate isomerase isoform X1 [Solanum 
lycopersicum]
Length=574

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 195/207 (94%), Gaps = 6/207 (3%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPY+TGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQP+YLK EVV+NH
Sbjct  368  IDGVPLPYQTGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPIYLKDEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQ------EELQKENVPQHLVSHKTFSGNRPSLSILLPSLNA  469
            DELMSNFFAQPDALAYGK Q      E+LQKEN+P+HLVSHKTFSGNRPSLSILLPSL+A
Sbjct  428  DELMSNFFAQPDALAYGKYQLSSQTPEQLQKENIPEHLVSHKTFSGNRPSLSILLPSLSA  487

Query  468  YNIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNF  289
            YNIGQLLAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASRKKGES+EGFNF
Sbjct  488  YNIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRKKGESVEGFNF  547

Query  288  STKTLLSKYLEASSDIPADPPTALPKI  208
            STK L+++YLEAS+D+P+DP T LP I
Sbjct  548  STKMLITRYLEASADVPSDPSTLLPNI  574



>ref|XP_007017510.1| Sugar isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY14735.1| Sugar isomerase family protein isoform 1 [Theobroma cacao]
Length=714

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGE+VSNH
Sbjct  514  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGELVSNH  573

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENVPQHL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  574  DELMSNFFAQPDALAYGKTSEQLLKENVPQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  633

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA YEHR+AV+GF+WGINSFDQWGVELGKSLATQVRKQL+ASR KG+ +EGFNFST TLL
Sbjct  634  LASYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRTKGDPVEGFNFSTTTLL  693

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEASSDIPADPPT LP+I
Sbjct  694  TRYLEASSDIPADPPTLLPRI  714



>ref|XP_007136588.1| hypothetical protein PHAVU_009G057500g [Phaseolus vulgaris]
 gb|ESW08582.1| hypothetical protein PHAVU_009G057500g [Phaseolus vulgaris]
Length=568

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPV+LKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVFLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT ++LQKENV  HL+ HKTFSGNRPSLS+LLPSL AYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTADQLQKENVSPHLIPHKTFSGNRPSLSLLLPSLKAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLNASR KGE ++GFNFST T+L
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPVQGFNFSTTTML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+ASSDIPAD PTALPKI
Sbjct  548  NRYLQASSDIPADLPTALPKI  568



>gb|KHN34179.1| Glucose-6-phosphate isomerase, cytosolic 1 [Glycine soja]
Length=552

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYL GEVVSNH
Sbjct  352  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLSGEVVSNH  411

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENVP HLV HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  412  DELMSNFFAQPDALAYGKTAEQLQKENVPPHLVPHKTFSGNRPSLSLLLPSLNAYNIGQL  471

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAV+GFIWGINSFDQWGVELGKSLA+QVRKQLNASR KGE ++GFNFST  +L
Sbjct  472  LAIYEHRVAVEGFIWGINSFDQWGVELGKSLASQVRKQLNASRTKGEPVQGFNFSTTAML  531

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+AS+D+PAD PT LP+I
Sbjct  532  TRYLQASADVPADLPTRLPQI  552



>gb|KDO84534.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=441

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  241  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  300

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GKT E+LQKENV  HL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  301  DELMSNFFAQPDALAVGKTPEQLQKENVAPHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  360

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQL+ASR K E IEGFNFST TLL
Sbjct  361  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGFNFSTTTLL  420

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEASSDIP+DP T LP+I
Sbjct  421  TRYLEASSDIPSDPSTLLPRI  441



>gb|KHN45846.1| Glucose-6-phosphate isomerase, cytosolic [Glycine soja]
Length=550

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPV+LKGEVVSNH
Sbjct  350  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVFLKGEVVSNH  409

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSN+FAQ DALAYGKT E+LQKENV  HL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  410  DELMSNYFAQSDALAYGKTAEQLQKENVSPHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  469

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLNASR KGE ++GFNFST T+L
Sbjct  470  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPVQGFNFSTTTML  529

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+ASSD+PAD PT LPKI
Sbjct  530  TRYLQASSDVPADLPTVLPKI  550



>ref|XP_003554193.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Glycine 
max]
Length=568

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYL GEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLSGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENVP HLV HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTAEQLQKENVPPHLVPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAV+GFIWGINSFDQWGVELGKSLA+QVRKQLNASR KGE ++GFNFST  +L
Sbjct  488  LAIYEHRVAVEGFIWGINSFDQWGVELGKSLASQVRKQLNASRTKGEPVQGFNFSTTAML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+AS+D+PAD PT LP+I
Sbjct  548  TRYLQASADVPADLPTRLPQI  568



>ref|XP_006434973.1| hypothetical protein CICLE_v10000722mg [Citrus clementina]
 gb|ESR48213.1| hypothetical protein CICLE_v10000722mg [Citrus clementina]
Length=568

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGMPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GKT E+LQKENV  HL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAVGKTPEQLQKENVAPHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQL+ASR K E IEGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEASSDIP+DPPT LP+I
Sbjct  548  TRYLEASSDIPSDPPTLLPRI  568



>gb|AEH27532.1| putative glucose-6-phosphateisomerase [Amorphophallus konjac]
Length=210

 Score =   344 bits (883),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE VSNH
Sbjct  10   IDGIPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEPVSNH  69

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E V  HL+ HKTFSGNRPSLSILLP+L+AYNIG+L
Sbjct  70   DELMSNFFAQPDALAYGKTPEQLLSEKVSDHLIPHKTFSGNRPSLSILLPALSAYNIGEL  129

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR+AV+GFIWGINSFDQWGVELGKSLA+QVRKQL+ SR  GE ++GFN+ST  LL
Sbjct  130  LAMYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLHLSRTAGEPVKGFNYSTTALL  189

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA + +P+   T LPK+
Sbjct  190  TRYLEAETGLPSGSSTVLPKV  210



>ref|XP_002282774.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Vitis vinifera]
 ref|XP_010664679.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Vitis vinifera]
 emb|CBI19685.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   357 bits (915),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ ENVPQHL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQNENVPQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQLN++R KG+ +EGFN+ST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNSARTKGKPVEGFNYSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
             +YLEASSDIP+DP T LP++
Sbjct  548  KRYLEASSDIPSDPCTLLPQM  568



>ref|XP_002312387.2| hypothetical protein POPTR_0008s11770g [Populus trichocarpa]
 gb|EEE89754.2| hypothetical protein POPTR_0008s11770g [Populus trichocarpa]
Length=568

 Score =   357 bits (915),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYL+GEVV+NH
Sbjct  368  IDGKPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLEGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT EELQKENV QHL+ HKTFSGNRPSLS+LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEELQKENVLQHLIPHKTFSGNRPSLSLLLSSLDAYKIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFNFST T+L
Sbjct  488  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNFSTTTML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYL+ SS++PA+PPT LP+I
Sbjct  548  TKYLKESSEVPANPPTILPRI  568



>ref|XP_006582469.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate isomerase, 
cytosolic 2-like [Glycine max]
Length=462

 Score =   353 bits (906),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPV+LKGEVVSNH
Sbjct  262  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVFLKGEVVSNH  321

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSN+FAQ DALAYGKT E+LQKENV  HL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  322  DELMSNYFAQSDALAYGKTAEQLQKENVSPHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  381

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLNASR KGE I+GFNFST T+L
Sbjct  382  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPIQGFNFSTTTML  441

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+ASSD+PAD  T LPKI
Sbjct  442  TRYLQASSDVPADLSTVLPKI  462



>ref|NP_001242028.1| uncharacterized protein LOC100807719 [Glycine max]
 gb|ACU20878.1| unknown [Glycine max]
Length=568

 Score =   356 bits (914),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPV+LKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVFLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSN+FAQ DALAYGKT E+LQKENV  HL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNYFAQSDALAYGKTAEQLQKENVSPHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLNASR KGE ++GFNFST T+L
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPVQGFNFSTTTML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+ASSD+PAD PT LPKI
Sbjct  548  TRYLQASSDVPADLPTVLPKI  568



>ref|XP_008357232.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Malus 
domestica]
Length=288

 Score =   347 bits (889),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+ETGEIDFGEP TNGQHSFYQLIHQGRVIPC FIGV+KSQQPVYLKGEVVSNH
Sbjct  88   IDGVILPFETGEIDFGEPXTNGQHSFYQLIHQGRVIPCXFIGVMKSQQPVYLKGEVVSNH  147

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L+KENVP+HL++HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  148  DELMSNFFAQPDALAYGKHPEQLKKENVPEHLITHKTFSGNRPSLSLLLPSLNAYNIGQL  207

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQLNASR KG+ IEGFN+ST TLL
Sbjct  208  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGFNYSTTTLL  267

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEA+ DIPAD PT LP+I
Sbjct  268  TKYLEATKDIPADLPTLLPQI  288



>ref|XP_010060937.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Eucalyptus 
grandis]
 ref|XP_010060938.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Eucalyptus 
grandis]
 gb|KCW67834.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
 gb|KCW67835.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
Length=568

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ ENV  HL+ HKTF+GNRPSLS+LLPSL AYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQTENVAHHLIPHKTFTGNRPSLSLLLPSLTAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFN+ST T+L
Sbjct  488  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNYSTATML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+P+DPPT LP+I
Sbjct  548  TRYLEATSDVPSDPPTLLPRI  568



>ref|XP_006473486.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Citrus 
sinensis]
Length=568

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GKT E+LQKENV  HL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAVGKTPEQLQKENVAPHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQL+ASR K E IEGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEASSDIP+DP T LP+I
Sbjct  548  TRYLEASSDIPSDPSTLLPRI  568



>ref|XP_008377333.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Malus domestica]
 ref|XP_008377335.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Malus domestica]
Length=568

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVILPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L+KENVP+HL++HKTF+GNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKHPEQLKKENVPEHLINHKTFTGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQLNASR KG+ IEGFN+ST +LL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGFNYSTTSLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEAS DIPAD PT LP+I
Sbjct  548  TKYLEASKDIPADLPTLLPQI  568



>gb|KHN22258.1| Glucose-6-phosphate isomerase, cytosolic [Glycine soja]
Length=550

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPV+LKGEVVSNH
Sbjct  350  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVFLKGEVVSNH  409

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSN+FAQ DALAYGKT E+LQKENV  HL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  410  DELMSNYFAQSDALAYGKTAEQLQKENVSPHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  469

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLNASR KGE I+GFNFST T+L
Sbjct  470  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPIQGFNFSTTTML  529

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+ASSD+PAD  T LPKI
Sbjct  530  TRYLQASSDVPADLSTVLPKI  550



>ref|XP_009365601.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Pyrus 
x bretschneideri]
 ref|XP_009365602.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Pyrus 
x bretschneideri]
Length=568

 Score =   354 bits (909),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGEVVSNH
Sbjct  368  IDGVILPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L+KENVP+HL++HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKHPEQLKKENVPEHLITHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQLNASR +G+ IEGFN+ST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTEGQPIEGFNYSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEA+ DIPAD PT LP+I
Sbjct  548  TKYLEATKDIPADLPTLLPQI  568



>emb|CAD24788.1| cytosolic phosphoglucose isomerase, partial [Clarkia heterandra]
Length=559

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 184/192 (96%), Gaps = 2/192 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  368  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI--EGFNFSTKT  277
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE +  EGFNFSTKT
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEEGFNFSTKT  547

Query  276  LLSKYLEASSDI  241
            LL++YL+A+SD+
Sbjct  548  LLTRYLQATSDV  559



>gb|KJB14513.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=569

 Score =   354 bits (908),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 189/202 (94%), Gaps = 1/202 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGK-TQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQ  454
            DELMSNFFAQPDALAYGK T E+L KENV QHL+ HKTFSGNRPSLS+LLPSLNAYNIGQ
Sbjct  428  DELMSNFFAQPDALAYGKVTAEQLLKENVSQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQ  487

Query  453  LLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTL  274
            LLA YEHRV V+GF+WGINSFDQWGVELGKSLATQVRKQLNASR K E +EGFNFST TL
Sbjct  488  LLASYEHRVTVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKSEPVEGFNFSTTTL  547

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL+ASSDIPA+PPT LP+I
Sbjct  548  LTRYLQASSDIPAEPPTLLPRI  569



>ref|XP_010263691.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Nelumbo 
nucifera]
 ref|XP_010263692.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Nelumbo 
nucifera]
Length=568

 Score =   354 bits (908),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  368  IDGVQLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGELVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  ENVPQHL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLLNENVPQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLA+QVRKQLNASR KGE +EGFNFST T+L
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLNASRTKGEPVEGFNFSTTTML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEA S +PA+P T LPK+
Sbjct  548  NKYLEAKSRVPANPTTVLPKV  568



>gb|KDO84533.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=606

 Score =   355 bits (910),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  406  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  465

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GKT E+LQKENV  HL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  466  DELMSNFFAQPDALAVGKTPEQLQKENVAPHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  525

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQL+ASR K E IEGFNFST TLL
Sbjct  526  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGFNFSTTTLL  585

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEASSDIP+DP T LP+I
Sbjct  586  TRYLEASSDIPSDPSTLLPRI  606



>ref|XP_008377470.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B [Malus 
domestica]
Length=389

 Score =   347 bits (891),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGEVVSNH
Sbjct  189  IDGVILPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMKSQQPVYLKGEVVSNH  248

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L+KENVP  L++HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  249  DELMSNFFAQPDALAYGKHPEQLKKENVPXPLITHKTFSGNRPSLSLLLPSLNAYNIGQL  308

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQLNASR KG+ IEGFN+ST TLL
Sbjct  309  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGFNYSTTTLL  368

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEA+ DIPAD PT LP+I
Sbjct  369  TKYLEATKDIPADLPTLLPQI  389



>ref|XP_004291883.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Fragaria 
vesca subsp. vesca]
 ref|XP_011459557.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E GEIDFGEPGTNGQHSFYQLIHQGR+IPCDFIG+VKSQQPVYLKGE+VSNH
Sbjct  368  IDGVLLPFEAGEIDFGEPGTNGQHSFYQLIHQGRIIPCDFIGIVKSQQPVYLKGELVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV  HL+ HKTF+GNRPSLS+LLP LNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQKENVAPHLIPHKTFTGNRPSLSLLLPLLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLATQVRKQL+ASR +G+S+EGFNFSTKTL+
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRTEGKSVEGFNFSTKTLM  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEASSDIPA+ PT LP+I
Sbjct  548  TKYLEASSDIPAELPTLLPRI  568



>ref|XP_009364475.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Pyrus x 
bretschneideri]
 ref|XP_009364484.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Pyrus x 
bretschneideri]
Length=568

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  368  IDGVILPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L+KENVP+HL++HKTF+GNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKHPEQLKKENVPEHLITHKTFTGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQLNASR KG+ IEGFN+ST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGFNYSTATLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEAS+D PA  PT LP+I
Sbjct  548  TKYLEASTDFPAYLPTLLPQI  568



>ref|XP_008377422.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Malus 
domestica]
Length=568

 Score =   351 bits (901),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+ETGEIDFGEP TNGQHSFYQLIHQGRVIPC+FIGV+KSQQPVYLKGEVVSNH
Sbjct  368  IDGVILPFETGEIDFGEPXTNGQHSFYQLIHQGRVIPCEFIGVMKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L+KENVP+HL++HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKHPEQLKKENVPEHLITHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQLNASR KG+ IEGFN+ST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGFNYSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEA+ DIPAD PT LP+I
Sbjct  548  TKYLEATKDIPADLPTLLPQI  568



>ref|XP_007151167.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
 gb|ESW23161.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
Length=568

 Score =   348 bits (894),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYL GEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLSGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENVP HLV HK FSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTSEQLQKENVPPHLVPHKIFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLA+QVRKQLN SR +GE ++GFN ST ++L
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLNVSRTQGEPVQGFNSSTTSML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+AS+D+PAD PT LP+I
Sbjct  548  TRYLQASADVPADLPTRLPQI  568



>ref|XP_011021922.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Populus 
euphratica]
Length=568

 Score =   348 bits (894),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PLP+ETGEIDFGEPG  GQ SFYQLIHQGRVIPCDFIGV+KSQQPVYL+GEV +NH
Sbjct  368  IDGKPLPFETGEIDFGEPGAYGQRSFYQLIHQGRVIPCDFIGVMKSQQPVYLEGEVANNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT EELQKENVPQHLV HKTFSGNRPSLS+LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEELQKENVPQHLVPHKTFSGNRPSLSLLLSSLDAYKIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQL+ASR KGE ++GFNFST T+L
Sbjct  488  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVDGFNFSTTTML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            SK+L+ SS++PA+PPT LP+I
Sbjct  548  SKFLKESSEVPANPPTILPRI  568



>gb|KCW67833.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
Length=566

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 188/201 (94%), Gaps = 2/201 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLK  VVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLK--VVSNH  425

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ ENV  HL+ HKTF+GNRPSLS+LLPSL AYNIGQL
Sbjct  426  DELMSNFFAQPDALAYGKTPEQLQTENVAHHLIPHKTFTGNRPSLSLLLPSLTAYNIGQL  485

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQL+ASR KGE +EGFN+ST T+L
Sbjct  486  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFNYSTATML  545

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA+SD+P+DPPT LP+I
Sbjct  546  TRYLEATSDVPSDPPTLLPRI  566



>ref|XP_010254873.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nelumbo 
nucifera]
Length=568

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  368  IDGVHLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGELVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  ENVPQHL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLLNENVPQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLA+QVRKQLNASR KGE +EGFNFST  +L
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLNASRIKGEPVEGFNFSTTKML  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLEA S + A P T LPK+
Sbjct  548  NKYLEAKSRVLAHPSTILPKM  568



>gb|AAY85660.1| cytosolic glucose-6-phosphate isomerase [Helianthus annuus]
Length=566

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLK EVV+NH
Sbjct  366  IDGVRLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKDEVVNNH  425

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ ENV  HLV HKTF+GNRPSLS+LLPSL+AY IGQL
Sbjct  426  DELMSNFFAQPDALAYGKTPEQLQSENVAPHLVPHKTFTGNRPSLSLLLPSLDAYRIGQL  485

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQL+ASRKKGES+EGFNFST  LL
Sbjct  486  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHASRKKGESVEGFNFSTTKLL  545

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEAS+D+P++P T LPKI
Sbjct  546  TRYLEASADVPSEPTTLLPKI  566



>sp|O82059.2|G6PI_SPIOL RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Spinacia oleracea]
 emb|CAA03983.1| glucose-6-phosphate isomerase [Spinacia oleracea]
Length=566

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+ KSQQPVYLKGEVVSNH
Sbjct  368  IDGVVLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIAKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKTQEELQKEN+  HLV HKTF+GNRPSLS+LLPSL AYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKTQEELQKENISPHLVPHKTFTGNRPSLSLLLPSLTAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAV+GF+WGINSFDQWGVELGKSLA QVRKQL+ASR  GE+++GFNFST T++
Sbjct  488  LAIYEHRVAVEGFVWGINSFDQWGVELGKSLANQVRKQLHASRTNGEAVKGFNFSTTTVM  547

Query  270  SKYLEASSDIPADPPTALP  214
            +KYL+ +SD+PA+ PT LP
Sbjct  548  AKYLQETSDVPAELPTKLP  566



>ref|XP_009407687.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407688.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=567

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG +KSQQP+YLKGEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGSIKSQQPIYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L  ENVP HL+ HKTFSGNRPSLS+LLPS +AYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKNPEQLLHENVPDHLIPHKTFSGNRPSLSLLLPSFDAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGK LATQVRKQL+ SR +G  ++GFNFST TLL
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKVLATQVRKQLHLSRTEGGPVQGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +KYLE     P+D    LP++
Sbjct  548  TKYLEVEPGNPSD-SNELPRL  567



>gb|ABK24817.1| unknown [Picea sitchensis]
Length=346

 Score =   331 bits (848),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPL +E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG++KSQQP+YL+GEVVSNH
Sbjct  148  IDGVPLNFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIIKSQQPIYLQGEVVSNH  207

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GKT EEL+ E V  HL++HKTFSGNRPSLSILLPSL AYN+GQL
Sbjct  208  DELMSNFFAQPDALACGKTPEELRSEKVSDHLIAHKTFSGNRPSLSILLPSLTAYNVGQL  267

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR+AVQGFIWGINSFDQWGVELGKSLA++VR QLN SR +G+ +EGFN ST  L+
Sbjct  268  LAMYEHRIAVQGFIWGINSFDQWGVELGKSLASRVRAQLNMSRTEGKPVEGFNHSTAMLI  327

Query  270  SKYLEASSDIPAD  232
             +YL+ ++ IP D
Sbjct  328  KRYLKENAPIPVD  340



>dbj|BAB83916.1| cytosolic phosphoglucose isomerase, partial [Dryopteris caudipinna]
Length=293

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 174/204 (85%), Gaps = 5/204 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            I+GVPL +E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+++SQQPVYLKGEVVSNH
Sbjct  88   IEGVPLSFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIIESQQPVYLKGEVVSNH  147

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGKT EEL  E VP+HLV HKTFSGNRPSLSILLP L  Y +GQL
Sbjct  148  DELMCNFFAQADALAYGKTPEELXAEGVPEHLVPHKTFSGNRPSLSILLPKLTPYTLGQL  207

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGFIWGINSFDQWGVELGKSLA+ VRKQ+NASR +G+S+ GFN+ST TLL
Sbjct  208  LSIYEHRIAVQGFIWGINSFDQWGVELGKSLASHVRKQINASRSQGKSVAGFNYSTSTLL  267

Query  270  SKYLEASSDIPAD-----PPTALP  214
            + YL+  S++        PP  LP
Sbjct  268  NHYLKVKSNVYTSTHDSFPPAILP  291



>emb|CAC85668.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=178

 Score =   321 bits (822),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 1/178 (1%)
 Frame = -1

Query  738  SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNHDELMSNFFAQPDALAYGKTQEELQ  559
            SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NHDELMSNFFAQPDALAYGKT EEL+
Sbjct  1    SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNHDELMSNFFAQPDALAYGKTPEELK  60

Query  558  KENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQLLAIYEHRVAVQGFIWGINSFDQWG  379
            KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQLLAIYEHRVAVQGF+WGINSFDQWG
Sbjct  61   KENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWG  120

Query  378  VELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTLLSKYLEASSDIPADPPTALPKI  208
            VELGKSLATQVRKQL+ASR KGE + EGFNFSTKTLL++YL+A+SD+PADP T LP I
Sbjct  121  VELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  178



>ref|XP_008353564.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Malus 
domestica]
Length=281

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+ETGEIDFGEP TNGQHSFYQLIHQGRVIPC+FIGV+KSQQPVYLKGEVVSNH
Sbjct  88   IDGVILPFETGEIDFGEPXTNGQHSFYQLIHQGRVIPCEFIGVMKSQQPVYLKGEVVSNH  147

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L+KENVP+HL++HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  148  DELMSNFFAQPDALAYGKHPEQLKKENVPEHLITHKTFSGNRPSLSLLLPSLNAYNIGQL  207

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQLNASR KG+ IEGFN+ST TLL
Sbjct  208  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGFNYSTTTLL  267

Query  270  SKYLEA  253
            +KYLE 
Sbjct  268  TKYLEV  273



>ref|XP_010519111.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Tarenaya hassleriana]
 ref|XP_010519112.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Tarenaya hassleriana]
Length=561

 Score =   333 bits (853),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQP+YLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPIYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  EEL+KENV ++L+ HKTFSGNRPSLS+LLP+LNAYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKAPEELRKENVAENLIPHKTFSGNRPSLSLLLPALNAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGKSLAT+VRKQLNASR +G +I+GFNFST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKSLATRVRKQLNASRTEGAAIDGFNFSTTTLL  548

Query  270  SKYLEASSD  244
             +YLEASSD
Sbjct  549  QRYLEASSD  557



>dbj|BAA23180.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV++SQQP+YLKGEVVSNH
Sbjct  368  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMRSQQPIYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L  E VP HL+ HKTF GNRPSLS+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKVAEQLLNEKVPDHLIPHKTFPGNRPSLSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQL+ SR K E +EGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA + +P+D  + LPK+
Sbjct  548  TRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23177.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23178.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV++SQQP+YLKGEVVSNH
Sbjct  368  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMRSQQPIYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L  E VP HL+ HKTF GNRPSLS+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKVAEQLLNEKVPDHLIPHKTFPGNRPSLSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQL+ SR K E +EGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA + +P+D  + LPK+
Sbjct  548  TRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23176.1| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV++SQQP+YLKGEVVSNH
Sbjct  368  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMRSQQPIYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L  E VP HL+ HKTF GNRPSLS+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKVAEQLLNEKVPDHLIPHKTFPGNRPSLSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQL+ SR K E +EGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA + +P+D  + LPK+
Sbjct  548  TRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23179.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23184.1| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV++SQQP+YLKGEVVSNH
Sbjct  368  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMRSQQPIYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L  E VP HL+ HKTF GNRPSLS+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKVAEQLLNEKVPDHLIPHKTFPGNRPSLSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQL+ SR K E +EGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA + +P+D  + LPK+
Sbjct  548  TRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23181.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23183.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV++SQQP+YLKGEVVSNH
Sbjct  368  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMRSQQPIYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L  E VP HL+ HKTF GNRPSLS+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKVAEQLLNEKVPDHLIPHKTFPGNRPSLSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQL+ SR K E +EGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA + +P+D  + LPK+
Sbjct  548  TRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23185.2| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV++SQQP+YLKGEVVSNH
Sbjct  368  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMRSQQPIYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L  E VP HL+ HKTF GNRPSLS+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKVAEQLLNEKVPBHLIPHKTFPGNRPSLSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+WGINSFDQWGVELGKSLA+QVRKQL+ SR K E +EGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA + +P+D  + LPK+
Sbjct  548  TRYLEAETGVPSD-QSQLPKL  567



>emb|CDX95171.1| BnaC09g16990D [Brassica napus]
Length=201

 Score =   318 bits (815),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG VKSQQPVYL+GEVVSNH
Sbjct  10   IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGTVKSQQPVYLEGEVVSNH  69

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L+AYN+GQL
Sbjct  70   DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELSAYNVGQL  129

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  130  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGAAPEGFNYSTTTLL  189

Query  270  SKYLEASSD  244
             +YLE S +
Sbjct  190  KRYLETSPE  198



>dbj|BAC77713.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   330 bits (847),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LL  L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLLELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>gb|KJB14514.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=584

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENV QHL+ HKTFSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTAEQLLKENVSQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA YEHRV V+GF+WGINSFDQWGVELGKSLATQVRKQLNASR K E +EGFNFST TLL
Sbjct  488  LASYEHRVTVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKSEPVEGFNFSTTTLL  547

Query  270  SKYLE  256
            ++YL+
Sbjct  548  TRYLQ  552



>ref|XP_010942803.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Elaeis 
guineensis]
Length=567

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQP+YLKGE VSNH
Sbjct  368  IDGIPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPIYLKGEAVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT+E+L  E +P HL+ HKTFSGNRPSLS+LLPSL+AYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTREQLLGEKIPNHLIPHKTFSGNRPSLSLLLPSLSAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLN SR KGE + GFNFST TLL
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNLSRTKGEPVAGFNFSTSTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLE  S + ++  T LPK+
Sbjct  548  TRYLEGDSGVQSN-STMLPKM  567



>ref|XP_010442128.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
Length=560

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AY++GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYSVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G +IEGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAIEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>sp|Q9FXM4.1|G6PI_ARALP RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis lyrata 
subsp. petraea]
 dbj|BAB17656.1| cytosolic phosphoglucose isomerase [Arabidopsis lyrata subsp. 
petraea]
Length=560

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>ref|XP_002865489.1| glucose-6-phosphate isomerase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41748.1| glucose-6-phosphate isomerase [Arabidopsis lyrata subsp. lyrata]
Length=560

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV + L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSEFLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>ref|XP_010481956.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X3 
[Camelina sativa]
Length=560

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AY++GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYSVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>ref|XP_010481955.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Camelina sativa]
 ref|XP_010481957.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Camelina sativa]
Length=560

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AY++GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYSVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>ref|XP_010494215.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494216.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494217.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494218.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
Length=560

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AY++GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYSVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>sp|Q9FXM5.2|G6PI_ARAHG RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis halleri 
subsp. gemmifera]
Length=560

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGE+DFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEVDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>ref|XP_010481952.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Camelina sativa]
 ref|XP_010481958.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Camelina sativa]
Length=560

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AY++GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYSVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAA23182.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   328 bits (841),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV++SQQP+YLKGEVVSNH
Sbjct  368  IDGVPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMRSQQPIYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK  E+L  E VP HL+ HKTF GNRPSLS+LLPSLNAYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKVAEQLLNEKVPDHLIPHKTFPGNRPSLSLLLPSLNAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GF+W INSFDQWGVELGKSLA+QVRKQL+ SR K E +EGFNFST TLL
Sbjct  488  LAIYEHRIAVEGFVWXINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGFNFSTTTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEA + +P+D  + LPK+
Sbjct  548  TRYLEAETGVPSD-QSQLPKL  567



>dbj|BAC77708.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77711.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77712.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (839),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC77716.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77721.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC11915.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77718.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC77717.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>gb|AAK50107.1|AF372970_1 AT5g42740/MJB21_12 [Arabidopsis thaliana]
 gb|AAM16223.1| AT5g42740/MJB21_12 [Arabidopsis thaliana]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAB17648.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC77720.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC77715.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAB17654.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>ref|NP_199088.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
 sp|P34795.1|G6PI_ARATH RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis thaliana]
 emb|CAA48940.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
 dbj|BAB10630.1| glucose-6-phosphate isomerase, cytosolic [Arabidopsis thaliana]
 dbj|BAB17638.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17641.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17642.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17644.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17647.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17651.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17652.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17653.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 emb|CAD11677.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 gb|AED94855.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC77710.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAB17636.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC77714.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC77709.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAB17649.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL +SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLQSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAB17646.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAB17635.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17640.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAB17643.1| cytosolic phosphoglucose isonerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAB17637.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>dbj|BAC77719.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   326 bits (835),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELG+ LAT VRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGRVLATHVRKQLHSSRTQGTTLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  IRYLETSSE  557



>dbj|BAC11914.1| cytosolic phosphoglucose isomerase [Crucihimalaya himalaica]
Length=560

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+W INSFDQWGVELGK LA QVRKQL++SR +G+++EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWVINSFDQWGVELGKVLAAQVRKQLHSSRTQGKALEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>ref|XP_008783474.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Phoenix 
dactylifera]
 ref|XP_008783475.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Phoenix 
dactylifera]
Length=567

 Score =   325 bits (834),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 181/201 (90%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQP+YLKGE VSNH
Sbjct  368  IDGIPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPIYLKGEAVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT+E+L  E VP HL+ HKTFSGNRPSLS+LLPSL+AYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTREQLLGEKVPNHLIPHKTFSGNRPSLSLLLPSLSAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQLN SR +G+ + GFNF T TLL
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNLSRTQGKPVVGFNFGTSTLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLE  S + ++  T LPK+
Sbjct  548  TRYLEVDSGVQSE-STVLPKM  567



>dbj|BAB17650.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   325 bits (833),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DE MSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DEFMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>emb|CAC85669.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85648.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=168

 Score =   311 bits (797),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -1

Query  738  SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNHDELMSNFFAQPDALAYGKTQEELQ  559
            SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NHDELMSNFFAQPDALAYGKT E+L+
Sbjct  1    SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNHDELMSNFFAQPDALAYGKTPEQLK  60

Query  558  KENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQLLAIYEHRVAVQGFIWGINSFDQWG  379
            KENV +HL+ HKTF+GNRPS+SILLP+L+AY IGQLLAIYEHRVAVQGF+WGINSFDQWG
Sbjct  61   KENVSEHLIPHKTFTGNRPSISILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWG  120

Query  378  VELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLLSKYLEASSDIPA  235
            VELGKSLATQVRKQL+ASR KGE +EGFNFSTKTLL++YLEA+SD+P 
Sbjct  121  VELGKSLATQVRKQLHASRVKGEPVEGFNFSTKTLLTRYLEATSDVPT  168



>dbj|BAB17645.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   325 bits (833),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DEL+SNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELISNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>emb|CAC85647.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=169

 Score =   309 bits (792),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 162/169 (96%), Gaps = 1/169 (1%)
 Frame = -1

Query  738  SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNHDELMSNFFAQPDALAYGKTQEELQ  559
            SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NHDELMSNFFAQPDALAYGKT EEL+
Sbjct  1    SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNHDELMSNFFAQPDALAYGKTPEELK  60

Query  558  KENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQLLAIYEHRVAVQGFIWGINSFDQWG  379
            KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQLLAIYEHRVAVQGF+WGINSFDQWG
Sbjct  61   KENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWG  120

Query  378  VELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTLLSKYLEASSDIPA  235
            VELGKSLATQVRKQL+ASR KGE + EGFNFSTKTLL++YL+A+SD+PA
Sbjct  121  VELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPA  169



>gb|KJB14511.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=545

 Score =   322 bits (825),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 166/201 (83%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENV QHL+ HK                       L
Sbjct  428  DELMSNFFAQPDALAYGKTAEQLLKENVSQHLIPHK-----------------------L  464

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA YEHRV V+GF+WGINSFDQWGVELGKSLATQVRKQLNASR K E +EGFNFST TLL
Sbjct  465  LASYEHRVTVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKSEPVEGFNFSTTTLL  524

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL+ASSDIPA+PPT LP+I
Sbjct  525  TRYLQASSDIPAEPPTLLPRI  545



>ref|XP_006281946.1| hypothetical protein CARUB_v10028158mg [Capsella rubella]
 gb|EOA14844.1| hypothetical protein CARUB_v10028158mg [Capsella rubella]
Length=560

 Score =   322 bits (826),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PL YETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGE+VSNH
Sbjct  369  IDGLPLSYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEMVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AY++GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYSVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G  +EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTPLEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>gb|AAC08411.1| cytosolic phosphoglucose isomerase [Leavenworthia crassa]
Length=560

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENV ++L+ HKTFSGNRPSLS+LLP L+AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLHKENVSENLIPHKTFSGNRPSLSLLLPELSAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LA+QVRKQL++SR +G  ++GFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLASQVRKQLHSSRTQGTELDGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  549  KRYLETSSE  557



>gb|AED99453.1| PgiC protein [Poa palustris]
Length=567

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGFIWGINSFDQWGVELGKSLA+QVRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  488  LAIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHASRMEGKPVEGFNPSSASLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P D  T LPK+
Sbjct  548  ARYLAVEPSTPYD-TTVLPKV  567



>emb|CDY64430.1| BnaA09g16190D [Brassica napus]
Length=568

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG VKSQQPVYL+GEVVSNH
Sbjct  377  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGTVKSQQPVYLEGEVVSNH  436

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L+AYN+GQL
Sbjct  437  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELSAYNVGQL  496

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  497  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGAAPEGFNYSTTTLL  556

Query  270  SKYLEASSD  244
             +YLE S +
Sbjct  557  KRYLETSPE  565



>ref|XP_009114042.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Brassica 
rapa]
Length=560

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG VKSQQPVYL+GEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGTVKSQQPVYLEGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L+AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELSAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGAAPEGFNYSTTTLL  548

Query  270  SKYLEASSD  244
             +YLE S +
Sbjct  549  KRYLETSPE  557



>dbj|BAB17639.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=559

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEV SNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEV-SNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFN+ST TLL
Sbjct  488  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNYSTTTLL  547

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  548  KRYLETSSE  556



>gb|AED99455.1| PgiC2-3 protein [Festuca ovina]
Length=567

 Score =   320 bits (820),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGFIWGINSFDQWGVELGKSLA++VRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  488  LAIYEHRIAVQGFIWGINSFDQWGVELGKSLASRVRKQLHASRMEGKPVEGFNPSSASLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P D  T LPK+
Sbjct  548  ARYLAVEPSTPYD-TTVLPKV  567



>emb|CAC85670.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85671.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=169

 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 161/169 (95%), Gaps = 1/169 (1%)
 Frame = -1

Query  738  SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNHDELMSNFFAQPDALAYGKTQEELQ  559
            SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NHDELMSNFFAQPDALAYGKT E+L+
Sbjct  1    SFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNHDELMSNFFAQPDALAYGKTPEQLK  60

Query  558  KENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQLLAIYEHRVAVQGFIWGINSFDQWG  379
            KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQLL IYEHRVAVQGF+WGINSFDQWG
Sbjct  61   KENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQLLGIYEHRVAVQGFVWGINSFDQWG  120

Query  378  VELGKSLATQVRKQLNASRKKGESI-EGFNFSTKTLLSKYLEASSDIPA  235
            VELGKSLATQVRKQL+ASR KGE + EGFNFSTKTLL++YL+A+SD+PA
Sbjct  121  VELGKSLATQVRKQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPA  169



>dbj|BAC11913.1| cytosolic phosphoglucose isomerase [Turritis glabra]
Length=560

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYE RVAVQGF+WGINSFDQ GVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  489  LAIYERRVAVQGFVWGINSFDQLGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  548

Query  270  SKYLEASS  247
             ++LE SS
Sbjct  549  KRFLETSS  556



>ref|XP_004981572.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Setaria 
italica]
Length=567

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE VSNH
Sbjct  368  IDGVQLPLETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ E VP+HL+ HKTF GNRPSLS+LLP+L+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQSEKVPEHLIPHKTFKGNRPSLSLLLPTLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGFIWGINSFDQWGVELGKSLA+QVRKQL+ SR +G+ +EGFN ST +LL
Sbjct  488  LSIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHGSRMEGKPVEGFNHSTSSLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P D  T LPK+
Sbjct  548  ARYLAVKPSTPYD-TTVLPKV  567



>tpg|DAA51693.2| TPA: glucose-6-phosphate isomerase, cytosolic(Phosphoglucose 
isomerase)(PGI) [Zea mays]
Length=209

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG  L +ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE VSNH
Sbjct  10   IDGAQLSFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGETVSNH  69

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP++L+ HKTF GNRPSLS+LLP+L+AY +GQL
Sbjct  70   DELMSNFFAQPDALAYGKTPEQLHSEKVPENLIPHKTFKGNRPSLSLLLPTLSAYEVGQL  129

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGFIWGINSFDQWGVELGKSLA+QVRKQL+ +R +G+ +EGFN ST +LL
Sbjct  130  LSIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHGTRMEGKPVEGFNHSTSSLL  189

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P D  T LPK+
Sbjct  190  ARYLAVKPSTPYD-TTVLPKV  209



>gb|KDO84532.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=583

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 166/201 (83%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH
Sbjct  406  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  465

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GKT E+LQKENV  HL+ HK                       L
Sbjct  466  DELMSNFFAQPDALAVGKTPEQLQKENVAPHLIPHK-----------------------L  502

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGKSLATQVRKQL+ASR K E IEGFNFST TLL
Sbjct  503  LAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGFNFSTTTLL  562

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLEASSDIP+DP T LP+I
Sbjct  563  TRYLEASSDIPSDPSTLLPRI  583



>ref|XP_009381882.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   319 bits (818),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 181/201 (90%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRV+PCDFIG +KSQQP+YLKGEVVSNH
Sbjct  427  IDGIPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVVPCDFIGSIKSQQPIYLKGEVVSNH  486

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK+ E+L +++VP HLV HKTFSGNRPSLS+LLPSL+AYNIG+L
Sbjct  487  DELMSNFFAQPDALAYGKSPEQLLQDSVPDHLVPHKTFSGNRPSLSLLLPSLDAYNIGKL  546

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AV+GFIWGINSFDQWGVELGK LA+QVRKQL+ S  K E ++GFNFST TLL
Sbjct  547  LAIYEHRIAVEGFIWGINSFDQWGVELGKVLASQVRKQLHLSHTKREPVQGFNFSTTTLL  606

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YLE     P+D  T LP++
Sbjct  607  TRYLEVEPGTPSD-STMLPRV  626



>gb|EMS52088.1| Glucose-6-phosphate isomerase, cytosolic [Triticum urartu]
Length=567

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 176/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVRLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ E VP++L+SHKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLQSEKVPENLISHKTFQGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGFIWGINSFDQWGVELGKSLA+ VRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  488  LSIYEHRIAVQGFIWGINSFDQWGVELGKSLASTVRKQLHASRMEGKPVEGFNPSSASLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +++L      P D  T LPK+
Sbjct  548  TRFLAVKPSTPYD-TTVLPKV  567



>gb|AED99454.1| PgiC protein [Festuca ovina]
Length=567

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 176/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVRLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ EN+ ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLRSENLSENLIPHKTFQGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGFIWGINSFDQWGVELGKSLA+QVRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  488  LAIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHASRMEGKPVEGFNPSSASLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P D  T LPK+
Sbjct  548  ARYLAVKPSTPXD-TTVLPKV  567



>gb|ABE41790.1| glucose-6-phosphate isomerase [Triticum aestivum]
Length=567

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVRLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP++L+SHKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPENLISHKTFQGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGFIWGINSFDQWGVELGKSLA+ VRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  488  LSIYEHRIAVQGFIWGINSFDQWGVELGKSLASTVRKQLHASRMEGKPVEGFNPSSASLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +++L      P D  T LPK+
Sbjct  548  TRFLAVKPSTPYD-TTVLPKV  567



>gb|ABB90111.1| phosphoglucoisomerase [Festuca ovina]
Length=552

 Score =   314 bits (805),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  359  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  418

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  419  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  478

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGFIWGINSFDQWGVELGKSLA++VRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  479  LAIYEHRIAVQGFIWGINSFDQWGVELGKSLASRVRKQLHASRMEGKPVEGFNPSSASLL  538

Query  270  SKYLEASSDIP  238
            ++YL      P
Sbjct  539  ARYLAVEPSTP  549



>gb|AED99456.1| PgiC2-4 protein [Festuca ovina]
Length=561

 Score =   315 bits (806),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGFIWGINSFDQWGVELGKSLA++VRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  488  LAIYEHRIAVQGFIWGINSFDQWGVELGKSLASRVRKQLHASRMEGKPVEGFNPSSASLL  547

Query  270  SKYLEASSDIP  238
            ++YL      P
Sbjct  548  ARYLAVEPSTP  558



>dbj|BAA08149.1| phosphoglucose isomerase (Pgi-b) [Oryza sativa]
Length=568

 Score =   315 bits (807),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 179/201 (89%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  369  IDGVQLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP+HL+SHKTF GNRPSLS+LLPSL+AY IGQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEQLHSEKVPEHLISHKTFQGNRPSLSLLLPSLSAYEIGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ ++GFN ST +LL
Sbjct  489  LSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFNSSTASLL  548

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P +  T +PK+
Sbjct  549  TRYLAVEPSTPYN-TTTMPKV  568



>ref|XP_006403357.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 ref|XP_006403358.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 ref|XP_006403359.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44810.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44811.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44812.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
Length=560

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG VKSQQPV+LK E VSNH
Sbjct  369  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGTVKSQQPVHLKREEVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT EELQKENV ++L+ HKTFSGNRPSLS+LLP L+AY +GQL
Sbjct  429  DELMSNFFAQPDALAYGKTPEELQKENVSENLIPHKTFSGNRPSLSLLLPELSAYTVGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G + EGFNFST TLL
Sbjct  489  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFNFSTTTLL  548

Query  270  SKYLEAS  250
             +YLE +
Sbjct  549  KRYLETN  555



>ref|NP_001057316.1| Os06g0256500 [Oryza sativa Japonica Group]
 sp|P42863.2|G6PIB_ORYSJ RecName: Full=Glucose-6-phosphate isomerase, cytosolic B; Short=GPI-B; 
AltName: Full=Phosphoglucose isomerase B; Short=PGI-B; 
AltName: Full=Phosphohexose isomerase B; Short=PHI-B [Oryza 
sativa Japonica Group]
 dbj|BAD46305.1| glucose-6-phosphate isomerase b [Oryza sativa Japonica Group]
 dbj|BAF19230.1| Os06g0256500 [Oryza sativa Japonica Group]
 dbj|BAG90817.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65472.1| hypothetical protein OsJ_20863 [Oryza sativa Japonica Group]
 gb|AGT38453.1| phosphoglucose isomerase [Oryza sativa Japonica Group]
Length=567

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV L +ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  368  IDGVQLSFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP+HL+SHKTF GNRPSLS+LLPSL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPEHLISHKTFQGNRPSLSLLLPSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ ++GFN ST +LL
Sbjct  488  LSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFNSSTASLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P +  T +PK+
Sbjct  548  TRYLAVEPSTPYN-TTTMPKV  567



>gb|ABE41789.1| glucose-6-phosphate isomerase [Hordeum vulgare]
 dbj|BAJ88324.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=567

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVRLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPENLIPHKTFQGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGFIWGINSFDQWGVELGKSLA+ VRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  488  LSIYEHRIAVQGFIWGINSFDQWGVELGKSLASTVRKQLHASRMEGKPVEGFNPSSASLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +++L      P D  T LPK+
Sbjct  548  TRFLAVKPSTPYD-TTVLPKV  567



>gb|AGT38452.1| phosphoglucose isomerase [Oryza sativa Japonica Group]
Length=567

 Score =   312 bits (799),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  368  IDGVQLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP+HL+ HKTF GNRPSLS+LLPSL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPEHLIPHKTFQGNRPSLSLLLPSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ + GFN ST +LL
Sbjct  488  LAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFNSSTTSLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P +  T LPK+
Sbjct  548  TRYLAVEPSTPYN-TTTLPKV  567



>ref|NP_001051434.1| Os03g0776000 [Oryza sativa Japonica Group]
 sp|P42862.2|G6PIA_ORYSJ RecName: Full=Glucose-6-phosphate isomerase, cytosolic A; Short=GPI-A; 
AltName: Full=Phosphoglucose isomerase A; Short=PGI-A; 
AltName: Full=Phosphohexose isomerase A; Short=PHI-A [Oryza 
sativa Japonica Group]
 gb|AAN65024.1| phosphoglucose isomerase (Pgi-a) [Oryza sativa Japonica Group]
 gb|ABF99131.1| Glucose-6-phosphate isomerase, cytosolic A, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABF99132.1| Glucose-6-phosphate isomerase, cytosolic A, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13348.1| Os03g0776000 [Oryza sativa Japonica Group]
 gb|EEE60024.1| hypothetical protein OsJ_12779 [Oryza sativa Japonica Group]
Length=567

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  368  IDGVQLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP+HL+ HKTF GNRPSLS+LLPSL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPEHLIPHKTFQGNRPSLSLLLPSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ + GFN ST +LL
Sbjct  488  LAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFNSSTTSLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P +  T LPK+
Sbjct  548  TRYLAVEPSTPYN-TTTLPKV  567



>gb|EEC76262.1| hypothetical protein OsI_13718 [Oryza sativa Indica Group]
Length=567

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  368  IDGVQLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP+HL+ HKTF GNRPSLS+LLPSL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPEHLIPHKTFQGNRPSLSLLLPSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ + GFN ST +LL
Sbjct  488  LAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFNSSTTSLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P +  T LPK+
Sbjct  548  TRYLAVEPSTPYN-TTTLPKV  567



>gb|EMT10058.1| Glucose-6-phosphate isomerase, cytosolic [Aegilops tauschii]
Length=567

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVRLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPENLIPHKTFQGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGFIWGINSFDQWGVELGKSLA+ VRKQL+ASR +G+ +EGFN S+ +LL
Sbjct  488  LSIYEHRIAVQGFIWGINSFDQWGVELGKSLASTVRKQLHASRMEGKPVEGFNPSSASLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +++L      P D  T LPK+
Sbjct  548  TRFLAVKPSTPYD-TTVLPKV  567



>ref|XP_002968611.1| hypothetical protein SELMODRAFT_89539 [Selaginella moellendorffii]
 gb|EFJ30865.1| hypothetical protein SELMODRAFT_89539 [Selaginella moellendorffii]
Length=564

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG  L YE GEIDFGEPGTNGQHSFYQLIHQGRV+PCDFIG++KSQQ V+L+ E+VSNH
Sbjct  370  IDGKVLDYEAGEIDFGEPGTNGQHSFYQLIHQGRVVPCDFIGIIKSQQSVFLRNEIVSNH  429

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGKT EEL+ E VP +L+ HKTF+GNRPSLS+LLP+L  Y +GQL
Sbjct  430  DELMCNFFAQADALAYGKTPEELRAEGVPDYLIPHKTFTGNRPSLSMLLPTLKPYTVGQL  489

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR+AVQGFIWGINSFDQWGVELGK LA++VR Q+NASR KG+ +EGFN ST TLL
Sbjct  490  LALYEHRIAVQGFIWGINSFDQWGVELGKVLASRVRTQMNASRTKGKPVEGFNHSTTTLL  549

Query  270  SKYLE  256
            ++YL+
Sbjct  550  NRYLK  554



>ref|XP_001760206.1| predicted protein [Physcomitrella patens]
 gb|EDQ74962.1| predicted protein [Physcomitrella patens]
Length=571

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 167/200 (84%), Gaps = 1/200 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG  LP+E GEI+FGEPGTNGQHSFYQLIHQGR IPCDFIG VKSQ+P+Y+ GE VSNH
Sbjct  367  IDGTRLPFEAGEIEFGEPGTNGQHSFYQLIHQGRTIPCDFIGSVKSQKPIYMIGEKVSNH  426

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQ DALAYGKT+E+LQ ENV + LV HK F+GNRPSLSILLP+LNAY +GQL
Sbjct  427  DELMSNFFAQADALAYGKTREDLQAENVKESLVPHKVFTGNRPSLSILLPALNAYTVGQL  486

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L++YE+R+AVQGF+WGINSFDQWGVELGKSLAT+VR QLN +R K   ++GFN+ST  LL
Sbjct  487  LSLYENRIAVQGFVWGINSFDQWGVELGKSLATKVRSQLNEARTKDAPVQGFNYSTTYLL  546

Query  270  SKYLEASSDIP-ADPPTALP  214
              YL+  + +  +DP    P
Sbjct  547  KHYLKGKTSVANSDPKNVFP  566



>dbj|BAA08148.1| phosphoglucose isomerase (Pgi-a) [Oryza sativa]
Length=567

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 176/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV L +ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  368  IDGVQLSFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP+HL+ HKTF GNRPSLS+LLPSL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPEHLIPHKTFQGNRPSLSLLLPSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ + GFN ST +LL
Sbjct  488  LAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFNSSTTSLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P +  T LPK+
Sbjct  548  TRYLAVEPSTPYN-TTTLPKV  567



>gb|ABK00059.1| cytosolic glucose-6-phosphate isomerase [Marchantia polymorpha]
Length=614

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 168/200 (84%), Gaps = 1/200 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DGVPLP+ TGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG++KSQQ VYLKGE VSNH
Sbjct  406  LDGVPLPFGTGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIIKSQQSVYLKGEQVSNH  465

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGKT+EEL  E VP+ L+ HK FSGNR SLSILLP+L  Y +GQL
Sbjct  466  DELMCNFFAQADALAYGKTREELVAEKVPEALIPHKMFSGNRQSLSILLPNLTPYTVGQL  525

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHRVAVQG+IWGINSFDQWGVELGKSLA +VR Q+NA+R K + + GFN+ST TLL
Sbjct  526  LALYEHRVAVQGWIWGINSFDQWGVELGKSLAGKVRTQMNAARTKTQPLSGFNYSTTTLL  585

Query  270  SKYLEASSDIP-ADPPTALP  214
            ++YL+  + +   DP    P
Sbjct  586  TRYLQGKTQLLYPDPHDVFP  605



>ref|NP_001105368.1| glucose-6-phosphate isomerase, cytosolic [Zea mays]
 sp|P49105.1|G6PI_MAIZE RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Zea mays]
 gb|AAA82734.1| glucose-6 phosphate isomerase [Zea mays]
 gb|ACF87923.1| unknown [Zea mays]
 gb|ACG35658.1| glucose-6-phosphate isomerase, cytosolic B [Zea mays]
 gb|ACN30887.1| unknown [Zea mays]
Length=567

 Score =   310 bits (793),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG  L +ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE VSNH
Sbjct  368  IDGAQLSFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP++L+ HKTF GNRPSLS+LLP+L+AY +GQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPENLIPHKTFKGNRPSLSLLLPTLSAYEVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGFIWGINSFDQWGVELGKSLA+QVRKQL+ +R +G+ +EGFN ST +LL
Sbjct  488  LSIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHGTRMEGKPVEGFNHSTSSLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL      P D  T LPK+
Sbjct  548  ARYLAVKPSTPYD-TTVLPKV  567



>ref|XP_002975871.1| hypothetical protein SELMODRAFT_104526 [Selaginella moellendorffii]
 gb|EFJ22776.1| hypothetical protein SELMODRAFT_104526 [Selaginella moellendorffii]
Length=562

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG  L YE GEIDFGEPGTNGQHSFYQLIHQGRV+PCDFIG++KSQQ V+L+ E+VSNH
Sbjct  368  IDGKVLDYEAGEIDFGEPGTNGQHSFYQLIHQGRVVPCDFIGIIKSQQSVFLRNEIVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGKT EEL+ E VP +L+ HKTF+GNRPSLS+LLP+L  Y +GQL
Sbjct  428  DELMCNFFAQADALAYGKTPEELRAEGVPDYLIPHKTFTGNRPSLSMLLPTLKPYTVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR+AVQGFIWGINSFDQWGVELGK LA++VR Q+NASR KG+ ++GFN ST TLL
Sbjct  488  LALYEHRIAVQGFIWGINSFDQWGVELGKVLASRVRTQMNASRTKGKPVQGFNHSTTTLL  547

Query  270  SKYLE  256
            ++YL+
Sbjct  548  NRYLK  552



>ref|XP_003569006.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Brachypodium 
distachyon]
Length=567

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 173/201 (86%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  368  IDGVRLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  428  DELMSNFFAQPDALAYGKTPEQLHSEKVPENLIPHKTFQGNRPSLSFLLSSLSAYEIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGFIWGINSFDQWGVELGKSLA+QVRKQL+ASR + + +EGFN S+  LL
Sbjct  488  LAIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHASRMEKKPVEGFNPSSAGLL  547

Query  270  SKYLEASSDIPADPPTALPKI  208
            +++L      P +  T LPK+
Sbjct  548  ARFLAVEPSTPYN-TTVLPKV  567



>gb|ABK00065.1| cytosolic glucose-6-phosphate isomerase [Marchantia polymorpha]
Length=653

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 168/200 (84%), Gaps = 1/200 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DGVPLP+ TGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG++KSQQ VYLKGE VSNH
Sbjct  445  LDGVPLPFGTGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIIKSQQSVYLKGEQVSNH  504

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGKT+EEL  E VP+ L+ HK FSGNR SLSILLP+L  Y +GQL
Sbjct  505  DELMCNFFAQADALAYGKTREELVAEKVPEALIPHKMFSGNRQSLSILLPNLTPYTVGQL  564

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHRVAVQG+IWGINSFDQWGVELGKSLA +VR Q+NA+R K + + GFN+ST TLL
Sbjct  565  LALYEHRVAVQGWIWGINSFDQWGVELGKSLAGKVRTQMNAARTKTQPLSGFNYSTTTLL  624

Query  270  SKYLEASSDIP-ADPPTALP  214
            ++YL+  + +   DP    P
Sbjct  625  TRYLQGKTQLLYPDPHDVFP  644



>gb|EEC80343.1| hypothetical protein OsI_22416 [Oryza sativa Indica Group]
Length=682

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV L +ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  417  IDGVQLSFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  476

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  ENVP+HL+SHKTF GNRPSLS+LLPSL+AY IGQL
Sbjct  477  DELMSNFFAQPDALAYGKTPEQLHSENVPEHLISHKTFQGNRPSLSLLLPSLSAYEIGQL  536

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+IYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ ++GFN ST +LL
Sbjct  537  LSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFNSSTASLL  596

Query  270  SKYL  259
            ++YL
Sbjct  597  TRYL  600


 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = -1

Query  453  LLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTL  274
            LL+IYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ ++GFN ST +L
Sbjct  602  LLSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFNSSTASL  661

Query  273  LSKYLEASSDIPADPPTALPKI  208
            L++YL      P +  T +PK+
Sbjct  662  LTRYLAVEPSTPYN-TTTMPKV  682



>ref|XP_002509192.1| phosphoglucose isomerase [Micromonas sp. RCC299]
 gb|ACO70450.1| phosphoglucose isomerase [Micromonas sp. RCC299]
Length=598

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 165/203 (81%), Gaps = 4/203 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PLPY+TGEIDFGEPGTNGQHSFYQLIHQGR IPCDFIG++KSQQ VYLKGE+VSNH
Sbjct  380  IDGQPLPYDTGEIDFGEPGTNGQHSFYQLIHQGRTIPCDFIGIIKSQQSVYLKGEIVSNH  439

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALA GKT  +L+ EN P  L+ HKTF+GNRPSLSI+LP+LNAY  GQ+
Sbjct  440  DELMCNFFAQADALAVGKTAVQLRSENCPDSLIPHKTFTGNRPSLSIMLPALNAYTTGQI  499

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTK  280
            LAIYEHRVA QGFIWG+NSFDQWGVELGK LA++VR  +N  R KGE +   +GFN ST 
Sbjct  500  LAIYEHRVATQGFIWGLNSFDQWGVELGKVLASKVRATMNEKRTKGEKMSDKDGFNPSTT  559

Query  279  TLLSKYLEASSDIP-ADPPTALP  214
             +L++YLE  + +  A+P    P
Sbjct  560  AMLNRYLEGKAQLKYAEPEDVFP  582



>ref|XP_006651865.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic B-like [Oryza 
brachyantha]
Length=907

 Score =   313 bits (802),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 178/201 (89%), Gaps = 1/201 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV L +ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGE+VSNH
Sbjct  708  IDGVQLSFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEIVSNH  767

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L  E VP+HL+ HKTF GNRPSLSILLPSL+AY IGQL
Sbjct  768  DELMSNFFAQPDALAYGKTPEQLHSEKVPEHLIPHKTFQGNRPSLSILLPSLSAYEIGQL  827

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR+AVQGF+WGINSFDQWGVELGKSLA+QVRK L+ASR +G+ ++GFN ST +LL
Sbjct  828  LAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVQGFNSSTASLL  887

Query  270  SKYLEASSDIPADPPTALPKI  208
            ++YL     IP +  T LPK+
Sbjct  888  TRYLAVEPSIPFN-TTTLPKV  907



>ref|XP_003082100.1| cytosolic phosphoglucose isomerase (ISS) [Ostreococcus tauri]
Length=590

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 161/193 (83%), Gaps = 3/193 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PL Y+TGEIDFGEPGTNGQHSFYQLIHQGR IPCDFIG+VKSQQ VYLKGE+VSNH
Sbjct  372  IDGTPLDYDTGEIDFGEPGTNGQHSFYQLIHQGRTIPCDFIGIVKSQQSVYLKGEIVSNH  431

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALA GK+  EL+ ENVP  L+ HKTFSGNRPSLSI+LP LNAY  GQL
Sbjct  432  DELMCNFFAQADALAVGKSAVELRSENVPDALIPHKTFSGNRPSLSIMLPELNAYTTGQL  491

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTK  280
            L++YEHRVAVQGF+WGINSFDQWGVELGK LA++VR  +N  R KGE++   EG+N ST 
Sbjct  492  LSLYEHRVAVQGFVWGINSFDQWGVELGKVLASRVRATMNDKRTKGETMSGGEGYNPSTT  551

Query  279  TLLSKYLEASSDI  241
             LL++YL   + +
Sbjct  552  RLLNRYLAGKAKL  564



>dbj|BAB17655.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=552

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 169/189 (89%), Gaps = 8/189 (4%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGE+DFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VK         EVVSNH
Sbjct  369  IDGLPLPFETGEVDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKR--------EVVSNH  420

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENV ++L+ HKTFSGNRPSLS+LLP L AYN+GQL
Sbjct  421  DELMSNFFAQPDALAYGKTPEQLQKENVSENLIPHKTFSGNRPSLSLLLPELTAYNVGQL  480

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHRVAVQGF+WGINSFDQWGVELGK LATQVRKQL++SR +G ++EGFN+ST TLL
Sbjct  481  LAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFNYSTTTLL  540

Query  270  SKYLEASSD  244
             +YLE SS+
Sbjct  541  KRYLETSSE  549



>emb|CEF99714.1| Phosphoglucose isomerase, C-terminal [Ostreococcus tauri]
Length=628

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 161/193 (83%), Gaps = 3/193 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PL Y+TGEIDFGEPGTNGQHSFYQLIHQGR IPCDFIG+VKSQQ VYLKGE+VSNH
Sbjct  410  IDGTPLDYDTGEIDFGEPGTNGQHSFYQLIHQGRTIPCDFIGIVKSQQSVYLKGEIVSNH  469

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALA GK+  EL+ ENVP  L+ HKTFSGNRPSLSI+LP LNAY  GQL
Sbjct  470  DELMCNFFAQADALAVGKSAVELRSENVPDALIPHKTFSGNRPSLSIMLPELNAYTTGQL  529

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTK  280
            L++YEHRVAVQGF+WGINSFDQWGVELGK LA++VR  +N  R KGE++   EG+N ST 
Sbjct  530  LSLYEHRVAVQGFVWGINSFDQWGVELGKVLASRVRATMNDKRTKGETMSGGEGYNPSTT  589

Query  279  TLLSKYLEASSDI  241
             LL++YL   + +
Sbjct  590  RLLNRYLAGKAKL  602



>gb|ABK00069.1| cytosolic glucose-6-phosphate isomerase [Chara vulgaris]
Length=561

 Score =   300 bits (767),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            I+GV  PY TG+IDFGEPGTNGQHSFYQLIHQGRVIPCDFIG++KSQ  V+LKGE+VSNH
Sbjct  367  IEGVRTPYPTGQIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIIKSQHSVHLKGEMVSNH  426

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGKT+E+L  E VP+ LVSHKTF+GNRPSLSILLP+L  Y +GQL
Sbjct  427  DELMCNFFAQADALAYGKTKEQLLAEGVPEALVSHKTFTGNRPSLSILLPTLTPYTVGQL  486

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEH+VAVQGF+WGINSFDQWGVELGK LA +VRK+++ +R +G  +  FN+ST  LL
Sbjct  487  LAMYEHQVAVQGFVWGINSFDQWGVELGKVLALKVRKEVSLARNQGTKVTAFNYSTNFLL  546

Query  270  SKYLEASSDI  241
            ++YL+   ++
Sbjct  547  NQYLKEKEEV  556



>ref|XP_001703279.1| phosphoglucose isomerase [Chlamydomonas reinhardtii]
 gb|EDP05961.1| phosphoglucose isomerase [Chlamydomonas reinhardtii]
Length=646

 Score =   302 bits (773),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 165/193 (85%), Gaps = 3/193 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            I+GV LP+ETGEIDFGEPGTNGQHSFYQLIHQGRV+PC+FIG+V+SQQ VYLKGEVVSNH
Sbjct  436  INGVRLPFETGEIDFGEPGTNGQHSFYQLIHQGRVVPCEFIGIVRSQQSVYLKGEVVSNH  495

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGKT E+L+ +NVP +L+ H+ F+GNRPS+SI+LPS  AY +GQL
Sbjct  496  DELMCNFFAQADALAYGKTPEQLRSDNVPDYLIPHRVFTGNRPSMSIMLPSCTAYTVGQL  555

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTK  280
            LAIYEHR+AVQGFIW INSFDQWGVELGK LA++VR  +N++R +   I   +GFN+ST 
Sbjct  556  LAIYEHRIAVQGFIWNINSFDQWGVELGKVLASKVRTVMNSARTRDRKILPQDGFNYSTT  615

Query  279  TLLSKYLEASSDI  241
             +++KYLE  + +
Sbjct  616  RMINKYLEGKTQV  628



>ref|XP_007509641.1| cytosolic phosphoglucose isomerase [Bathycoccus prasinos]
 emb|CCO19444.1| cytosolic phosphoglucose isomerase [Bathycoccus prasinos]
Length=635

 Score =   301 bits (771),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 164/199 (82%), Gaps = 3/199 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG P+ Y TGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQ VYLKGE+VSNH
Sbjct  417  IDGTPVDYPTGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQSVYLKGEIVSNH  476

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALA GKT  EL+ EN P  L+ HKTF+GNRPSLSI+LP LNAY  GQL
Sbjct  477  DELMCNFFAQADALAVGKTPVELRAENCPDTLIPHKTFTGNRPSLSIMLPELNAYTTGQL  536

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKG---ESIEGFNFSTK  280
            L++YEHRVAVQGF+WG+NSFDQWGVELGK LAT+VR  ++  R +G   +S +G+N ST+
Sbjct  537  LSLYEHRVAVQGFVWGLNSFDQWGVELGKVLATRVRATMHDKRNEGKMLDSSDGYNHSTE  596

Query  279  TLLSKYLEASSDIPADPPT  223
             +L++YL+  + +  D P+
Sbjct  597  RMLNRYLQGKAQLKYDTPS  615



>ref|XP_002946940.1| hypothetical protein VOLCADRAFT_103185 [Volvox carteri f. nagariensis]
 gb|EFJ52166.1| hypothetical protein VOLCADRAFT_103185 [Volvox carteri f. nagariensis]
Length=584

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 165/193 (85%), Gaps = 3/193 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            I+GV LP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPC+FIG+V+SQQ VYLKGEVVSNH
Sbjct  374  INGVRLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCEFIGIVRSQQSVYLKGEVVSNH  433

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGKT E+L+ +NVP +L+ H+ F+GNRPS+S++LPS  AY +GQL
Sbjct  434  DELMCNFFAQADALAYGKTPEQLRSDNVPDYLIPHRVFTGNRPSMSVMLPSCTAYTVGQL  493

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTK  280
            L++YEHR+AVQGFIW INSFDQWGVELGK LA++VR  +N++R +   +   +GFN+ST 
Sbjct  494  LSMYEHRIAVQGFIWNINSFDQWGVELGKVLASKVRTVMNSARTRDRKVLPQDGFNYSTT  553

Query  279  TLLSKYLEASSDI  241
             +++KYLE  + +
Sbjct  554  RMINKYLEGKTQV  566



>ref|XP_001420367.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98660.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=590

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PL YETGEIDFGEPGTNGQHSFYQLIHQGR IPCDFIG++KSQQ VYLKGE+VSNH
Sbjct  372  IDGTPLDYETGEIDFGEPGTNGQHSFYQLIHQGRTIPCDFIGIIKSQQSVYLKGEIVSNH  431

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALA GK+  EL+ E+ P  L+ HKTF+GNRPSLSILLP LNAY  GQL
Sbjct  432  DELMCNFFAQADALAVGKSAIELRAESCPDALIPHKTFTGNRPSLSILLPELNAYTTGQL  491

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTK  280
            L++YEHRVA QGF+WG+NSFDQWGVELGK LA++VR  +N+ R KGE +   +GFN ST 
Sbjct  492  LSLYEHRVATQGFVWGLNSFDQWGVELGKVLASRVRTSMNSKRTKGEIMTPGDGFNPSTT  551

Query  279  TLLSKYLEASSDI  241
             LL++YL   + +
Sbjct  552  ALLNRYLAGKAKL  564



>ref|XP_003061563.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54193.1| predicted protein [Micromonas pusilla CCMP1545]
Length=625

 Score =   298 bits (763),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 3/189 (2%)
 Frame = -1

Query  798  PLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNHDELM  619
            PLPY+TGEIDFGEPGTNGQHSFYQLIHQGR IPCDFIG++KSQQ VYLKGE+VSNHDELM
Sbjct  411  PLPYDTGEIDFGEPGTNGQHSFYQLIHQGRTIPCDFIGIIKSQQSVYLKGEIVSNHDELM  470

Query  618  SNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQLLAIY  439
             NFFAQ DALA GKT  EL+ ENVP  L+ HKTF+GNRPSLSI+LP+LNAY+ GQLLAIY
Sbjct  471  CNFFAQADALAVGKTDVELRSENVPTFLIPHKTFTGNRPSLSIMLPALNAYSTGQLLAIY  530

Query  438  EHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGE---SIEGFNFSTKTLLS  268
            EHRVAVQGF+WG+NSFDQWGVELGK LA++VR  ++  R  GE   S +GFN ST  +L+
Sbjct  531  EHRVAVQGFVWGLNSFDQWGVELGKVLASKVRVSMSQKRTTGELEGSSDGFNSSTTAMLN  590

Query  267  KYLEASSDI  241
            +YL+  + +
Sbjct  591  RYLKGKAQL  599



>ref|XP_001778143.1| predicted protein [Physcomitrella patens]
 gb|EDQ57033.1| predicted protein [Physcomitrella patens]
Length=594

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PLP+E GEI+FGEPGTNGQHSFYQLIHQGRV+PCDFIG VKSQ+ VY+ GE VSNH
Sbjct  388  IDGSPLPFEAGEIEFGEPGTNGQHSFYQLIHQGRVVPCDFIGAVKSQKSVYMVGEKVSNH  447

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQ DALA GK+ E+L+ E VP  LV HK F+GNRPSLSILLP+++A+ +GQL
Sbjct  448  DELMSNFFAQADALANGKSSEDLKAEGVPASLVPHKVFTGNRPSLSILLPNVDAFTVGQL  507

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L++YE+R+AVQGFIW +NSFDQWGVELGKSLA++VR QLNA+R K  ++EGFN+ST  LL
Sbjct  508  LSLYENRIAVQGFIWNVNSFDQWGVELGKSLASRVRSQLNAARTKEAAVEGFNYSTTFLL  567

Query  270  SKYLEASSDI  241
              YL+  + +
Sbjct  568  QHYLKGKTPV  577



>ref|XP_001782795.1| predicted protein [Physcomitrella patens]
 gb|EDQ52372.1| predicted protein [Physcomitrella patens]
Length=577

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PLPYE GEI+FGEPGTNGQHSFYQLIHQGRV+PCDFIG V+SQ  V++ GE VSNH
Sbjct  386  IDGTPLPYEAGEIEFGEPGTNGQHSFYQLIHQGRVVPCDFIGAVRSQHSVFMPGEKVSNH  445

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQ DALA GKT E+L+ E V   L+ HK F+GNRPSLSILLP+L+A+ IGQL
Sbjct  446  DELMSNFFAQADALADGKTPEDLKAEGVAAPLIPHKVFTGNRPSLSILLPTLDAFTIGQL  505

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L++YEHR+AVQGFIW +NSFDQWGVELGKSLA++VR QLNASR +   ++GFN+ST  LL
Sbjct  506  LSLYEHRIAVQGFIWNVNSFDQWGVELGKSLASRVRTQLNASRTRDAPLQGFNYSTTYLL  565

Query  270  SKYLEASSDI  241
            + YL+  + +
Sbjct  566  THYLKGKTPV  575



>gb|ACI29026.1| glucose-6-phosphate isomerase [Dunaliella salina]
Length=659

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 163/193 (84%), Gaps = 3/193 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            I+G PLP+E+GEID GEPGTNGQHSFYQLIHQGRV+PCDFIG+V+SQQ VYLKGE+VSNH
Sbjct  452  INGHPLPFESGEIDSGEPGTNGQHSFYQLIHQGRVVPCDFIGIVRSQQSVYLKGEIVSNH  511

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQ DALAY K  E+L+ ENVP  L+ HKTF+GNRPS+SI+LP+  A  +GQ+
Sbjct  512  DELMSNFFAQADALAYDKPPEQLRSENVPDFLIPHKTFTGNRPSISIMLPACTARTVGQI  571

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTK  280
            LA+YEHRVAVQGFIWGINSFDQWGVELGK LA++VR  ++ SR K  ++   +GFN+ST 
Sbjct  572  LALYEHRVAVQGFIWGINSFDQWGVELGKVLASKVRTTMHQSRTKSRTVSITDGFNYSTT  631

Query  279  TLLSKYLEASSDI  241
             +++KYLE  + +
Sbjct  632  RMMNKYLEGKTQM  644



>gb|AAL04447.1| cytosolic phosphoglucoisomerase [Beta vulgaris]
Length=154

 Score =   278 bits (711),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+ KSQQPVYLKGEVVSNH
Sbjct  10   IDGVVLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIAKSQQPVYLKGEVVSNH  69

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKTQEELQKENV   LV HKTFSGNRPS+S+LLPSL AYN+GQL
Sbjct  70   DELMSNFFAQPDALAYGKTQEELQKENVSPDLVPHKTFSGNRPSISLLLPSLTAYNVGQL  129

Query  450  LAIYEHRVAVQGFIWGINSFDQWGV  376
            LAIYEHR+AV+GFIWGINSFDQWGV
Sbjct  130  LAIYEHRIAVEGFIWGINSFDQWGV  154



>gb|KIY94551.1| glucose-6-phosphate isomerase [Monoraphidium neglectum]
Length=217

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 150/178 (84%), Gaps = 3/178 (2%)
 Frame = -1

Query  783  TGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNHDELMSNFFA  604
             GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+V+SQQ VYLK E+VSNHDELM NFFA
Sbjct  12   AGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVRSQQSVYLKNEIVSNHDELMCNFFA  71

Query  603  QPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQLLAIYEHRVA  424
            Q DALAYGKT  EL+ +NVP  LV H+ F+GNRPSLS+LLP LNAY +GQ+L++YEH+VA
Sbjct  72   QADALAYGKTSTELRSQNVPDFLVPHRVFTGNRPSLSVLLPELNAYTVGQILSLYEHQVA  131

Query  423  VQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTKTLLSKYL  259
            VQGF+W INSFDQWGVELGK LA++VR ++N +R     +   +GFN+ST  +++KYL
Sbjct  132  VQGFVWNINSFDQWGVELGKVLASKVRTKINEARNGARFMAGSDGFNYSTTRMINKYL  189



>ref|XP_005650466.1| cytosolic phosphoglucose isomerase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25922.1| cytosolic phosphoglucose isomerase [Coccomyxa subellipsoidea 
C-169]
Length=594

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 161/194 (83%), Gaps = 4/194 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG  L +E GEIDFGEPGTNGQHSFYQLIHQGRV+PC+FIG+VKSQQ VYLKGEVVSNH
Sbjct  375  LDGSKLSFEAGEIDFGEPGTNGQHSFYQLIHQGRVVPCEFIGIVKSQQSVYLKGEVVSNH  434

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALA GKT  EL+ ENVP  L+ HKTF+GNRPS+SILLP LNA+ +GQ+
Sbjct  435  DELMCNFFAQADALATGKTPIELRAENVPDSLIPHKTFTGNRPSISILLPELNAFTVGQI  494

Query  450  LAIYEHRVAV-QGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFST  283
            LA+YE+R+AV QGFIWGINSFDQWGVELGK LA++VR +++  R K  ++   +GFN ST
Sbjct  495  LALYENRIAVQQGFIWGINSFDQWGVELGKVLASKVRAEMHTCRTKDRNVSPTDGFNHST  554

Query  282  KTLLSKYLEASSDI  241
              LL++YLE  + +
Sbjct  555  TKLLNRYLEGKARL  568



>emb|CBK23535.2| unnamed protein product [Blastocystis hominis]
Length=567

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG PLP+ +GE+DFGEPGTNGQHSFYQLIHQGRVIPCDFIG  KSQ P+  + E VSNH
Sbjct  379  MDGTPLPFASGEVDFGEPGTNGQHSFYQLIHQGRVIPCDFIGFCKSQAPLESETEAVSNH  438

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK + +L+ +NVP  L  HK FSGNRPS S+L P LNAY  G+L
Sbjct  439  DELMSNFFAQPDALAVGKNEADLEAQNVPVELRPHKFFSGNRPSSSLLFPELNAYTCGEL  498

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LAIYEHR AVQGF+WG+ SFDQWGVELGK LAT VRKQL+ SRK+   + GFN ST  +L
Sbjct  499  LAIYEHRTAVQGFVWGLCSFDQWGVELGKVLATSVRKQLHGSRKENAEVSGFNPSTTAML  558

Query  270  SKYLEA  253
             KYL A
Sbjct  559  KKYLSA  564



>ref|XP_001754629.1| predicted protein [Physcomitrella patens]
 gb|EDQ80599.1| predicted protein, partial [Physcomitrella patens]
Length=575

 Score =   284 bits (726),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 158/186 (85%), Gaps = 2/186 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLK-GEVVSN  634
            +DG PL Y  GEIDFGEPGTNGQHSFYQLIHQGR+IPCDFIGV+KSQQ V L+ GE+VSN
Sbjct  362  MDGTPLNYHAGEIDFGEPGTNGQHSFYQLIHQGRLIPCDFIGVIKSQQAVNLQAGELVSN  421

Query  633  HDELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQ  454
            HDELM NFFAQPDALAYGKT+ E  KE +P+ LV HK F+GNRPSLSILLP+L+AY  GQ
Sbjct  422  HDELMCNFFAQPDALAYGKTRVEACKEGIPEELVPHKMFTGNRPSLSILLPTLDAYTAGQ  481

Query  453  LLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTL  274
               +YEHR+AVQGF+WGINSFDQWGVELGKSLAT+VR+ ++  R KGES+  +N+ST  +
Sbjct  482  -ATLYEHRIAVQGFVWGINSFDQWGVELGKSLATKVRQTMHNFRTKGESVCDYNYSTTFM  540

Query  273  LSKYLE  256
            L+++L+
Sbjct  541  LNRFLQ  546



>gb|ABK00064.1| cytosolic glucose-6-phosphate isomerase [Mesostigma viride]
Length=580

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG  LP+E GE++FGEPGTNGQHSFYQLIHQGRVIPCDFIG++KSQQ VYLK E+VSNH
Sbjct  354  MDGTELPFEAGEVEFGEPGTNGQHSFYQLIHQGRVIPCDFIGIIKSQQSVYLKNELVSNH  413

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGK+ EEL  E V   LV HKTF+GNRPS SILLP+L+AY +GQL
Sbjct  414  DELMCNFFAQADALAYGKSAEELVAEGVAPDLVPHKTFTGNRPSSSILLPTLDAYTVGQL  473

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            L+ YEHRVAV GFI+GINSFDQWGVELGK LA +VR  +N +R KG  I G+N ST  L+
Sbjct  474  LSHYEHRVAVAGFIYGINSFDQWGVELGKVLAGKVRTTMNQARTKGVPITGYNSSTIALM  533

Query  270  SKYLEASS  247
            ++YL   +
Sbjct  534  NRYLSGKT  541



>gb|KHG04166.1| Glucose-6-phosphate isomerase, cytosolic [Gossypium arboreum]
Length=560

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 170/212 (80%), Gaps = 12/212 (6%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYLKGEVVSNH
Sbjct  350  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLKGEVVSNH  409

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L KENV QHL+ HKTFSGNRPSLS+LLPSLNAYNIGQ 
Sbjct  410  DELMSNFFAQPDALAYGKTAEQLLKENVSQHLIPHKTFSGNRPSLSLLLPSLNAYNIGQS  469

Query  450  LAIYEHRVAVQGF--------IWGINSFDQWGVELG---KSLATQVRKQLNASRKKGESI  304
             A+     + Q          ++G +     G EL     SLATQVRKQLN SR K E +
Sbjct  470  NALLGCLSSWQAMNIELLLKVLFGASILLTSG-ELSWVRYSLATQVRKQLNGSRTKSEPV  528

Query  303  EGFNFSTKTLLSKYLEASSDIPADPPTALPKI  208
            EGFNFST TLL++YL+ASSDIPA+P T LP+I
Sbjct  529  EGFNFSTTTLLTRYLQASSDIPAEPLTLLPRI  560



>ref|XP_007151166.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
 gb|ESW23160.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
Length=519

 Score =   277 bits (709),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYL GEVVSNH
Sbjct  368  IDGVPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLSGEVVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENVP HLV HK FSGNRPSLS+LLPSLNAYNIGQL
Sbjct  428  DELMSNFFAQPDALAYGKTSEQLQKENVPPHLVPHKIFSGNRPSLSLLLPSLNAYNIGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AV+GFIWGINSFDQWGVELGK
Sbjct  488  LAIYEHRIAVEGFIWGINSFDQWGVELGK  516



>gb|ACB69778.1| phosphoglucose isomerase [Poa pratensis subsp. angustifolia]
Length=440

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  288  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  347

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  348  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  407

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLAT  352
            LAIYEHR+AVQGFIWGINSFDQWGVELGKSLA+
Sbjct  408  LAIYEHRIAVQGFIWGINSFDQWGVELGKSLAS  440



>ref|XP_008876241.1| hypothetical protein H310_11362 [Aphanomyces invadans]
 gb|ETV95068.1| hypothetical protein H310_11362 [Aphanomyces invadans]
Length=555

 Score =   276 bits (707),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DGV LP++ GEI+FGEPGTNGQHSFYQL+HQGRV+PCDFIG  KSQ PV L+GE VSNH
Sbjct  371  LDGVELPFQAGEINFGEPGTNGQHSFYQLVHQGRVVPCDFIGFCKSQAPVDLEGEAVSNH  430

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPS-LNAYNIGQ  454
            DELMSNFFAQPDALA GK+ +EL   NVP  L  HK F GNRPS+S+L    LNA++ GQ
Sbjct  431  DELMSNFFAQPDALANGKSIDELT--NVPDTLKPHKAFPGNRPSVSLLFEGHLNAFSAGQ  488

Query  453  LLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTL  274
            LLA+YEHR  VQG +WGINSFDQWGVELGK LATQVR QL+ASRK    ++GFN ST TL
Sbjct  489  LLALYEHRTVVQGAVWGINSFDQWGVELGKVLATQVRNQLSASRKSSAPVQGFNSSTSTL  548

Query  273  LSKYL  259
            L+KYL
Sbjct  549  LNKYL  553



>emb|CAD79585.1| cytosolic phosphoglucose isomerase, partial [Megacorax gracielanus]
Length=166

 Score =   263 bits (672),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  31   IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  90

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  91   DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  150

Query  450  LAIYEHRVAVQGFIWG  403
            LAIYEHRVAVQGFIWG
Sbjct  151  LAIYEHRVAVQGFIWG  166



>gb|KIZ06944.1| glucose-6-phosphate isomerase [Monoraphidium neglectum]
Length=580

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 163/203 (80%), Gaps = 4/203 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG PLP+E GEIDFGEPGTNGQHSFYQLIHQGR+IPCDFIG+V+SQQ VYLK E+VSNH
Sbjct  365  IDGKPLPFEAGEIDFGEPGTNGQHSFYQLIHQGRIIPCDFIGIVRSQQSVYLKNEIVSNH  424

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELM NFFAQ DALAYGK+  EL+ +NVP  LV H+ F+GNRPSLS+LLP LNAY +GQL
Sbjct  425  DELMCNFFAQADALAYGKSGTELRSQNVPDFLVPHRVFTGNRPSLSLLLPELNAYTVGQL  484

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTK  280
            L++YEH+VAVQGF+W INSFDQWGVELGK LA++VR ++N +R     I   +GFN+ST 
Sbjct  485  LSLYEHQVAVQGFVWNINSFDQWGVELGKVLASKVRTKINEARNNNRFIAGSDGFNYSTT  544

Query  279  TLLSKYLEASSDIP-ADPPTALP  214
             +++KYL     +  ADP    P
Sbjct  545  RMINKYLAGKEQLLYADPRDVFP  567



>gb|ETP26016.1| hypothetical protein F441_01181 [Phytophthora parasitica CJ01A1]
Length=556

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+AY  GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAYTTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QLNASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLNASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ETK96016.1| hypothetical protein L915_01139 [Phytophthora parasitica]
Length=556

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+AY  GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAYTTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QLNASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLNASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>ref|XP_008890866.1| hypothetical protein PPTG_01022 [Phytophthora parasitica INRA-310]
 gb|ETI56214.1| hypothetical protein F443_01209 [Phytophthora parasitica P1569]
 gb|ETL49396.1| hypothetical protein L916_01121 [Phytophthora parasitica]
 gb|ETM02446.1| hypothetical protein L917_01091 [Phytophthora parasitica]
 gb|ETM55689.1| hypothetical protein L914_01128 [Phytophthora parasitica]
 gb|ETN24837.1| hypothetical protein PPTG_01022 [Phytophthora parasitica INRA-310]
 gb|ETO84955.1| hypothetical protein F444_01204 [Phytophthora parasitica P1976]
Length=556

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+AY  GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAYTTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QLNASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLNASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ETP54025.1| hypothetical protein F442_01139 [Phytophthora parasitica P10297]
Length=556

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+AY  GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAYTTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QLNASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLNASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>ref|XP_009523844.1| glucose-6-phosphate isomerase [Phytophthora sojae]
 gb|EGZ21127.1| glucose-6-phosphate isomerase [Phytophthora sojae]
Length=556

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GEI+FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEINFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP++L +HK F GNRPS+S+L   L+AY+ GQL
Sbjct  429  DELMSNFFAQPDALARGKSLEDLKAEGVPENLRNHKLFPGNRPSVSLLFKKLDAYSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QLN SR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGSIWGINSFDQWGVELGKVLAKQVRAQLNVSRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>emb|CAD79577.1| cytosolic phosphoglucose isomerase, partial [Hauya heydeana]
Length=136

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  3    IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  62

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKEN PQHL+ HKTF+GNRPSLSILLPSL+AY IGQL
Sbjct  63   DELMSNFFAQPDALAYGKTPEQLQKENAPQHLIPHKTFTGNRPSLSILLPSLDAYRIGQL  122

Query  450  LAIYEHRVAVQGFI  409
            LAIYEHRVAVQGFI
Sbjct  123  LAIYEHRVAVQGFI  136



>gb|AAP51074.1| glucose-6-phosphate isomerase [Phytophthora cactorum]
Length=556

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G+ +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGLCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>ref|XP_005713157.1| glucose-6-phosphate isomerase [Chondrus crispus]
 emb|CDF33354.1| glucose-6-phosphate isomerase [Chondrus crispus]
Length=553

 Score =   273 bits (698),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG  L  E G I+FGEPGTNGQHSFYQLIHQGRV+PCDF+ V+KSQ PV L GE VSNH
Sbjct  368  LDGSELNMEAGPINFGEPGTNGQHSFYQLIHQGRVVPCDFVAVIKSQVPVSLPGEPVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA+GK+ E+ + E + + LV HKTF GNRPS S+L+  LNA+ +GQL
Sbjct  428  DELMSNFFAQPDALAFGKSAEQCRVEGIREELVPHKTFPGNRPSSSMLIDELNAFTVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA++EHR  V+GFIWGINSFDQWGVELGK LA  VR QL ASR  G  + GFN ST  LL
Sbjct  488  LALFEHRTVVEGFIWGINSFDQWGVELGKVLAKDVRTQLTASRSDGADVSGFNPSTTMLL  547

Query  270  SKYL  259
             KYL
Sbjct  548  KKYL  551



>ref|XP_002967787.1| hypothetical protein SELMODRAFT_409075 [Selaginella moellendorffii]
 gb|EFJ31134.1| hypothetical protein SELMODRAFT_409075 [Selaginella moellendorffii]
Length=1477

 Score =   285 bits (728),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 164/206 (80%), Gaps = 21/206 (10%)
 Frame = -1

Query  810   IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
             IDG PLPYETGEIDFGEPGTNGQHSFYQLIHQGR+IPCDF+G++KSQQP+YL GE VSNH
Sbjct  1271  IDGTPLPYETGEIDFGEPGTNGQHSFYQLIHQGRIIPCDFVGIIKSQQPMYLSGEPVSNH  1330

Query  630   DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
             DELM NFFAQ DALAYGKT +EL+ E VP  LV HKTF+GNRPSLS+LLP+L  Y IGQL
Sbjct  1331  DELMCNFFAQADALAYGKTPDELRAEGVPDSLVPHKTFTGNRPSLSLLLPNLTPYTIGQL  1390

Query  450   LAIYEHRVAVQGFIWGINSFDQWGVELGK---------------------SLATQVRKQL  334
             LAIYEHR+AVQGFIWGINSFDQWGVELGK                     SLA +VR Q+
Sbjct  1391  LAIYEHRIAVQGFIWGINSFDQWGVELGKVILSPNSSITLSLTSAPSKNQSLAGKVRNQM  1450

Query  333   NASRKKGESIEGFNFSTKTLLSKYLE  256
             +  R KG+ +EGFN+ST TLL++YL+
Sbjct  1451  HLWRTKGKVVEGFNYSTTTLLNRYLK  1476



>gb|AAP51066.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51076.1| glucose-6-phosphate isomerase [Phytophthora erythroseptica]
Length=556

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51065.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51075.1| glucose-6-phosphate isomerase [Phytophthora erythroseptica]
Length=556

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLRAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ABH11442.1| cytosolic glucose-6-phosphate isomerase [Chondrus crispus]
Length=553

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG  L  E G I+FGEPGTNGQHSFYQLIHQGR++PCDF+ V+KSQ PV L GE VSNH
Sbjct  368  LDGSELNMEAGPINFGEPGTNGQHSFYQLIHQGRLVPCDFVAVIKSQVPVSLPGEPVSNH  427

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA+GK+ E+ + E + + LV HKTF GNRPS S+L+  LNA+ +GQL
Sbjct  428  DELMSNFFAQPDALAFGKSAEQCRVEGIREELVPHKTFRGNRPSSSMLIDELNAFTVGQL  487

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA++EHR  V+GFIWGINSFDQWGVELGK LA  VR QL ASR  G  + GFN ST  LL
Sbjct  488  LALFEHRTVVEGFIWGINSFDQWGVELGKVLAKDVRTQLTASRSDGADVSGFNPSTTMLL  547

Query  270  SKYL  259
             KYL
Sbjct  548  KKYL  551



>gb|AAP51072.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51069.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51080.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ACB69780.1| phosphoglucose isomerase [Poa nemoralis]
Length=430

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  282  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  341

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  342  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  401

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AVQGFIWGINSFDQWGVELGK
Sbjct  402  LAIYEHRIAVQGFIWGINSFDQWGVELGK  430



>ref|XP_002908462.1| glucose-6-phosphate isomerase [Phytophthora infestans T30-4]
 gb|AAM28239.1| glucose 6-phosphate isomerase [Phytophthora infestans]
 gb|AAP51064.1| glucose-6-phosphate isomerase [Phytophthora infestans]
 gb|AAP51078.1| glucose-6-phosphate isomerase [Phytophthora infestans]
 gb|EEY61545.1| glucose-6-phosphate isomerase [Phytophthora infestans T30-4]
Length=556

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51068.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ACB69781.1| phosphoglucose isomerase, partial [Poa nemoralis]
Length=430

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  282  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  341

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  342  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  401

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AVQGFIWGINSFDQWGVELGK
Sbjct  402  LAIYEHRIAVQGFIWGINSFDQWGVELGK  430



>gb|AAP51063.1| glucose-6-phosphate isomerase [Phytophthora mirabilis]
Length=556

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51071.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKELDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ACB69779.1| phosphoglucose isomerase [Poa chaixii]
Length=433

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  285  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  344

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  345  DELMSNFFAQPDALAYGKTPEQLRNENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  404

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AVQGFIWGINSFDQWGVELGK
Sbjct  405  LAIYEHRIAVQGFIWGINSFDQWGVELGK  433



>gb|ACB69786.1| phosphoglucose isomerase, partial [Poa palustris]
Length=438

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  290  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  349

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  350  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  409

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AVQGFIWGINSFDQWGVELGK
Sbjct  410  LAIYEHRIAVQGFIWGINSFDQWGVELGK  438



>gb|ACB69788.1| phosphoglucose isomerase [Poa pratensis]
Length=435

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  287  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  346

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  347  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  406

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AVQGFIWGINSFDQWGVELGK
Sbjct  407  LAIYEHRIAVQGFIWGINSFDQWGVELGK  435



>gb|AAP51067.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQL+HQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLVHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51062.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQPGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSTTTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|AAP51061.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+A R +   +EGFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSAPRTENAPVEGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ACB69787.1| phosphoglucose isomerase, partial [Poa palustris]
Length=438

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  290  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  349

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  350  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  409

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AVQGFIWGINSFDQWGVELGK
Sbjct  410  LAIYEHRIAVQGFIWGINSFDQWGVELGK  438



>emb|CAC84504.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=150

 Score =   258 bits (660),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 139/150 (93%), Gaps = 1/150 (1%)
 Frame = -1

Query  654  KGEVVSNHDELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSL  475
            KGEVV+NHDELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L
Sbjct  1    KGEVVNNHDELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPTL  60

Query  474  NAYNIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI-EG  298
            +AY IGQLL IYEHRVAVQGF+WGINSFDQWGVELGKSLATQVRKQL+ASR KGE + EG
Sbjct  61   DAYRIGQLLGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEG  120

Query  297  FNFSTKTLLSKYLEASSDIPADPPTALPKI  208
            FNFSTKTLL++YL+A+SD+PADP T LP I
Sbjct  121  FNFSTKTLLTRYLQATSDVPADPSTLLPNI  150



>emb|CCA13931.1| unnamed protein product [Albugo laibachii Nc14]
Length=555

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++G+ LP+ TGEI+FGEPGTNGQHSFYQLIHQGR++PCDFIG  +SQ+P+    E VSNH
Sbjct  370  VEGIDLPFCTGEINFGEPGTNGQHSFYQLIHQGRIVPCDFIGFTESQKPIAHADEAVSNH  429

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGK+  EL+KE VP+ L  H+ F GNRPSLS+L   L+ ++ GQL
Sbjct  430  DELMSNFFAQPDALAYGKSISELEKEGVPKALQPHRYFPGNRPSLSLLFEKLDPFSCGQL  489

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL  SRK    IEGFN ST  LL
Sbjct  490  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRNQLEGSRKHQAKIEGFNPSTSYLL  549

Query  270  SKYL  259
            ++YL
Sbjct  550  NRYL  553



>emb|CAD79578.1| cytosolic phosphoglucose isomerase, partial [Ludwigia peploides]
Length=381

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGEVV+NH
Sbjct  248  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMKSQQPVYLKGEVVNNH  307

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENVP+HLV HKTF+GNRPSLSILLPSLNAYN+GQL
Sbjct  308  DELMSNFFAQPDALAYGKTPEQLRKENVPEHLVPHKTFTGNRPSLSILLPSLNAYNVGQL  367

Query  450  LAIYEHRVAVQGFI  409
            LAIYEHRVAVQGFI
Sbjct  368  LAIYEHRVAVQGFI  381



>gb|AAP51060.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA Q R QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQARAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ACB69784.1| phosphoglucose isomerase [Poa pratensis]
Length=435

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG++KSQQPVYLKGE VSNH
Sbjct  287  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGLIKSQQPVYLKGETVSNH  346

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ ENV ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  347  DELMSNFFAQPDALAYGKTPEQLRSENVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  406

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AVQGFIWGINSFDQWGVELGK
Sbjct  407  LAIYEHRIAVQGFIWGINSFDQWGVELGK  435



>gb|AAP51079.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   270 bits (691),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR  L+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAHLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>emb|CCI49830.1| unnamed protein product [Albugo candida]
Length=501

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++G  LP+ TGE++FGEPGTNGQHSFYQLIHQGR++PCDFIG  +SQ+P+    E VSNH
Sbjct  316  VEGFDLPFSTGEVNFGEPGTNGQHSFYQLIHQGRIVPCDFIGFSESQKPIVQDDEPVSNH  375

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT +EL+ E VP+ L  H+ F GNRPS S+L   L+ ++ GQL
Sbjct  376  DELMSNFFAQPDALAYGKTIKELENEGVPKALQPHRYFPGNRPSTSLLFEKLDPFSCGQL  435

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL  SRKK   +EGFN ST  L+
Sbjct  436  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRNQLEQSRKKHAKVEGFNPSTSYLM  495

Query  270  SKYL  259
            SKYL
Sbjct  496  SKYL  499



>emb|CAD79587.1| cytosolic phosphoglucose isomerase, partial [Hauya elegans]
Length=371

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+ETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVV+SQQPVYLKGEVV+NH
Sbjct  238  IDGLPLPFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVRSQQPVYLKGEVVNNH  297

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQKENVPQHL+ HKTF+GNRPSLSILLPSL+AY IGQL
Sbjct  298  DELMSNFFAQPDALAYGKTPEQLQKENVPQHLIPHKTFTGNRPSLSILLPSLDAYRIGQL  357

Query  450  LAIYEHRVAVQGFI  409
            LAIYEHRVAVQGFI
Sbjct  358  LAIYEHRVAVQGFI  371



>gb|ACB69777.1| phosphoglucose isomerase [Poa pratensis subsp. angustifolia]
Length=439

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGVPLPYE GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGE VSNH
Sbjct  291  IDGVPLPYEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQPVYLKGETVSNH  350

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+ E V ++L+ HKTF GNRPSLS LL SL+AY IGQL
Sbjct  351  DELMSNFFAQPDALAYGKTPEQLRSEKVSENLIPHKTFKGNRPSLSFLLSSLSAYEIGQL  410

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGK  364
            LAIYEHR+AVQGFIWGINSFDQWGVELGK
Sbjct  411  LAIYEHRIAVQGFIWGINSFDQWGVELGK  439



>emb|CAD79574.1| cytosolic phosphoglucose isomerase, partial [Fuchsia cylindracea]
Length=136

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVV+NH
Sbjct  3    IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVNNH  62

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLPSL+AY IGQL
Sbjct  63   DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPSLDAYRIGQL  122

Query  450  LAIYEHRVAVQGFI  409
            LAIYEHRVAVQGFI
Sbjct  123  LAIYEHRVAVQGFI  136



>ref|XP_008611761.1| glucose-6-phosphate isomerase, cytosolic 2 [Saprolegnia diclina 
VS20]
 gb|EQC34889.1| glucose-6-phosphate isomerase, cytosolic 2 [Saprolegnia diclina 
VS20]
Length=555

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 146/186 (78%), Gaps = 2/186 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG  LP+  GEI+FGEPGTNGQHSFYQLIHQGRV+PCDFI   KSQ P +L GE VSNH
Sbjct  369  LDGSVLPFAAGEINFGEPGTNGQHSFYQLIHQGRVVPCDFIAFCKSQTPTHLSGEKVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILL-PSLNAYNIGQ  454
            DELMSNFFAQPDALA GKT EEL  E VP+ L  HK F GNRPS+S+L   SL+A+  GQ
Sbjct  429  DELMSNFFAQPDALANGKTVEELAAEGVPEALRPHKAFPGNRPSVSLLFHGSLDAFACGQ  488

Query  453  LLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGES-IEGFNFSTKT  277
            LLA+YEHR  VQG IWG+NSFDQWGVELGK LATQVR QL+ASR    + ++GFN ST  
Sbjct  489  LLALYEHRTVVQGAIWGLNSFDQWGVELGKVLATQVRNQLSASRTNAAAPLQGFNSSTSA  548

Query  276  LLSKYL  259
            LL +YL
Sbjct  549  LLKRYL  554



>ref|XP_009825599.1| hypothetical protein H257_03289 [Aphanomyces astaci]
 gb|ETV85581.1| hypothetical protein H257_03289 [Aphanomyces astaci]
Length=556

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 148/186 (80%), Gaps = 4/186 (2%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            + GV LP++ GEI+FGEPGTNGQHSFYQLIHQGRV+PCDFIG  KSQ PV L GE VSNH
Sbjct  371  LAGVELPFQAGEINFGEPGTNGQHSFYQLIHQGRVVPCDFIGFCKSQTPVELAGEAVSNH  430

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPS-LNAYNIGQ  454
            DELMSNFFAQPDALA GK+ +EL   NVP  L  HK F GNRPS+S+L    L A++ GQ
Sbjct  431  DELMSNFFAQPDALANGKSIDELT--NVPDALKPHKAFPGNRPSVSLLFEGHLTAFSCGQ  488

Query  453  LLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRK-KGESIEGFNFSTKT  277
            LLA+YEHR  VQG +WGINSFDQWGVELGK LATQVR QL+ASRK K  S++GFN +T T
Sbjct  489  LLALYEHRTVVQGAVWGINSFDQWGVELGKVLATQVRNQLSASRKNKATSVDGFNSATAT  548

Query  276  LLSKYL  259
            LL  YL
Sbjct  549  LLQTYL  554



>gb|AAP51070.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+ + E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDPKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>emb|CCI49829.1| unnamed protein product [Albugo candida]
Length=555

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++G  LP+ TGE++FGEPGTNGQHSFYQLIHQGR++PCDFIG  +SQ+P+    E VSNH
Sbjct  370  VEGFDLPFSTGEVNFGEPGTNGQHSFYQLIHQGRIVPCDFIGFSESQKPIVQDDEPVSNH  429

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT +EL+ E VP+ L  H+ F GNRPS S+L   L+ ++ GQL
Sbjct  430  DELMSNFFAQPDALAYGKTIKELENEGVPKALQPHRYFPGNRPSTSLLFEKLDPFSCGQL  489

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL  SRKK   +EGFN ST  L+
Sbjct  490  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRNQLEQSRKKHAKVEGFNPSTSYLM  549

Query  270  SKYL  259
            SKYL
Sbjct  550  SKYL  553



>emb|CAD79584.1| cytosolic phosphoglucose isomerase, partial [Epilobium brachycarpum]
Length=373

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQP+YLKGEVV+NH
Sbjct  238  IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPIYLKGEVVNNH  297

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLP+L+AY IGQL
Sbjct  298  DELMSNFFAQPDALAYGKTPEQLKKENVAEHLIPHKTFTGNRPSLSILLPTLDAYRIGQL  357

Query  450  LAIYEHRVAVQGFIWG  403
            LAIYEHRVAVQGFIWG
Sbjct  358  LAIYEHRVAVQGFIWG  373



>gb|AAP51077.1| glucose-6-phosphate isomerase [Phytophthora erythroseptica]
Length=556

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHS YQLIHQGRV+PCDF+G  +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSSYQLIHQGRVVPCDFLGFCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ GQL
Sbjct  429  DELMSNFFAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGQL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>emb|CAD79571.1| cytosolic phosphoglucose isomerase, partial [Circaea cordata]
Length=136

 Score =   255 bits (651),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDG+PLP+E+GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGV+KSQQPVYLKGEVV+NH
Sbjct  3    IDGLPLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVMKSQQPVYLKGEVVNNH  62

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+L+KENV +HL+ HKTF+GNRPSLSILLPSL+AY IGQL
Sbjct  63   DELMSNFFAQPDALAYGKTPEQLKKENVSEHLIPHKTFTGNRPSLSILLPSLDAYRIGQL  122

Query  450  LAIYEHRVAVQGFI  409
            LAIYEHRVAVQGFI
Sbjct  123  LAIYEHRVAVQGFI  136



>gb|KDO30887.1| glucose-6-phosphate isomerase [Saprolegnia parasitica CBS 223.65]
Length=555

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 146/186 (78%), Gaps = 2/186 (1%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            +DG  LP+  GEI+FGEPGTNGQHSFYQLIHQGRV+PCDFI   KSQ P +L GE VSNH
Sbjct  369  LDGSVLPFAAGEINFGEPGTNGQHSFYQLIHQGRVVPCDFIAFCKSQNPTHLSGEKVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILL-PSLNAYNIGQ  454
            DELMSNFFAQPDALA GKT EEL  E VP+ L  HK F GNRPS+S+L   +L+A+  GQ
Sbjct  429  DELMSNFFAQPDALANGKTVEELAAEGVPEALRPHKAFPGNRPSVSLLFHGTLDAFACGQ  488

Query  453  LLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGES-IEGFNFSTKT  277
            LLA+YEHR  VQG IWG+NSFDQWGVELGK LATQVR QL+ASR    + ++GFN ST  
Sbjct  489  LLALYEHRTVVQGAIWGLNSFDQWGVELGKVLATQVRNQLSASRANASAPLQGFNSSTSA  548

Query  276  LLSKYL  259
            LL +YL
Sbjct  549  LLKRYL  554



>gb|AAP51073.1| glucose-6-phosphate isomerase [Phytophthora cactorum]
Length=556

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            ++GV LP++ GE++FGEPGTNGQHSFYQLIHQGRV+PCDF+G+ +SQ PV L GE VSNH
Sbjct  369  VEGVDLPFQAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFLGLCESQNPVQLAGEPVSNH  428

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNF AQPDALA GK+ E+L+ E VP+ L +HK F GNRPS+S+L   L+A++ G+L
Sbjct  429  DELMSNFSAQPDALARGKSIEDLKAEGVPEKLQNHKLFPGNRPSISLLFKKLDAFSTGRL  488

Query  450  LAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESIEGFNFSTKTLL  271
            LA+YEHR  VQG IWGINSFDQWGVELGK LA QVR QL+ASR +   ++GFN +T ++L
Sbjct  489  LALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTENAPVKGFNSATTSML  548

Query  270  SKYL  259
              YL
Sbjct  549  EAYL  552



>gb|ACR55850.1| cytosolic phosphoglucose isomerase, partial [Achillea aspleniifolia]
 gb|ACR55851.1| cytosolic phosphoglucose isomerase, partial [Achillea aspleniifolia]
 gb|ACR55852.1| cytosolic phosphoglucose isomerase, partial [Achillea aspleniifolia]
 gb|ACR55853.1| cytosolic phosphoglucose isomerase, partial [Achillea aspleniifolia]
 gb|ACR55854.1| cytosolic phosphoglucose isomerase, partial [Achillea aspleniifolia]
 gb|ACR55855.1| cytosolic phosphoglucose isomerase, partial [Achillea aspleniifolia]
 gb|ACR55857.1| cytosolic phosphoglucose isomerase, partial [Achillea asplenifolia 
x Achillea collina]
 gb|ACR55858.1| cytosolic phosphoglucose isomerase, partial [Achillea asplenifolia 
x Achillea collina]
 gb|ACR55859.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55860.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55861.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55862.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55863.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55864.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55865.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55866.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55867.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55868.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55869.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55870.1| cytosolic phosphoglucose isomerase, partial [Achillea collina]
 gb|ACR55871.1| cytosolic phosphoglucose isomerase, partial [Achillea asplenifolia 
x Achillea collina]
 gb|ACR55872.1| cytosolic phosphoglucose isomerase, partial [Achillea asplenifolia 
x Achillea collina]
 gb|ACR55873.1| cytosolic phosphoglucose isomerase, partial [Achillea asplenifolia 
x Achillea collina]
 gb|ACR55874.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea 
x Achillea collina]
 gb|ACR55875.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea]
 gb|ACR55877.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea]
 gb|ACR55878.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea]
 gb|ACR55879.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea]
 gb|ACR55880.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea]
 gb|ACR55881.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea]
 gb|ACR55882.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea 
x Achillea collina]
 gb|ACR55883.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea]
 gb|ACR55884.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea]
 gb|ACR55885.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea 
x Achillea collina]
 gb|ACR55886.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea 
x Achillea collina]
 gb|ACR55887.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea 
x Achillea collina]
 gb|ACR55888.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea 
x Achillea collina]
 gb|ACR55889.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea 
x Achillea collina]
 gb|ACR55890.1| cytosolic phosphoglucose isomerase, partial [Achillea setacea 
x Achillea collina]
Length=239

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  810  IDGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNH  631
            IDGV LP+E GEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIG+VKSQQPVYL+ EVV+NH
Sbjct  101  IDGVRLPFEAGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGIVKSQQPVYLRDEVVNNH  160

Query  630  DELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQL  451
            DELMSNFFAQPDALAYGKT E+LQ ENV  HLV HKTF+GNRPSLSILLPSL+AY IGQL
Sbjct  161  DELMSNFFAQPDALAYGKTPEQLQSENVASHLVPHKTFNGNRPSLSILLPSLDAYRIGQL  220

Query  450  LAIYEHRVAVQGFIWGINS  394
            LAIYEHR+AV+GF+WGINS
Sbjct  221  LAIYEHRIAVEGFVWGINS  239



>ref|XP_005851258.1| hypothetical protein CHLNCDRAFT_138008 [Chlorella variabilis]
 gb|EFN59156.1| hypothetical protein CHLNCDRAFT_138008 [Chlorella variabilis]
Length=521

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 150/201 (75%), Gaps = 3/201 (1%)
 Frame = -1

Query  807  DGVPLPYETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLKGEVVSNHD  628
            D +P       IDFGEPGTNGQHSFYQLIHQGR IP +FI VV+SQQ VYL GE VS+H+
Sbjct  316  DNLPALLGLLNIDFGEPGTNGQHSFYQLIHQGRTIPAEFIAVVRSQQDVYLGGEKVSSHE  375

Query  627  ELMSNFFAQPDALAYGKTQEELQKENVPQHLVSHKTFSGNRPSLSILLPSLNAYNIGQLL  448
            ELM NFFAQPDALA GK    L+ E VP+HLV HKTF+GNRPSLSILLP LNAY +GQLL
Sbjct  376  ELMCNFFAQPDALACGKDSGTLRAEGVPEHLVPHKTFTGNRPSLSILLPELNAYTLGQLL  435

Query  447  AIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLNASRKKGESI---EGFNFSTKT  277
            ++YEHRVA  GF+WGINSFDQWGVELGK LA +VR ++  +R  G  +   +GFN ST  
Sbjct  436  SMYEHRVATSGFVWGINSFDQWGVELGKVLANKVRSKVQEARSAGRQVSKADGFNASTVR  495

Query  276  LLSKYLEASSDIPADPPTALP  214
            LL+++LEA +  PA      P
Sbjct  496  LLNRFLEAKTQPPAQGKHTFP  516



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1697011271292