BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5524

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591201.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    251   2e-76   Nicotiana tomentosiformis
ref|XP_009588089.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...    251   2e-76   Nicotiana tomentosiformis
ref|XP_004242803.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    251   3e-76   Solanum lycopersicum
ref|XP_009760674.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    251   5e-76   Nicotiana sylvestris
ref|XP_006362449.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    246   2e-74   Solanum tuberosum [potatoes]
ref|XP_010110726.1|  Tyrosine--tRNA ligase                              245   2e-74   Morus notabilis
ref|XP_002265238.2|  PREDICTED: probable tyrosine--tRNA ligase, m...    245   2e-74   Vitis vinifera
ref|XP_012067411.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    241   2e-72   Jatropha curcas
emb|CDP19091.1|  unnamed protein product                                240   7e-72   Coffea canephora [robusta coffee]
ref|XP_006375482.1|  hypothetical protein POPTR_0014s13650g             233   1e-71   
ref|XP_004146892.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    238   2e-71   Cucumis sativus [cucumbers]
ref|XP_007022036.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...    238   2e-71   
ref|XP_008453844.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    236   7e-71   
gb|KCW55733.1|  hypothetical protein EUGRSUZ_I01565                     235   2e-70   Eucalyptus grandis [rose gum]
ref|XP_003544330.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    234   4e-70   Glycine max [soybeans]
gb|KHN08832.1|  Tyrosine--tRNA ligase                                   234   4e-70   Glycine soja [wild soybean]
ref|XP_002512791.1|  tyrosyl-tRNA synthetase, putative                  234   6e-70   
gb|KEH32330.1|  tyrosyl-tRNA synthetase                                 234   7e-70   Medicago truncatula
ref|XP_010028900.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    234   7e-70   Eucalyptus grandis [rose gum]
ref|XP_004500343.1|  PREDICTED: tyrosine--tRNA ligase-like              234   9e-70   Cicer arietinum [garbanzo]
ref|XP_004303944.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    233   1e-69   Fragaria vesca subsp. vesca
ref|XP_011033705.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    233   2e-69   Populus euphratica
gb|KHN40972.1|  Tyrosine--tRNA ligase                                   226   2e-69   Glycine soja [wild soybean]
ref|XP_010683748.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    231   7e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008218548.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    230   1e-68   Prunus mume [ume]
gb|EMT07165.1|  Tyrosyl-tRNA synthetase                                 231   1e-68   
ref|XP_007222608.1|  hypothetical protein PRUPE_ppa004925mg             230   2e-68   Prunus persica
ref|XP_003519285.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    230   2e-68   Glycine max [soybeans]
ref|XP_006645923.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    229   2e-68   
ref|XP_006468947.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    230   3e-68   Citrus sinensis [apfelsine]
dbj|BAK00149.1|  predicted protein                                      230   3e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO63480.1|  hypothetical protein CISIN_1g037749mg                   229   3e-68   Citrus sinensis [apfelsine]
gb|KEH34424.1|  tyrosyl-tRNA synthetase                                 229   4e-68   Medicago truncatula
gb|KJB12925.1|  hypothetical protein B456_002G045400                    229   4e-68   Gossypium raimondii
ref|XP_010927782.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    230   5e-68   Elaeis guineensis
ref|XP_010276894.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    230   5e-68   Nelumbo nucifera [Indian lotus]
ref|XP_008801775.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    230   5e-68   Phoenix dactylifera
ref|XP_007022035.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...    228   7e-68   
ref|XP_006446866.1|  hypothetical protein CICLE_v10015023mg             228   2e-67   Citrus clementina [clementine]
ref|XP_003574045.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    228   3e-67   Brachypodium distachyon [annual false brome]
ref|XP_007022034.1|  Tyrosyl-tRNA synthetase isoform 1                  228   4e-67   
gb|EMS54027.1|  Tyrosyl-tRNA synthetase                                 232   6e-67   Triticum urartu
ref|NP_001043131.1|  Os01g0500900                                       226   9e-67   
ref|XP_008339494.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    225   2e-66   
ref|XP_008339493.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    224   2e-66   
ref|XP_011071261.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    225   2e-66   
ref|NP_001141566.1|  hypothetical protein                               224   3e-66   Zea mays [maize]
gb|EAZ12037.1|  hypothetical protein OsJ_01916                          225   5e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008783116.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    225   5e-66   Phoenix dactylifera
ref|XP_010500171.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    224   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_008361702.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    223   7e-66   
ref|XP_004982893.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    223   7e-66   Setaria italica
ref|XP_009355255.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    223   8e-66   Pyrus x bretschneideri [bai li]
ref|XP_004299915.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    223   8e-66   Fragaria vesca subsp. vesca
ref|XP_009355254.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    223   9e-66   Pyrus x bretschneideri [bai li]
ref|XP_010500039.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    223   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_002884331.1|  tRNA synthetase class I family protein             223   1e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_008347911.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    223   1e-65   
ref|XP_009348746.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    222   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_002447960.1|  hypothetical protein SORBIDRAFT_06g018870          223   2e-65   
ref|XP_009348745.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    222   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_010463686.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    222   4e-65   Camelina sativa [gold-of-pleasure]
emb|CAN64191.1|  hypothetical protein VITISV_016956                     227   5e-65   Vitis vinifera
ref|XP_009414004.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    222   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_186915.1|  tyrosyl-tRNA synthetase                               220   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485586.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    220   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006297370.1|  hypothetical protein CARUB_v10013389mg             220   3e-64   
ref|XP_006408394.1|  hypothetical protein EUTSA_v10020578mg             219   4e-64   Eutrema salsugineum [saltwater cress]
gb|EYU42284.1|  hypothetical protein MIMGU_mgv1a005712mg                218   4e-64   Erythranthe guttata [common monkey flower]
ref|XP_010549888.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    219   5e-64   Tarenaya hassleriana [spider flower]
ref|XP_007142062.1|  hypothetical protein PHAVU_008G249300g             218   7e-64   Phaseolus vulgaris [French bean]
gb|EYU24457.1|  hypothetical protein MIMGU_mgv1a005745mg                216   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_009134705.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    217   3e-63   Brassica rapa
emb|CDX74240.1|  BnaA03g28070D                                          217   3e-63   
ref|XP_009134703.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    217   3e-63   Brassica rapa
gb|EPS58486.1|  hypothetical protein M569_16327                         214   8e-63   Genlisea aurea
ref|XP_009118453.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    215   1e-62   Brassica rapa
ref|XP_006826574.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    201   2e-57   Amborella trichopoda
ref|XP_002992920.1|  hypothetical protein SELMODRAFT_136175             183   7e-51   
ref|XP_002980036.1|  hypothetical protein SELMODRAFT_111886             183   9e-51   Selaginella moellendorffii
ref|XP_002955541.1|  hypothetical protein VOLCADRAFT_83275              176   1e-47   Volvox carteri f. nagariensis
ref|XP_001699082.1|  hypothetical protein CHLREDRAFT_139405             175   1e-47   Chlamydomonas reinhardtii
ref|XP_005848281.1|  hypothetical protein CHLNCDRAFT_48743              173   3e-47   Chlorella variabilis
ref|XP_003059850.1|  predicted protein                                  169   8e-46   Micromonas pusilla CCMP1545
ref|XP_002504529.1|  predicted protein                                  170   1e-45   Micromonas commoda
ref|XP_001751567.1|  predicted protein                                  165   7e-44   
ref|XP_005650588.1|  tyrosyl-tRNA synthetase                            164   8e-44   Coccomyxa subellipsoidea C-169
gb|KIZ02509.1|  tyrosyl-tRNA synthetase                                 145   1e-39   Monoraphidium neglectum
ref|XP_001416448.1|  Tyrosyl-tRNA synthetase, probable                  152   4e-39   Ostreococcus lucimarinus CCE9901
ref|XP_010229641.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...    148   1e-37   
ref|XP_003075033.1|  TyrS Tyrosyl-tRNA synthetase, probable (IC)        143   6e-36   Ostreococcus tauri
emb|CBI22389.3|  unnamed protein product                                139   8e-35   Vitis vinifera
ref|WP_032125960.1|  tyrosyl-tRNA synthetase                            138   2e-34   Candidatus Protochlamydia massiliensis
ref|WP_042103652.1|  tyrosyl-tRNA synthetase                            137   5e-34   Parachlamydiaceae bacterium HS-T3
ref|WP_013182397.1|  tyrosyl-tRNA synthetase                            135   2e-33   Waddlia chondrophila
ref|WP_042279297.1|  tyrosyl-tRNA synthetase                            135   3e-33   Candidatus Protochlamydia sp. R18
ref|WP_039359281.1|  tyrosyl-tRNA synthetase                            135   3e-33   Candidatus Protochlamydia amoebophila
ref|WP_011175719.1|  tyrosine--tRNA ligase                              135   3e-33   Candidatus Protochlamydia amoebophila
gb|KIC71389.1|  Tyrosine--tRNA ligase                                   134   5e-33   Candidatus Protochlamydia amoebophila
emb|CDZ80947.1|  Tyrosine--tRNA ligase                                  132   3e-32   Candidatus Rubidus massiliensis
ref|WP_006340872.1|  tyrosyl-tRNA synthetase                            132   4e-32   Parachlamydia acanthamoebae
ref|WP_039384881.1|  tyrosyl-tRNA synthetase                            130   2e-31   Neochlamydia sp. TUME1
ref|WP_042240888.1|  tyrosyl-tRNA synthetase                            129   3e-31   Neochlamydia sp. S13
ref|WP_044882238.1|  tyrosyl-tRNA synthetase                            129   5e-31   Neochlamydia sp. EPS4
gb|AFG55783.1|  hypothetical protein 0_14069_01                         121   3e-30   Pinus taeda
gb|AFG55790.1|  hypothetical protein 0_14069_01                         120   5e-30   Pinus taeda
gb|AEW07904.1|  hypothetical protein 0_14069_01                         120   9e-30   Pinus radiata
ref|XP_005713019.1|  tyrosine--tRNA ligase, mitochondrial or chlo...    123   6e-29   Chondrus crispus [carageen]
gb|AFG55784.1|  hypothetical protein 0_14069_01                         116   2e-28   Pinus taeda
ref|WP_039376683.1|  tyrosyl-tRNA synthetase                            121   3e-28   
ref|WP_013943141.1|  tyrosyl-tRNA synthetase                            117   7e-27   Simkania negevensis
ref|WP_041017153.1|  tyrosyl-tRNA synthetase                            117   7e-27   Criblamydia sequanensis
ref|XP_007509051.1|  tyrosyl-tRNA synthetase                            113   2e-25   Bathycoccus prasinos
ref|XP_005538192.1|  tyrosine--tRNA ligase, mitochondrial or chlo...    113   3e-25   Cyanidioschyzon merolae strain 10D
ref|XP_005707106.1|  tyrosyl-tRNA synthetase                            107   2e-23   Galdieria sulphuraria
gb|ENO19082.1|  tyrosine--tRNA ligase                                   100   6e-21   Actinomyces cardiffensis F0333
ref|WP_040313631.1|  tyrosyl-tRNA synthetase                            100   6e-21   Actinomyces cardiffensis
ref|XP_011397334.1|  Tyrosine-tRNA ligase                             97.4    1e-19   Auxenochlorella protothecoides
ref|WP_022848286.1|  tyrosyl-tRNA synthetase                          96.3    2e-19   Anaerolineaceae bacterium oral taxon 439
ref|WP_022864835.1|  tyrosyl-tRNA synthetase                          95.9    2e-19   Varibaculum cambriense
ref|WP_024058184.1|  tyrosyl-tRNA synthetase                          93.2    1e-18   Varibaculum cambriense
ref|WP_016445042.1|  tyrosyl-tRNA synthetase                          91.7    5e-18   Actinomyces europaeus
ref|WP_034510938.1|  tyrosyl-tRNA synthetase                          91.7    6e-18   Actinomyces sp. S4-C9
ref|WP_024332044.1|  tyrosyl-tRNA synthetase                          89.7    3e-17   
ref|WP_028851238.1|  tyrosyl-tRNA synthetase                          88.6    7e-17   Thermocrispum municipale
ref|WP_007324558.1|  tyrosyl-tRNA synthetase                          88.6    8e-17   Rhodopirellula baltica
ref|WP_017176881.1|  tyrosyl-tRNA synthetase                          88.6    8e-17   Actinomyces timonensis
ref|WP_013600598.1|  tyrosyl-tRNA synthetase                          88.6    1e-16   Pseudarthrobacter phenanthrenivorans
ref|WP_008661113.1|  tyrosyl-tRNA synthetase                          88.2    1e-16   Rhodopirellula europaea
gb|EKY16477.1|  tyrosine--tRNA ligase                                 87.0    1e-16   Actinomyces sp. oral taxon 181 str. F0379
ref|WP_007332625.1|  tyrosyl-tRNA synthetase                          88.2    1e-16   Rhodopirellula baltica
ref|WP_011122161.1|  tyrosine--tRNA ligase                            88.2    1e-16   Rhodopirellula baltica
ref|WP_043536564.1|  tyrosyl-tRNA synthetase                          87.4    2e-16   Actinomyces polynesiensis
ref|XP_009516786.1|  hypothetical protein PHYSODRAFT_552811           87.4    2e-16   Phytophthora sojae
ref|WP_041569078.1|  tyrosyl-tRNA synthetase                          87.4    2e-16   Chloracidobacterium thermophilum
gb|AEP11643.1|  tyrosyl-tRNA synthetase                               87.4    2e-16   Chloracidobacterium thermophilum B
ref|WP_034251080.1|  tyrosyl-tRNA synthetase                          87.0    2e-16   Actinomyces sp. oral taxon 181
ref|WP_006889016.1|  tyrosyl-tRNA synthetase                          87.4    2e-16   Rothia
ref|WP_037233127.1|  tyrosyl-tRNA synthetase                          87.0    3e-16   Rothia aeria
ref|WP_034277502.1|  tyrosyl-tRNA synthetase                          87.0    3e-16   Amycolatopsis halophila
gb|ERT67692.1|  tyrosine--tRNA ligase                                 87.0    3e-16   Rothia aeria F0184
ref|WP_019127035.1|  tyrosyl-tRNA synthetase                          86.7    3e-16   Actinomyces sp. ph3
dbj|BAI65246.1|  tyrosyl-tRNA synthetase                              84.3    4e-16   Rothia mucilaginosa DY-18
ref|WP_044150629.1|  tyrosyl-tRNA synthetase                          84.3    4e-16   
ref|WP_005987818.1|  tyrosyl-tRNA synthetase                          86.3    4e-16   Actinomyces graevenitzii
ref|WP_037604940.1|  tyrosyl-tRNA synthetase                          85.9    6e-16   Streptacidiphilus rugosus
ref|WP_012892535.1|  tyrosyl-tRNA synthetase                          85.9    6e-16   Streptosporangium roseum
ref|WP_017614427.1|  tyrosyl-tRNA synthetase                          86.3    6e-16   Nocardiopsis salina
ref|WP_021271485.1|  tyrosyl-tRNA synthetase                          85.9    7e-16   Bacteriovorax sp. BSW11_IV
ref|WP_021949404.1|  tyrosyl-tRNA synthetase                          86.3    7e-16   
ref|WP_036788433.1|  tyrosyl-tRNA synthetase                          85.9    7e-16   Porphyromonas canoris
ref|WP_021604636.1|  tyrosyl-tRNA synthetase                          85.9    8e-16   Actinomyces graevenitzii
ref|WP_021352198.1|  tyrosyl-tRNA synthetase                          85.5    8e-16   Corynebacterium pseudodiphtheriticum
ref|WP_008470064.1|  tyrosyl-tRNA synthetase                          85.5    8e-16   Lactobacillus hominis
ref|WP_027017834.1|  tyrosyl-tRNA synthetase                          85.5    9e-16   Corynebacterium
ref|WP_043455304.1|  tyrosyl-tRNA synthetase                          85.5    9e-16   Pseudarthrobacter phenanthrenivorans
ref|WP_005439705.1|  tyrosyl-tRNA synthetase                          85.5    9e-16   Saccharomonospora azurea
ref|WP_005448890.1|  tyrosyl-tRNA synthetase                          85.5    9e-16   Saccharomonospora azurea
ref|WP_015786857.1|  tyrosyl-tRNA synthetase                          85.5    1e-15   Saccharomonospora viridis
ref|WP_016335378.1|  tyrosyl-tRNA synthetase                          85.1    1e-15   Amycolatopsis keratiniphila
ref|WP_007338393.1|  tyrosyl-tRNA synthetase                          85.1    1e-15   Rhodopirellula baltica
ref|WP_003795411.1|  tyrosyl-tRNA synthetase                          84.7    2e-15   Actinomyces odontolyticus
ref|WP_024963599.1|  tyrosyl-tRNA synthetase                          84.7    2e-15   Trueperella pyogenes
ref|WP_020629629.1|  tyrosyl-tRNA synthetase                          84.7    2e-15   Amycolatopsis alba
gb|ETI39233.1|  tyrosine-tRNA ligase                                  84.7    2e-15   Phytophthora parasitica P1569
ref|XP_008910914.1|  tyrosine-tRNA ligase                             84.7    2e-15   Phytophthora parasitica INRA-310
ref|WP_025295943.1|  tyrosyl-tRNA synthetase                          84.3    2e-15   Trueperella pyogenes
ref|WP_023019532.1|  MULTISPECIES: tyrosyl-tRNA synthetase            84.3    2e-15   Corynebacterium
ref|WP_038511529.1|  tyrosyl-tRNA synthetase                          84.3    3e-15   Amycolatopsis japonica
ref|WP_013132266.1|  tyrosyl-tRNA synthetase                          84.3    3e-15   Thermobispora bispora
ref|WP_022513249.1|  tyrosyl-tRNA synthetase                          84.0    3e-15   
ref|WP_004806341.1|  tyrosyl-tRNA synthetase                          84.0    3e-15   
ref|WP_028912082.1|  tyrosyl-tRNA synthetase                          84.0    3e-15   Prevotella sp. MA2016
ref|WP_039240672.1|  tyrosyl-tRNA synthetase                          84.0    3e-15   Arthrobacter sp. MWB30
ref|WP_033435726.1|  tyrosyl-tRNA synthetase                          84.0    3e-15   Saccharothrix syringae
gb|AJK58517.1|  tyrosyl-tRNA synthetase                               84.0    3e-15   
ref|WP_007000220.1|  tyrosyl-tRNA synthetase                          84.0    4e-15   Actinobaculum massiliense
emb|CCQ46715.1|  tyrosyl-tRNA synthetase                              84.0    4e-15   Pseudarthrobacter siccitolerans
ref|WP_026460182.1|  tyrosyl-tRNA synthetase                          83.6    4e-15   Actinomyces suimastitidis
ref|WP_042409186.1|  tyrosyl-tRNA synthetase                          83.6    4e-15   Corynebacterium jeddahense
ref|XP_009837943.1|  tyrosine-tRNA ligase                             84.0    4e-15   Aphanomyces astaci
ref|WP_034466497.1|  tyrosyl-tRNA synthetase                          83.6    4e-15   Actinobacteria
ref|WP_008674495.1|  tyrosyl-tRNA synthetase                          83.6    4e-15   Rhodopirellula sallentina
ref|WP_003099613.1|  tyrosyl-tRNA synthetase                          83.6    5e-15   Amycolatopsis vancoresmycina
gb|KDQ21806.1|  hypothetical protein BOTBODRAFT_99200                 83.6    5e-15   Botryobasidium botryosum FD-172 SS1
ref|WP_028927384.1|  tyrosyl-tRNA synthetase                          83.2    5e-15   Pseudonocardia acaciae
ref|WP_018779124.1|  tyrosyl-tRNA synthetase                          83.6    5e-15   Arthrobacter sp. 161MFSha2.1
ref|WP_020645475.1|  tyrosyl-tRNA synthetase                          83.2    5e-15   Amycolatopsis balhimycina
ref|WP_019194888.1|  tyrosyl-tRNA synthetase                          83.2    6e-15   Corynebacterium timonense
ref|WP_043622222.1|  tyrosyl-tRNA synthetase                          83.2    6e-15   Nonomuraea candida
ref|WP_005163244.1|  tyrosyl-tRNA synthetase                          83.2    6e-15   Amycolatopsis azurea
ref|XP_004334902.1|  tyrosine-tRNA ligase                             83.6    7e-15   Acanthamoeba castellanii str. Neff
ref|WP_013227826.1|  tyrosyl-tRNA synthetase                          82.8    7e-15   Amycolatopsis mediterranei
ref|WP_041314757.1|  tyrosyl-tRNA synthetase                          82.8    7e-15   Saccharothrix espanaensis
gb|AAP58586.1|  putative tyrosyl-tRNA synthetase                      82.8    7e-15   uncultured Acidobacteria bacterium
ref|WP_042457579.1|  tyrosyl-tRNA synthetase                          82.8    7e-15   Streptacidiphilus jiangxiensis
ref|WP_037345658.1|  tyrosyl-tRNA synthetase                          82.8    7e-15   Amycolatopsis
ref|WP_013398793.1|  tyrosyl-tRNA synthetase                          82.8    8e-15   Rothia dentocariosa
ref|WP_018771549.1|  tyrosyl-tRNA synthetase                          82.8    9e-15   Arthrobacter sp. 162MFSha1.1
ref|WP_030504916.1|  tyrosyl-tRNA synthetase                          82.8    9e-15   Microbispora rosea
ref|WP_036865421.1|  tyrosyl-tRNA synthetase                          82.8    1e-14   Porphyromonas sp. COT-108 OH2963
ref|WP_028846608.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Thermocrispum agreste
ref|WP_013838509.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Isoptericola variabilis
ref|WP_044851982.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Amycolatopsis orientalis
ref|WP_007028024.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Amycolatopsis decaplanina
emb|CCH33827.1|  Tyrosyl-tRNA synthetase                              82.8    1e-14   Saccharothrix espanaensis DSM 44229
ref|WP_017197962.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Arthrobacter sp. M2012083
ref|WP_037313083.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Amycolatopsis orientalis
ref|WP_004600657.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Corynebacterium otitidis
ref|WP_018296313.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Corynebacterium lubricantis
ref|WP_012825381.1|  tyrosyl-tRNA synthetase                          82.4    1e-14   Haliangium ochraceum
ref|WP_033442848.1|  tyrosyl-tRNA synthetase                          82.0    1e-14   Saccharothrix sp. NRRL B-16314
ref|WP_042380116.1|  tyrosyl-tRNA synthetase                          82.0    1e-14   Streptacidiphilus melanogenes
ref|WP_021852743.1|  tyrosyl-tRNA synthetase                          82.0    2e-14   
ref|XP_002907836.1|  tyrosyl-tRNA synthetase, putative                82.0    2e-14   Phytophthora infestans T30-4
ref|WP_013515994.1|  tyrosyl-tRNA synthetase                          82.0    2e-14   Pseudodesulfovibrio aespoeensis
ref|WP_018763582.1|  tyrosyl-tRNA synthetase                          82.0    2e-14   Arthrobacter sp. 135MFCol5.1
ref|WP_005457874.1|  tyrosyl-tRNA synthetase                          82.0    2e-14   Saccharomonospora cyanea
ref|WP_026547366.1|  tyrosyl-tRNA synthetase                          82.0    2e-14   Paenarthrobacter nicotinovorans
ref|WP_026541624.1|  tyrosyl-tRNA synthetase                          82.0    2e-14   Paenarthrobacter nicotinovorans
ref|WP_028931561.1|  tyrosyl-tRNA synthetase                          81.6    2e-14   Pseudonocardia asaccharolytica
ref|WP_011956798.1|  tyrosine--tRNA ligase                            81.6    2e-14   Roseiflexus sp. RS-1
ref|WP_021853510.1|  tyrosyl-tRNA synthetase                          81.6    2e-14   Prevotella
ref|WP_024366580.1|  tyrosyl-tRNA synthetase                          81.6    2e-14   Arthrobacter sp. TB 26
ref|WP_014921325.1|  tyrosyl-tRNA synthetase                          81.3    3e-14   Arthrobacter sp. Rue61a
ref|WP_003798662.1|  tyrosyl-tRNA synthetase                          81.3    3e-14   Arthrobacter globiformis
ref|WP_006061976.1|  tyrosyl-tRNA synthetase                          81.3    3e-14   Corynebacterium durum
ref|WP_009103310.1|  tyrosyl-tRNA synthetase                          81.3    3e-14   Rhodopirellula sp. SWK7
ref|WP_035732891.1|  tyrosyl-tRNA synthetase                          81.3    3e-14   
gb|EXX57162.1|  tyrosine--tRNA ligase MSY1                            80.1    3e-14   Rhizophagus irregularis DAOM 197198w
gb|EIE99747.1|  tyrosyl-tRNA synthetase                               80.9    3e-14   Saccharomonospora glauca K62
ref|WP_036910525.1|  tyrosyl-tRNA synthetase                          80.9    3e-14   Prevotella
ref|WP_004355960.1|  tyrosyl-tRNA synthetase                          80.9    3e-14   Prevotella disiens
ref|WP_040919996.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Saccharomonospora glauca
ref|WP_042427072.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Streptacidiphilus anmyonensis
ref|WP_031165781.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Streptosporangium roseum
ref|WP_009199613.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Actinomyces sp. oral taxon 848
ref|WP_036847792.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Porphyromonas sp. COT-108 OH1349
ref|WP_043780313.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Amycolatopsis rifamycinica
ref|WP_021964934.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   
ref|WP_033150736.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Prevotella
ref|WP_026407733.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Actinomyces gerencseriae
ref|WP_028266666.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Arthrobacter sp. MA-N2
ref|WP_034501447.1|  tyrosyl-tRNA synthetase                          80.5    4e-14   Actinomyces sp. S6-Spd3
ref|WP_028906618.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Prevotella ruminicola
ref|WP_013064850.1|  tyrosyl-tRNA synthetase                          80.9    4e-14   Prevotella ruminicola
ref|WP_034999926.1|  tyrosyl-tRNA synthetase                          80.5    4e-14   Corynebacterium ihumii
ref|WP_028903046.1|  MULTISPECIES: tyrosyl-tRNA synthetase            80.5    4e-14   Prevotella
ref|WP_044279722.1|  tyrosine--tRNA ligase                            80.9    5e-14   
ref|WP_037274388.1|  tyrosyl-tRNA synthetase                          80.5    5e-14   Kibdelosporangium aridum
ref|WP_021756583.1|  tyrosyl-tRNA synthetase                          80.5    5e-14   Chlamydia pecorum
ref|WP_013559196.1|  tyrosyl-tRNA synthetase                          80.5    5e-14   Anaerolinea thermophila
ref|WP_033296256.1|  tyrosyl-tRNA synthetase                          80.5    5e-14   Amycolatopsis jejuensis
ref|WP_045730303.1|  tyrosyl-tRNA synthetase                          80.5    5e-14   Pseudarthrobacter chlorophenolicus
ref|WP_020672041.1|  tyrosyl-tRNA synthetase                          80.5    6e-14   Amycolatopsis nigrescens
ref|WP_005507143.1|  tyrosyl-tRNA synthetase                          80.5    6e-14   Rothia
ref|WP_028271895.1|  tyrosyl-tRNA synthetase                          80.5    6e-14   Arthrobacter sp. UNC362MFTsu5.1
ref|WP_005507861.1|  tyrosyl-tRNA synthetase                          80.5    6e-14   Rothia
ref|WP_026424349.1|  tyrosyl-tRNA synthetase                          80.1    6e-14   Actinokineospora inagensis
ref|WP_021474284.1|  tyrosyl-tRNA synthetase                          80.5    6e-14   Arthrobacter
ref|WP_020547072.1|  tyrosyl-tRNA synthetase                          80.1    6e-14   Nonomuraea coxensis
gb|ETK30431.1|  tyrosyl-tRNA synthetase                               80.1    7e-14   Microbispora sp. ATCC PTA-5024
ref|WP_004898658.1|  tyrosyl-tRNA synthetase                          80.1    7e-14   
ref|WP_031072446.1|  tyrosyl-tRNA synthetase                          80.1    7e-14   Streptomyces sp. NRRL S-118
gb|EMI16363.1|  tyrosyl-tRNA synthetase                               80.1    7e-14   Rhodopirellula maiorica SM1
ref|WP_014790868.1|  tyrosyl-tRNA synthetase                          80.1    7e-14   Ornithobacterium rhinotracheale
ref|WP_036333822.1|  tyrosyl-tRNA synthetase                          80.1    7e-14   Microbispora sp. ATCC PTA-5024
ref|WP_031544395.1|  tyrosyl-tRNA synthetase                          80.1    7e-14   Salinicoccus luteus
gb|ESA01810.1|  hypothetical protein GLOINDRAFT_39208                 80.5    7e-14   
ref|WP_040770420.1|  tyrosyl-tRNA synthetase                          80.1    8e-14   Rhodopirellula maiorica
ref|WP_033503787.1|  tyrosyl-tRNA synthetase                          80.1    8e-14   Bifidobacterium actinocoloniiforme
ref|WP_036886463.1|  tyrosyl-tRNA synthetase                          79.7    8e-14   Prevotella bivia
gb|AHA96684.1|  tyrosyl-tRNA synthase                                 79.7    9e-14   Lactobacillus johnsonii N6.2
ref|WP_036863366.1|  tyrosyl-tRNA synthetase                          79.7    9e-14   Prevotella bivia
ref|WP_018921741.1|  tyrosyl-tRNA synthetase                          79.7    9e-14   Salsuginibacillus kocurii
ref|WP_041818421.1|  tyrosine--tRNA ligase                            79.7    9e-14   Lactobacillus johnsonii
ref|WP_004338209.1|  tyrosyl-tRNA synthetase                          79.7    9e-14   Prevotella bivia
ref|WP_020660335.1|  tyrosyl-tRNA synthetase                          79.7    9e-14   Amycolatopsis benzoatilytica
ref|WP_040085774.1|  tyrosyl-tRNA synthetase                          79.7    9e-14   Corynebacterium humireducens
ref|WP_026420795.1|  tyrosyl-tRNA synthetase                          79.7    9e-14   
ref|WP_015936720.1|  tyrosyl-tRNA synthetase                          79.7    1e-13   
ref|WP_026503264.1|  tyrosyl-tRNA synthetase                          79.7    1e-13   
ref|WP_011774354.1|  tyrosyl-tRNA synthetase                          79.7    1e-13   
ref|WP_014523269.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_010528768.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_014366981.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_024820416.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_026459488.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_009079585.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_027449259.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
gb|KDO34878.1|  tyrosyl-tRNA synthetase                               79.3    1e-13   
ref|WP_037370307.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
gb|AAS08157.1|  tyrosyl-tRNA synthetase                               79.3    1e-13   
ref|WP_004006304.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_044496576.1|  tyrosine--tRNA ligase                            79.3    1e-13   
ref|WP_042369585.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_043608636.1|  tyrosyl-tRNA synthetase                          79.0    1e-13   
ref|WP_023576069.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_018657964.1|  tyrosyl-tRNA synthetase                          79.0    1e-13   
ref|WP_022016119.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
ref|WP_021584875.1|  tyrosyl-tRNA synthetase                          79.3    1e-13   
gb|AGP58290.1|  tyrosyl-tRNA synthetase                               79.0    1e-13   
ref|WP_036867594.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_026866815.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_021275481.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_024991409.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_003650704.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_035280995.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_016188948.1|  tyrosine--tRNA ligase                            79.0    2e-13   
ref|WP_011691372.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_006548833.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_026448992.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_010468888.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_006256112.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
gb|KGM09478.1|  hypothetical protein N868_16990                       79.0    2e-13   
ref|WP_012911063.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_021314877.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_015415854.1|  tyrosyl-tRNA synthetase                          79.0    2e-13   
ref|WP_031129511.1|  tyrosyl-tRNA synthetase                          78.6    2e-13   
gb|AAZ56076.1|  tyrosyl-tRNA synthetase                               79.0    2e-13   
ref|WP_025065363.1|  tyrosyl-tRNA synthetase                          78.6    2e-13   
ref|WP_020621555.1|  tyrosyl-tRNA synthetase                          78.6    2e-13   
gb|ABJ59589.1|  tyrosyl-tRNA synthetase                               78.6    2e-13   
ref|WP_031264683.1|  tyrosyl-tRNA synthetase                          78.6    2e-13   
ref|WP_042166486.1|  tyrosyl-tRNA synthetase                          78.6    2e-13   
ref|XP_008868076.1|  tyrosine-tRNA ligase                             78.6    3e-13   
ref|WP_021267070.1|  tyrosyl-tRNA synthetase                          78.6    3e-13   
ref|WP_045576366.1|  tyrosine--tRNA ligase                            78.2    3e-13   
ref|WP_042198650.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_020007484.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_013170168.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_010225538.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_026466510.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_009347608.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_017573475.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
gb|AJC07291.1|  tyrosyl-tRNA synthase                                 78.2    3e-13   
ref|WP_035809282.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_039155571.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_026316880.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_044496612.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_003649560.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_014558675.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_004362948.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_013241818.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_018120146.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_017832867.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_019739157.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
gb|AFH90785.1|  Tyrosyl-tRNA synthetase                               78.2    3e-13   
ref|WP_006953261.1|  tyrosyl-tRNA synthetase                          78.2    3e-13   
ref|WP_038993706.1|  tyrosyl-tRNA synthetase                          78.2    4e-13   
ref|WP_006947867.1|  tyrosyl-tRNA synthetase                          78.2    4e-13   
ref|WP_023392472.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
ref|WP_027454742.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
ref|WP_006240013.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
ref|WP_003716179.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
ref|WP_040353255.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
gb|EAQ78434.1|  tyrosyl-tRNA synthetase                               77.8    4e-13   
ref|WP_024877836.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
ref|WP_006908464.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
ref|WP_032087326.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
ref|WP_022395261.1|  tyrosyl-tRNA synthetase                          77.8    4e-13   
ref|WP_026859655.1|  tyrosyl-tRNA synthetase                          77.8    5e-13   
ref|WP_043480242.1|  tyrosyl-tRNA synthetase                          77.8    5e-13   
ref|WP_035929596.1|  tyrosyl-tRNA synthetase                          77.8    5e-13   
ref|WP_031426654.1|  tyrosyl-tRNA synthetase                          77.8    5e-13   
ref|WP_008824157.1|  tyrosyl-tRNA synthetase                          77.8    5e-13   
ref|WP_018340909.1|  tyrosyl-tRNA synthetase                          77.8    5e-13   
ref|WP_013670661.1|  tyrosyl-tRNA synthetase                          77.8    5e-13   
ref|WP_008103635.1|  tyrosyl-tRNA synthetase                          77.4    5e-13   
ref|WP_014567013.1|  tyrosyl-tRNA synthetase                          77.4    5e-13   
ref|WP_023589348.1|  tyrosyl-tRNA synthetase                          77.4    5e-13   
ref|WP_012120309.1|  tyrosine--tRNA ligase                            77.4    5e-13   
gb|EJU04247.1|  hypothetical protein DACRYDRAFT_48409                 77.8    5e-13   
ref|WP_043828458.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_041649506.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_007174743.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_004896025.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_026538365.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_029722869.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_015400799.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
emb|CBT75367.1|  tyrosine--tRNA ligase                                77.4    6e-13   
ref|WP_006546407.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_036831526.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_026404207.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_016896392.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_006681555.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_004106818.1|  tyrosyl-tRNA synthetase                          77.4    6e-13   
ref|WP_040106654.1|  tyrosyl-tRNA synthetase                          77.0    6e-13   
ref|WP_030996324.1|  tyrosyl-tRNA synthetase                          77.0    7e-13   
ref|WP_020806596.1|  tyrosyl-tRNA synthetase                          77.0    7e-13   
ref|WP_006281183.1|  tyrosyl-tRNA synthetase                          77.0    7e-13   
ref|WP_043585078.1|  tyrosyl-tRNA synthetase                          77.0    7e-13   
ref|WP_030266695.1|  tyrosyl-tRNA synthetase                          77.0    7e-13   
ref|WP_030173661.1|  tyrosyl-tRNA synthetase                          77.0    7e-13   
ref|WP_002680671.1|  tyrosyl-tRNA synthetase                          77.0    8e-13   
ref|WP_006823030.1|  tyrosyl-tRNA synthetase                          77.0    8e-13   
ref|WP_027453266.1|  tyrosyl-tRNA synthetase                          77.0    8e-13   
ref|WP_018662449.1|  tyrosyl-tRNA synthetase                          77.0    8e-13   
ref|WP_036856724.1|  tyrosyl-tRNA synthetase                          77.0    8e-13   
ref|WP_004354427.1|  tyrosyl-tRNA synthetase                          77.0    8e-13   
ref|WP_017565008.1|  tyrosyl-tRNA synthetase                          77.0    8e-13   
ref|WP_006718950.1|  tyrosyl-tRNA synthetase                          77.0    8e-13   
gb|EJF36940.1|  tyrosine--tRNA ligase                                 77.0    8e-13   
ref|WP_028662109.1|  tyrosyl-tRNA synthetase                          77.0    9e-13   
ref|WP_038611426.1|  tyrosyl-tRNA synthetase                          77.0    9e-13   
ref|WP_034554070.1|  tyrosyl-tRNA synthetase                          77.0    9e-13   
ref|WP_033507377.1|  tyrosyl-tRNA synthetase                          77.0    9e-13   
ref|WP_015451268.1|  MULTISPECIES: tyrosyl-tRNA synthetase            77.0    9e-13   
ref|WP_019610730.1|  tyrosyl-tRNA synthetase                          76.6    9e-13   
ref|WP_004128120.1|  tyrosyl-tRNA synthetase                          76.6    9e-13   
ref|WP_013911393.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_043256456.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_023577906.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_016457404.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_027445654.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_044339444.1|  tyrosine--tRNA ligase                            76.6    1e-12   
ref|WP_013154057.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_034235592.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_028277280.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_003143076.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_014709256.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
gb|EGJ78331.1|  putative tyrosyl-tRNA synthetase                      76.6    1e-12   
ref|WP_023925721.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_008447361.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_028905488.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_024989478.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_034662903.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_043462324.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_021757799.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_024936535.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_018774401.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_041838392.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_025067875.1|  tyrosyl-tRNA synthetase                          76.6    1e-12   
ref|WP_025000389.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_006840945.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_003655654.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_037818189.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
gb|ACU39264.1|  tyrosyl-tRNA synthetase                               76.3    1e-12   
ref|WP_006043715.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_024442908.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_005989039.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_006770450.1|  tyrosine--tRNA ligase                            76.3    1e-12   
ref|WP_025252737.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_018911465.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_030431057.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_017606030.1|  tyrosyl-tRNA synthetase                          76.3    1e-12   
ref|WP_018659753.1|  tyrosyl-tRNA synthetase                          76.3    2e-12   
ref|WP_017884472.1|  tyrosyl-tRNA synthetase                          76.3    2e-12   
ref|WP_004136073.1|  tyrosyl-tRNA synthetase                          76.3    2e-12   
ref|WP_022317024.1|  MULTISPECIES: tyrosyl-tRNA synthetase            76.3    2e-12   
ref|WP_030063911.1|  tyrosyl-tRNA synthetase                          76.3    2e-12   
ref|WP_007573255.1|  tyrosyl-tRNA synthetase                          76.3    2e-12   
ref|WP_004366699.1|  tyrosyl-tRNA synthetase                          76.3    2e-12   
ref|WP_003657064.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_021757244.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_013712800.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_004012674.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
emb|CDX92007.1|  BnaC03g33090D                                        76.6    2e-12   
ref|WP_026287364.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_015651172.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_043934087.1|  tyrosine--tRNA ligase                            75.9    2e-12   
ref|WP_022286111.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_030456950.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_038984901.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_034230867.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_029577057.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_044079621.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_023635620.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_018118567.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
gb|ETJ03879.1|  Tyrosine-tRNA ligase                                  75.9    2e-12   
ref|WP_044065228.1|  MULTISPECIES: tyrosyl-tRNA synthetase            75.9    2e-12   
ref|WP_044075099.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_004384512.1|  MULTISPECIES: tyrosyl-tRNA synthetase            75.9    2e-12   
dbj|GAB47632.1|  tyrosyl-tRNA synthetase                              75.9    2e-12   
ref|WP_025069924.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_012845555.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_028910362.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_030474020.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_005512963.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_040632807.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_013416135.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_026453975.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_028897025.1|  tyrosyl-tRNA synthetase                          75.9    2e-12   
ref|WP_012852510.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_022663249.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_025780404.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_021927795.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_004380478.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_004118250.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_007367905.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_004121809.1|  tyrosyl-tRNA synthetase                          75.5    2e-12   
ref|WP_004137882.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   
ref|WP_036893143.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   
ref|WP_004112539.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   
ref|WP_004115506.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   
ref|WP_033513851.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   
ref|WP_023572950.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   
ref|WP_022875807.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   
ref|WP_014554673.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   
ref|WP_028274405.1|  tyrosyl-tRNA synthetase                          75.5    3e-12   



>ref|XP_009591201.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=522

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DVVRFLKILTFL IEEI E++  MG PGY PNTAQRRLAEEVTRFV
Sbjct  346  PYKFYQYFFTVPDDDVVRFLKILTFLNIEEIAEVERDMGKPGYVPNTAQRRLAEEVTRFV  405

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL+IS+LDL VSSG
Sbjct  406  HGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYDQVLNISILDLYVSSG  465

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARRMLKQGGLYLNNA+VD E+KKIE DDIVD KV+LLSAGKKNKMVVRIS
Sbjct  466  LLESKSAARRMLKQGGLYLNNAKVDGESKKIEADDIVDDKVILLSAGKKNKMVVRIS  522



>ref|XP_009588089.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Nicotiana tomentosiformis]
Length=521

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DVVRFLKILTFL+IEEI EL+  MG PGY PNTAQRRLAEEVTRFV
Sbjct  345  PYKFYQYFFTVPDDDVVRFLKILTFLSIEEIAELERDMGKPGYVPNTAQRRLAEEVTRFV  404

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL+I +LDL VS G
Sbjct  405  HGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMKYDQVLNIPILDLYVSGG  464

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARRMLKQGGLYLNN +VDSE+KKIE DDIVD KV+LLSAGKKNKMVVRIS
Sbjct  465  LLESKSAARRMLKQGGLYLNNGKVDSESKKIEADDIVDDKVILLSAGKKNKMVVRIS  521



>ref|XP_004242803.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Solanum 
lycopersicum]
Length=521

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DVVRFLKILTFL+IEEI EL+  MG PGY PNTAQRRLAEEVTRFV
Sbjct  345  PYKFYQYFFTVPDDDVVRFLKILTFLSIEEIAELEKDMGKPGYVPNTAQRRLAEEVTRFV  404

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ ++QVL I +LDL VSSG
Sbjct  405  HGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYEQVLDIPILDLYVSSG  464

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARRMLKQGGLYLNNA+VDSE+KKIE DDIVD KV+LLSAGKKNKMVVRIS
Sbjct  465  LLESKSAARRMLKQGGLYLNNAKVDSESKKIEADDIVDDKVILLSAGKKNKMVVRIS  521



>ref|XP_009760674.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=522

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DVVRFLKILTFL IEEIEE++  MG PGY PNTAQRRLAEEVTRFV
Sbjct  346  PYKFYQYFFTVPDDDVVRFLKILTFLNIEEIEEVERDMGKPGYVPNTAQRRLAEEVTRFV  405

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL+I +LDL VSSG
Sbjct  406  HGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYDQVLNIPILDLYVSSG  465

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARRMLKQGGLYLNNA+VD E+KKIE DDIVD KV+LLSAGKKNKMVVRIS
Sbjct  466  LLESKSAARRMLKQGGLYLNNAKVDGESKKIEADDIVDDKVILLSAGKKNKMVVRIS  522



>ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=522

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DVVRFLKILTFL+IEEI EL+  MG  GY PNTAQRRLAEEVTRFV
Sbjct  346  PYKFYQYFFTVPDDDVVRFLKILTFLSIEEIAELERDMGKLGYVPNTAQRRLAEEVTRFV  405

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+  +QVL+I +LDL VSSG
Sbjct  406  HGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNHEQVLNIPILDLYVSSG  465

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARRMLKQGGLYLNNA+VDSE+KKIE DDIVD KV+LLSAGKKNKMVVRIS
Sbjct  466  LLESKSAARRMLKQGGLYLNNAKVDSESKKIEADDIVDDKVILLSAGKKNKMVVRIS  522



>ref|XP_010110726.1| Tyrosine--tRNA ligase [Morus notabilis]
 gb|EXC27891.1| Tyrosine--tRNA ligase [Morus notabilis]
Length=481

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD+DVVRFLK+LTF+ +EEI  L+ +MG PGYAPNTAQRRLAEEVTRFV
Sbjct  306  PYKFYQYFFSVPDSDVVRFLKLLTFIDMEEIMALEREMGLPGYAPNTAQRRLAEEVTRFV  365

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL + + + +S++DLSVS+G
Sbjct  366  HGEEGLREALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYAEAIGLSLVDLSVSAG  424

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARR+LKQGGLYLNNARVDSE+K++E DDIVDGKVLLLSAGKKNK+VVRIS
Sbjct  425  LLESKSAARRLLKQGGLYLNNARVDSESKRVEADDIVDGKVLLLSAGKKNKVVVRIS  481



>ref|XP_002265238.2| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Vitis 
vinifera]
Length=485

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFLKILTFL ++EI EL+ +M +P Y PNTAQRRLAEE TRFV
Sbjct  310  PYKFYQYFFSVPDADVVRFLKILTFLDMDEIMELEVKMRSPSYVPNTAQRRLAEEATRFV  369

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGLDEALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D+VL++S+LDLS+S+G
Sbjct  370  HGQEGLDEALKATEALRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVLNLSLLDLSISTG  428

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  429  LLESKSAARRLLKQGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  485



>ref|XP_012067411.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Jatropha 
curcas]
 gb|KDP41896.1| hypothetical protein JCGZ_26914 [Jatropha curcas]
Length=509

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADV+RFLKILTFL + EI+EL+ +M  PGY PN AQRRLAEEVTRFV
Sbjct  334  PYKFYQYFFSVPDADVIRFLKILTFLDLNEIDELEREMKKPGYVPNKAQRRLAEEVTRFV  393

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +DQVL++S++DLSVS+G
Sbjct  394  HGEDGLSEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDQVLNLSLVDLSVSAG  452

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARR+LKQGGLYLNN+RVDSE+K++E +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  453  LLESKSAARRLLKQGGLYLNNSRVDSESKRVEAEDIVDGKVLLLSAGKKNKVVVRIS  509



>emb|CDP19091.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQYFFSVPD DVVRFLK+LTFL++EEI  L+  M  PGY PNTAQRRLAEE+TRFV
Sbjct  350  PYNFYQYFFSVPDDDVVRFLKMLTFLSLEEIARLERDMDTPGYVPNTAQRRLAEEITRFV  409

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGLDEALKATEALRPG A TKLD KTIEGI  DVPSCSLP+DQVLS+S+LDLSVSSG
Sbjct  410  HGQEGLDEALKATEALRPGAA-TKLDAKTIEGIGEDVPSCSLPYDQVLSLSLLDLSVSSG  468

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARR+LKQGGLYLNN+RVDSEAKKIE +DI+DGKV+LLSAGKKNKMVVR+S
Sbjct  469  LLESKSAARRLLKQGGLYLNNSRVDSEAKKIEANDIIDGKVILLSAGKKNKMVVRVS  525



>ref|XP_006375482.1| hypothetical protein POPTR_0014s13650g [Populus trichocarpa]
 gb|ERP53279.1| hypothetical protein POPTR_0014s13650g [Populus trichocarpa]
Length=329

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADV+RFLKILTFL IEEI+EL+ +M  PGY PNTAQRRLAE+VT FV
Sbjct  154  PYKFYQYFFSVPDADVIRFLKILTFLDIEEIDELEKEMNRPGYTPNTAQRRLAEQVTLFV  213

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EALKATEALRPG A+TKLDWKT EGIA DVPSCSL  DQVL+IS++DLSVSSG
Sbjct  214  HGEDGLNEALKATEALRPG-AETKLDWKTFEGIAEDVPSCSLASDQVLNISLIDLSVSSG  272

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGKVLLLSAGKKNK++VRI+
Sbjct  273  LLDSKSAARRLLKQGGLYLNNSRVDSETKRIEPQDIVDGKVLLLSAGKKNKVIVRIT  329



>ref|XP_004146892.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Cucumis 
sativus]
 gb|KGN53185.1| hypothetical protein Csa_4G025150 [Cucumis sativus]
Length=493

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFL+ILTFL IEEI++L++QM  PGY PNTAQRRLAEEVTRFV
Sbjct  318  PYKFYQYFFSVPDADVVRFLRILTFLDIEEIQDLESQMMKPGYVPNTAQRRLAEEVTRFV  377

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEAL+PG A+TKLDWKTIEGIA DVP CSL +DQVL++SV+DLSV+SG
Sbjct  378  HGEDGLREALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVLNLSVVDLSVTSG  436

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARR+LKQGGLYLNN RVDSE+K++E  DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  437  LLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDIVDGKVLLLSAGKKNKVVVRIS  493



>ref|XP_007022036.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 ref|XP_007022037.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13561.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13562.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
Length=491

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFLKILTFL++EEI EL++ M  PGY PNTAQ+RLAEE+TRFV
Sbjct  316  PYKFYQYFFSVPDADVVRFLKILTFLSMEEINELESGMTRPGYVPNTAQQRLAEEITRFV  375

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV+++S++DLSV SG
Sbjct  376  HGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVVNLSIVDLSVCSG  434

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  435  LFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  491



>ref|XP_008453844.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Cucumis 
melo]
Length=493

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFL+ILTFL IEEI++L++QM  PGY PNT QRRLAEEVTRFV
Sbjct  318  PYKFYQYFFSVPDADVVRFLRILTFLDIEEIQDLESQMTKPGYVPNTVQRRLAEEVTRFV  377

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+ GL EALKATEAL+PG A+TKLDWKTIEGIA DVP CSL +DQVL++SV+DLSV++G
Sbjct  378  HGENGLSEALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVLNLSVVDLSVTTG  436

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARR+LKQGGLYLNN RVDSE+K++E  D++DGKVLLLSAGKKNK+VVRIS
Sbjct  437  LLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDVIDGKVLLLSAGKKNKVVVRIS  493



>gb|KCW55733.1| hypothetical protein EUGRSUZ_I01565, partial [Eucalyptus grandis]
Length=479

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD D++RFLK+LTFL IEEI E++  M  PGY PNTAQRRLAEEVTRFV
Sbjct  304  PYKFYQYFFSVPDTDIIRFLKVLTFLEIEEINEIEKDMKRPGYVPNTAQRRLAEEVTRFV  363

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL+ S++DLSV +G
Sbjct  364  HGEDGLQEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLNYDDVLNCSLVDLSVLAG  422

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L+ESKSAARR+LKQGG+YLNN RVD E+K+IE +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  423  LMESKSAARRLLKQGGMYLNNGRVDGESKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  479



>ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=490

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLKILTFL IEEI  L+ +MG PGY PNTAQRRLAEEVTRFV
Sbjct  315  PYKFYQYFFSVPDDDVIRFLKILTFLDIEEIVSLEGEMGKPGYVPNTAQRRLAEEVTRFV  374

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL++S++DLSVSSG
Sbjct  375  HGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDAVLNLSLVDLSVSSG  433

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR+LKQGGLYLNN RVDSE+K+IE  DIVDGKVLLLSAGKKNK++VRI+
Sbjct  434  LFESKSAARRLLKQGGLYLNNNRVDSESKRIEAADIVDGKVLLLSAGKKNKVLVRIA  490



>gb|KHN08832.1| Tyrosine--tRNA ligase [Glycine soja]
Length=482

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLKILTFL IEEI  L+ +MG PGY PNTAQRRLAEEVTRFV
Sbjct  307  PYKFYQYFFSVPDDDVIRFLKILTFLDIEEIVSLEGEMGKPGYVPNTAQRRLAEEVTRFV  366

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL++S++DLSVSSG
Sbjct  367  HGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDAVLNLSLVDLSVSSG  425

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR+LKQGGLYLNN RVDSE+K+IE  DIVDGKVLLLSAGKKNK++VRI+
Sbjct  426  LFESKSAARRLLKQGGLYLNNNRVDSESKRIEAADIVDGKVLLLSAGKKNKVLVRIA  482



>ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
Length=492

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFS+ D DV+RFLKILTFL ++EI EL+ +M  PGY PNTAQRRLAEEVTRFV
Sbjct  317  PYKFYQYFFSIADDDVIRFLKILTFLELDEIAELEREMKRPGYVPNTAQRRLAEEVTRFV  376

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GL EA+KATEALRPG A+TKLDWKTIEGIA DVPSCSL +DQVL++S++DLSV++G
Sbjct  377  HGQDGLLEAIKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDQVLNLSLVDLSVTAG  435

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L++SKSAARR+LKQGGLYLNN+RVDSE+K++E  DIV+GKVLLLSAGKKNK++VRIS
Sbjct  436  LIDSKSAARRLLKQGGLYLNNSRVDSESKRVESQDIVEGKVLLLSAGKKNKVIVRIS  492



>gb|KEH32330.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=482

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFLKILTFL I EI +L+ +M  PGY PNTAQRRLAEEVTRFV
Sbjct  307  PYKFYQYFFSVPDADVVRFLKILTFLDIYEIVKLEEEMKRPGYMPNTAQRRLAEEVTRFV  366

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EAL+ATEALRPG ++TKLDWKTIEGIA DVPSCSL +D+VL+ S++DLSVSSG
Sbjct  367  HGEDGLSEALRATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDEVLNQSLVDLSVSSG  425

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L +SKSAARR+LKQGG+YLNN+RVDSE K+IE  DIVDGKVLLLSAGKKNK++VRI+
Sbjct  426  LFDSKSAARRLLKQGGVYLNNSRVDSENKRIEAADIVDGKVLLLSAGKKNKVLVRIA  482



>ref|XP_010028900.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
Length=506

 Score =   234 bits (597),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD D++RFLK+LTFL IEEI E++  M  PGY PNTAQRRLAEEVTRFV
Sbjct  331  PYKFYQYFFSVPDTDIIRFLKVLTFLEIEEINEIEKDMKRPGYVPNTAQRRLAEEVTRFV  390

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL+ S++DLSV +G
Sbjct  391  HGEDGLQEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLNYDDVLNCSLVDLSVLAG  449

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L+ESKSAARR+LKQGG+YLNN RVD E+K+IE +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  450  LMESKSAARRLLKQGGMYLNNGRVDGESKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  506



>ref|XP_004500343.1| PREDICTED: tyrosine--tRNA ligase-like [Cicer arietinum]
Length=501

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADV+RFLKILTFL I EI +L+ +M  PGY PNTAQRRLAEEVTRFV
Sbjct  326  PYKFYQYFFSVPDADVIRFLKILTFLDIGEIVKLEEEMMKPGYVPNTAQRRLAEEVTRFV  385

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EA+KATEALRPG ++TKLDWKTIEGIA DVPSCSL +D+VL+ S++DLSVSSG
Sbjct  386  HGEDGLNEAIKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDEVLNQSLVDLSVSSG  444

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L +SKSAARR+LKQGGLYLNN+RVD+E K++E  DIVDGKVLLLSAGKKNK++VRI+
Sbjct  445  LFDSKSAARRLLKQGGLYLNNSRVDNENKRVEAADIVDGKVLLLSAGKKNKVLVRIA  501



>ref|XP_004303944.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSV DADVVRFLKILTFL + +I ++++ M  PGY PNTAQRRLAEEVTRFV
Sbjct  304  PYKFYQYFFSVSDADVVRFLKILTFLDMNDIRQIESDMKRPGYLPNTAQRRLAEEVTRFV  363

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG ADTKLDWKT++ I+ DVPSCS P+ QVL +SV+DLSVSSG
Sbjct  364  HGQDGLDEALKATEAMRPG-ADTKLDWKTMQAISEDVPSCSFPYHQVLDLSVVDLSVSSG  422

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L +SKSAARR+LKQGGLYLNN+RVDSE+K+IE  D+VDGK+LLLSAGKKNK++VRIS
Sbjct  423  LFDSKSAARRLLKQGGLYLNNSRVDSESKRIEPQDVVDGKLLLLSAGKKNKVLVRIS  479



>ref|XP_011033705.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Populus euphratica]
Length=502

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADV+RFLKILTFL IEEI+EL+ +M  PGY PNTAQRRLAE+VT FV
Sbjct  327  PYKFYQYFFSVPDADVIRFLKILTFLDIEEIDELEKEMNRPGYIPNTAQRRLAEQVTLFV  386

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EALKATEALRPG A+TKLDWKT EGIA DVPSCSL  DQVL+IS++DLSVSSG
Sbjct  387  HGEDGLNEALKATEALRPG-AETKLDWKTFEGIAEDVPSCSLASDQVLNISLIDLSVSSG  445

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGKVLLLSAGKKNK++VRI+
Sbjct  446  LLDSKSAARRLLKQGGLYLNNSRVDSETKRIEPQDIVDGKVLLLSAGKKNKVIVRIT  502



>gb|KHN40972.1| Tyrosine--tRNA ligase [Glycine soja]
Length=279

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLKILTFL IEEI  L+ +MG PGY PNTAQRRLAEEVTRFV
Sbjct  103  PYKFYQYFFSVPDDDVIRFLKILTFLDIEEIVALEGEMGKPGYVPNTAQRRLAEEVTRFV  162

Query  547  HGQEG-LDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG++G L EALKATEALRPG ++TKLDWKTIEGIA DVP CSL +D VL++S++DL VSS
Sbjct  163  HGEDGFLAEALKATEALRPG-SETKLDWKTIEGIAEDVPCCSLAYDAVLNLSLVDLLVSS  221

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            GL ESKSAARR+LKQGGLYLNN RVD+E K+IE  DIVDGKVLLLSAGKKNK++VRI
Sbjct  222  GLFESKSAARRLLKQGGLYLNNNRVDNEGKRIEAADIVDGKVLLLSAGKKNKVLVRI  278



>ref|XP_010683748.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683749.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683750.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683751.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD+DVVRFL+ILTFL IEEIEE++ +M  PGY PN+AQ RLAEE+TRFV
Sbjct  323  PYKFYQYFFTVPDSDVVRFLRILTFLDIEEIEEIEREMKKPGYKPNSAQIRLAEELTRFV  382

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL++S++DLSV SG
Sbjct  383  HGEEGLKEAIKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDDVLNLSIVDLSVLSG  441

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLES+SA RRMLKQGGLYLNN R+D+E+K+IE DDIVDGKVLLLSAGKKNKMVVR+S
Sbjct  442  LLESRSAVRRMLKQGGLYLNNTRIDNESKRIEVDDIVDGKVLLLSAGKKNKMVVRVS  498



>ref|XP_008218548.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218549.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218550.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=485

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 162/176 (92%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQY FSVPDADVVRFLKILTF+ ++EI++L+ +M  PGY PNTAQRRLA+EVTRFV
Sbjct  307  PYKFYQYLFSVPDADVVRFLKILTFMDMDEIKQLENEMKGPGYLPNTAQRRLAQEVTRFV  366

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEALRPG ADTKLDWKTI+ I+ DVPSCS P++QVL +S++DLSVSSG
Sbjct  367  HGQDGLDEALKATEALRPG-ADTKLDWKTIQAISEDVPSCSFPYNQVLDLSLVDLSVSSG  425

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LL+SKSAARR+LKQGGLYLNN+RVD+E K++E  DIVDGK+LLLSAGKKNK++V+I
Sbjct  426  LLDSKSAARRLLKQGGLYLNNSRVDNENKRVEPQDIVDGKLLLLSAGKKNKVLVQI  481



>gb|EMT07165.1| Tyrosyl-tRNA synthetase [Aegilops tauschii]
Length=512

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DVVRF+KILTFL+++EI EL+  M  PGY PNT QRRLAEEVTRFV
Sbjct  337  PYKFYQYFFSVPDVDVVRFMKILTFLSLDEIHELEESMKKPGYVPNTVQRRLAEEVTRFV  396

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQVL   ++DL+ S+G
Sbjct  397  HGQEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLRYDQVLKSPLVDLAASTG  455

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSAARR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGKKNKMVVRIS
Sbjct  456  LLASKSAARRLIKQGGLYLNNMKIDSEDKLVEEGDIVDGKVLLLSAGKKNKMVVRIS  512



>ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
 gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
Length=485

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQY FSVPDADVVRFLKILTF+ ++EI++L+ +M  PGY PNT QRRLAEEVTRFV
Sbjct  307  PYKFYQYLFSVPDADVVRFLKILTFMDMDEIKQLENEMKGPGYLPNTVQRRLAEEVTRFV  366

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEALRPG ADTKLDWKTI+ I+ DVPSCS P++QVL +S++DLSVSSG
Sbjct  367  HGQDGLDEALKATEALRPG-ADTKLDWKTIQAISEDVPSCSFPYNQVLDLSLVDLSVSSG  425

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LL+SKSAARR+LKQGGLYLNN+RVD+E K++E  DIVDGK+LLLSAGKKNK++V+I
Sbjct  426  LLDSKSAARRLLKQGGLYLNNSRVDNENKRVEPQDIVDGKLLLLSAGKKNKVLVQI  481



>ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=496

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLKILTFL IEEI  L+ +MG PGY PNTAQRRLAEEVTRFV
Sbjct  321  PYKFYQYFFSVPDDDVIRFLKILTFLDIEEIVALEGEMGKPGYVPNTAQRRLAEEVTRFV  380

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEALRPG ++TKLDWKTIEGIA DVP CSL +D VL++S++DL VSSG
Sbjct  381  HGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPCCSLAYDAVLNLSLVDLLVSSG  439

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L ESKSAARR+LKQGGLYLNN RVD+E K+IE  DIVDGKVLLLSAGKKNK++VRI
Sbjct  440  LFESKSAARRLLKQGGLYLNNNRVDNEGKRIEAADIVDGKVLLLSAGKKNKVLVRI  495



>ref|XP_006645923.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Oryza brachyantha]
Length=485

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RF+KILTF++++EI+EL+  M  PGY PNT QRRLAEEVTRFV
Sbjct  310  PYKFYQYFFSVPDVDVIRFMKILTFMSLDEIQELEQSMKKPGYVPNTIQRRLAEEVTRFV  369

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL   ++DL+VS+G
Sbjct  370  HGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVLKSPLVDLAVSTG  428

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA RR++KQGGLYLNN R+DSE K +EE D+V+GKVLLLSAGKKNKMVVRIS
Sbjct  429  LLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVNGKVLLLSAGKKNKMVVRIS  485



>ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Citrus sinensis]
Length=493

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADV+RFL+ILTFL +EEI+EL+  M  PGY PNTAQ+RLAEEVTRFV
Sbjct  318  PYKFYQYFFSVPDADVIRFLRILTFLDLEEIDELEKDMKRPGYVPNTAQQRLAEEVTRFV  377

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL++S++DLSVS+G
Sbjct  378  HGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVLNVSLVDLSVSAG  436

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGKKNK+VVRI+
Sbjct  437  LFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGKKNKVVVRIA  493



>dbj|BAK00149.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DVVRF++ILTFL+++EI EL+  M  PGY PNT QRRLAEEVT FV
Sbjct  337  PYKFYQYFFSVPDVDVVRFMRILTFLSLDEIHELEESMKKPGYVPNTVQRRLAEEVTLFV  396

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL   ++DL+ S+G
Sbjct  397  HGQEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVLKSPLVDLAASTG  455

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGKKNKMVVRIS
Sbjct  456  LLASKSAVRRLIKQGGLYLNNKKIDSEDKLVEEGDIVDGKVLLLSAGKKNKMVVRIS  512



>gb|KDO63480.1| hypothetical protein CISIN_1g037749mg [Citrus sinensis]
Length=495

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADV+RFL+ILTFL +EEI+EL+  M  PGY PNTAQRRLAEEVT FV
Sbjct  320  PYKFYQYFFSVPDADVIRFLRILTFLDLEEIDELEKDMKRPGYVPNTAQRRLAEEVTHFV  379

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL++S++DL+VS+G
Sbjct  380  HGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVLNVSLVDLAVSAG  438

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGKKNK+VVRI+
Sbjct  439  LFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGKKNKVVVRIA  495



>gb|KEH34424.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=500

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFLKILTFL I+EI +L+ ++  PGY PNTAQRRLAEEVT+FV
Sbjct  325  PYKFYQYFFSVPDADVVRFLKILTFLDIDEIVKLEEEIKKPGYVPNTAQRRLAEEVTKFV  384

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EAL+ATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL+ S++DLSVSSG
Sbjct  385  HGEDGLNEALRATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDDVLNQSLVDLSVSSG  443

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L +SKSAARR+LKQGG+YLNN+RVDSE K+IE  DIVDGKVLLLSAGKKNK++VRI+
Sbjct  444  LFDSKSAARRLLKQGGVYLNNSRVDSENKRIEVADIVDGKVLLLSAGKKNKVLVRIA  500



>gb|KJB12925.1| hypothetical protein B456_002G045400 [Gossypium raimondii]
Length=491

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFLKILTFL +EEI EL++ M  PGY PNTAQR+LAEE+TRFV
Sbjct  316  PYKFYQYFFSVPDADVVRFLKILTFLNMEEINELESAMKKPGYVPNTAQRKLAEEITRFV  375

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEALRPG ++TKLDW+TIEGIA DVPS SLP+ +VL++S++DLSVSSG
Sbjct  376  HGEDGLTEALKATEALRPG-SETKLDWETIEGIAEDVPSRSLPYTEVLNLSIVDLSVSSG  434

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR+LKQGG+YLNN RVD+E+K+IE +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  435  LFESKSAARRLLKQGGIYLNNNRVDNESKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  491



>ref|XP_010927782.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=544

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DVVRFLKILTFL++EEI+EL+ +M   GY PNTAQRRLAEEVTRFV
Sbjct  369  PYKFYQYFFSVPDVDVVRFLKILTFLSMEEIQELEEEMKKQGYVPNTAQRRLAEEVTRFV  428

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EALKATE LRPG A+TKLDW+TIEGIA DVPSC L +DQVL+ S++DLSVS+G
Sbjct  429  HGEEGLAEALKATETLRPG-AETKLDWETIEGIAEDVPSCCLAYDQVLNSSLVDLSVSTG  487

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSAARR++KQGGLYLNN RVD+EAK IE  DIVDGK+LLLSAGKKNK+V+RIS
Sbjct  488  LLSSKSAARRLMKQGGLYLNNRRVDNEAKMIEAGDIVDGKLLLLSAGKKNKIVIRIS  544



>ref|XP_010276894.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=531

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DVVRFLKILTFL++EEI EL+  M  PGY PN+AQRRLAEEVTRFV
Sbjct  356  PYKFYQYFFSVPDVDVVRFLKILTFLSMEEINELEEGMKRPGYTPNSAQRRLAEEVTRFV  415

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EALKATEALRPG A+T LDWKTIEGIA DVPSC+L + QVL+ S++DLSVS+G
Sbjct  416  HGEEGLLEALKATEALRPG-AETVLDWKTIEGIAEDVPSCTLDYKQVLNASLVDLSVSTG  474

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLESKSAARR+LKQGGLYLNN RV+SE + IE  DI+DGKVLLLSAGKKNKM+VRIS
Sbjct  475  LLESKSAARRLLKQGGLYLNNIRVESEIRSIEVGDIIDGKVLLLSAGKKNKMIVRIS  531



>ref|XP_008801775.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=544

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DVVRFL+ILTFL++EEI +L+ +M  PGYAPNTAQRRLAEEVTRFV
Sbjct  369  PYKFYQYFFSVPDVDVVRFLRILTFLSMEEIRKLEDEMKKPGYAPNTAQRRLAEEVTRFV  428

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EALKATE LRPG A+TKLDW+TIEGIA DVPSCSL + QVL+ S++DLSVS+G
Sbjct  429  HGEEGLAEALKATETLRPG-AETKLDWETIEGIAEDVPSCSLAYGQVLNSSLVDLSVSTG  487

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LL SKSAARR++KQGGLYLNN RVD+E K IE  DIVD KVLLLSAGKKNKMV+RI
Sbjct  488  LLSSKSAARRLMKQGGLYLNNRRVDNEEKVIEAGDIVDEKVLLLSAGKKNKMVIRI  543



>ref|XP_007022035.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
 gb|EOY13560.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
Length=486

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFLKILTFL++EEI EL++ M  PGY PNTAQ+RLAEE+TRFV
Sbjct  316  PYKFYQYFFSVPDADVVRFLKILTFLSMEEINELESGMTRPGYVPNTAQQRLAEEITRFV  375

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV+++S++DLSV SG
Sbjct  376  HGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVVNLSIVDLSVCSG  434

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  215
            L ESKSAARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGKKNK
Sbjct  435  LFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGKKNK  485



>ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
 gb|ESR60106.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
Length=493

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADV+RFL+ILTFL +EEI+EL+  M  P Y PNTAQRRLAEEVT FV
Sbjct  318  PYKFYQYFFSVPDADVIRFLRILTFLDLEEIDELEKDMKRPSYVPNTAQRRLAEEVTHFV  377

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL++S++DLSVS+G
Sbjct  378  HGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVLNVSLVDLSVSAG  436

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGKKNK+VVRI+
Sbjct  437  LFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGKKNKVVVRIA  493



>ref|XP_003574045.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=512

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RF+KILTFL+++EI EL+  M  PGY PNT QR LAEEVTRFV
Sbjct  337  PYKFYQYFFSVPDVDVIRFMKILTFLSLDEILELEKSMKRPGYVPNTVQRILAEEVTRFV  396

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EALKAT+ALRPG A T+LD +TIEGIA DVPSCSLP+DQVL   ++DL+ S+G
Sbjct  397  HGQEGLEEALKATQALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVLKSPLVDLAASTG  455

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGKKNKMVVRIS
Sbjct  456  LLASKSAVRRLIKQGGLYLNNIKIDSEDKLVEEGDIVDGKVLLLSAGKKNKMVVRIS  512



>ref|XP_007022034.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY13559.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=542

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFLKILTFL++EEI EL++ M  PGY PNTAQ+RLAEE+TRFV
Sbjct  372  PYKFYQYFFSVPDADVVRFLKILTFLSMEEINELESGMTRPGYVPNTAQQRLAEEITRFV  431

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV+++S++DLSV SG
Sbjct  432  HGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVVNLSIVDLSVCSG  490

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  215
            L ESKSAARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGKKNK
Sbjct  491  LFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGKKNK  541



>gb|EMS54027.1| Tyrosyl-tRNA synthetase [Triticum urartu]
Length=796

 Score =   232 bits (591),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DVVRF+KILTFL++ EI EL+  M  PGY PNT QRRLAEEVTRFV
Sbjct  621  PYKFYQYFFSVPDVDVVRFMKILTFLSLGEIHELEESMKKPGYVPNTVQRRLAEEVTRFV  680

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEG++EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL   ++DL+ S+G
Sbjct  681  HGQEGVEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVLKSPLVDLAASTG  739

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGKKNKMVVRIS
Sbjct  740  LLASKSAVRRLIKQGGLYLNNKKIDSEDKLVEEGDIVDGKVLLLSAGKKNKMVVRIS  796



>ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group]
 dbj|BAB64064.1| putative tyrosine-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF05045.1| Os01g0500900 [Oryza sativa Japonica Group]
 gb|EAY74203.1| hypothetical protein OsI_02083 [Oryza sativa Indica Group]
 dbj|BAG90095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RF+KILTF++++EI+EL+  M  PGY PNT QRRLAEEVTRFV
Sbjct  322  PYKFYQYFFSVPDIDVIRFMKILTFMSLDEIQELEESMKKPGYVPNTIQRRLAEEVTRFV  381

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSC LP+ QVL   ++DL+VS+G
Sbjct  382  HGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCFLPYGQVLKSPLVDLAVSTG  440

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA RR++KQGGLYLNN R+DSE K +EE D+VDGKVLLLSAGKKNKMVVRIS
Sbjct  441  LLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGKVLLLSAGKKNKMVVRIS  497



>ref|XP_008339494.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Malus domestica]
Length=482

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQY FSVPD DVVRFLKILTFL +++I++L+++M  PGY PNTAQRRLAEEVTRFV
Sbjct  305  PYKLYQYLFSVPDVDVVRFLKILTFLDMDDIKQLESEMKRPGYLPNTAQRRLAEEVTRFV  364

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVPSCS P+ QVL +S++DLSVSSG
Sbjct  365  HGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPSCSFPYHQVLDLSLVDLSVSSG  423

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKKNK++V+IS
Sbjct  424  LLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKKNKVLVQIS  480



>ref|XP_008339493.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Malus domestica]
Length=486

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQY FSVPD DVVRFLKILTFL +++I++L+++M  PGY PNTAQRRLAEEVTRFV
Sbjct  309  PYKLYQYLFSVPDVDVVRFLKILTFLDMDDIKQLESEMKRPGYLPNTAQRRLAEEVTRFV  368

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVPSCS P+ QVL +S++DLSVSSG
Sbjct  369  HGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPSCSFPYHQVLDLSLVDLSVSSG  427

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKKNK++V+IS
Sbjct  428  LLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKKNKVLVQIS  484



>ref|XP_011071261.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Sesamum 
indicum]
Length=503

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 160/173 (92%), Gaps = 1/173 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQYFFS+ DADVVRFLKILTFL+I+EI +++++M +PGY PNTAQRRLAEEVTRFV
Sbjct  292  PYQFYQYFFSISDADVVRFLKILTFLSIDEISQIESEMRSPGYVPNTAQRRLAEEVTRFV  351

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGLDEALKAT+ALRPG A+TKLDWKTIE IA DVPS SL  DQVL++S+LDLSV +G
Sbjct  352  HGEEGLDEALKATQALRPG-AETKLDWKTIETIAEDVPSISLQQDQVLNLSLLDLSVRTG  410

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  209
            LLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKV+LLSAGKKNKM+
Sbjct  411  LLESKSAARRLLKQGGLYLNNNRIDSEAKRIEPNDIVDGKVILLSAGKKNKMI  463



>ref|NP_001141566.1| hypothetical protein [Zea mays]
 gb|ACF86629.1| unknown [Zea mays]
 tpg|DAA37471.1| TPA: hypothetical protein ZEAMMB73_107188 [Zea mays]
Length=496

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DV+RF+KILTFL+++EI EL+  M  PGY PNT Q+RLAEEVTRFV
Sbjct  321  PYKFYQYFFAVPDIDVIRFMKILTFLSLDEILELEDSMKKPGYVPNTVQKRLAEEVTRFV  380

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQV    ++DL+VS+G
Sbjct  381  HGEEGLEEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVFKSPLIDLAVSTG  439

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA +R++KQGGLYLNN R+DSE K +EE DIVDGKVLLLSAGKKNKMVVRIS
Sbjct  440  LLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEEGDIVDGKVLLLSAGKKNKMVVRIS  496



>gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japonica Group]
Length=545

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RF+KILTF++++EI+EL+  M  PGY PNT QRRLAEEVTRFV
Sbjct  370  PYKFYQYFFSVPDIDVIRFMKILTFMSLDEIQELEESMKKPGYVPNTIQRRLAEEVTRFV  429

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSC LP+ QVL   ++DL+VS+G
Sbjct  430  HGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCFLPYGQVLKSPLVDLAVSTG  488

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA RR++KQGGLYLNN R+DSE K +EE D+VDGKVLLLSAGKKNKMVVRIS
Sbjct  489  LLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGKVLLLSAGKKNKMVVRIS  545



>ref|XP_008783116.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
 ref|XP_008783117.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=543

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DVVRFL+ILTFL++EEI EL+ +M  P YAPNTAQRRLAEEVTRFV
Sbjct  368  PYKFYQYFFSVPDIDVVRFLRILTFLSMEEIRELEDEMKKPSYAPNTAQRRLAEEVTRFV  427

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATE LRPG A+TKLDW+TIEGIA DVPSCSL + QVL+ S++DLSVS+G
Sbjct  428  HGEDGLTEALKATETLRPG-AETKLDWETIEGIAEDVPSCSLAYGQVLNSSLVDLSVSTG  486

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LL SKSAARR+++QGGLYLNN RVD+EAK IE  DIVD K+LLLSAGKKNKMV++I
Sbjct  487  LLSSKSAARRLMEQGGLYLNNRRVDNEAKVIEAGDIVDEKILLLSAGKKNKMVIKI  542



>ref|XP_010500171.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=505

 Score =   224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L+ QM  PGY PNTAQ +LAEEVTRFV
Sbjct  330  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKILEDQMSKPGYVPNTAQIKLAEEVTRFV  389

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V   S++DLSVS+G
Sbjct  390  HGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGSSIVDLSVSAG  448

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKNK+VVRIS
Sbjct  449  LFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKNKVVVRIS  505



>ref|XP_008361702.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQY FSVPD DVVRFLKILTFL +++I++L+++M  PGY PNTAQRRLAEEVTRFV
Sbjct  305  PYKLYQYLFSVPDVDVVRFLKILTFLDMDDIKQLESEMKRPGYLPNTAQRRLAEEVTRFV  364

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVP CS P+ QVL +S++DLSVSSG
Sbjct  365  HGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPXCSFPYHQVLDLSLVDLSVSSG  423

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKKNK++V+IS
Sbjct  424  LLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKKNKVLVQIS  480



>ref|XP_004982893.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Setaria italica]
Length=494

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DV+RF+KILTFL+++EI+EL+  M  PGY PNT Q+RLAEEVTRFV
Sbjct  319  PYKFYQYFFAVPDVDVIRFMKILTFLSLDEIQELEESMKKPGYVPNTVQKRLAEEVTRFV  378

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQVL   ++DL+VS+G
Sbjct  379  HGEEGLVEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVLKSPLVDLAVSTG  437

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA +R++KQGGLYLNN R+DSE K +EE DIVDGKVLLLSAGKKNKMVVRIS
Sbjct  438  LLASKSAVKRLIKQGGLYLNNIRIDSEDKLVEEGDIVDGKVLLLSAGKKNKMVVRIS  494



>ref|XP_009355255.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355256.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355257.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355258.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQY FSVPD DVVRFLKILTFL +++I++L+++M  PGY PNTAQRRLAEEVTRFV
Sbjct  305  PYKLYQYLFSVPDVDVVRFLKILTFLDMDDIKQLESEMERPGYLPNTAQRRLAEEVTRFV  364

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG ADTKLDW  I+ I+ DVPSCS P+ +VL++S+LDLSVSSG
Sbjct  365  HGQDGLDEALKATEAMRPG-ADTKLDWNAIKAISEDVPSCSFPYHEVLNLSILDLSVSSG  423

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGKKNK++V+IS
Sbjct  424  LLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGKKNKVLVQIS  480



>ref|XP_004299915.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
 ref|XP_011464831.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYF SV DADVVRFLKILTFL + +I+++++ M  PGY PNTAQRRLAEEVTRFV
Sbjct  309  PYKFYQYFISVSDADVVRFLKILTFLDMNDIKQIESDMKRPGYLPNTAQRRLAEEVTRFV  368

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ GLDEALKATEA+RPG ADT LDW T++ I+ DVPSCS P+ QVL + V+DLSVSSG
Sbjct  369  HGQNGLDEALKATEAMRPG-ADTNLDWNTMQAISEDVPSCSFPYHQVLDLPVVDLSVSSG  427

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ++KSAARR+LKQGGLY+NN RV+SE+K+IE  DIVDGK+LLLSAGKKNK++VRIS
Sbjct  428  LFDTKSAARRLLKQGGLYMNNLRVESESKRIEPQDIVDGKLLLLSAGKKNKVLVRIS  484



>ref|XP_009355254.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQY FSVPD DVVRFLKILTFL +++I++L+++M  PGY PNTAQRRLAEEVTRFV
Sbjct  309  PYKLYQYLFSVPDVDVVRFLKILTFLDMDDIKQLESEMERPGYLPNTAQRRLAEEVTRFV  368

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG ADTKLDW  I+ I+ DVPSCS P+ +VL++S+LDLSVSSG
Sbjct  369  HGQDGLDEALKATEAMRPG-ADTKLDWNAIKAISEDVPSCSFPYHEVLNLSILDLSVSSG  427

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGKKNK++V+IS
Sbjct  428  LLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGKKNKVLVQIS  484



>ref|XP_010500039.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010500108.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=511

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L+ QM  PGY PNTAQ +LAEEVTRFV
Sbjct  336  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKILEDQMSKPGYVPNTAQIKLAEEVTRFV  395

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V   S++DLSVS+G
Sbjct  396  HGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGSSIVDLSVSAG  454

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKNK+VVRIS
Sbjct  455  LFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKNKVVVRIS  511



>ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L+ QM  PGY PNTAQ +LAEEVTRFV
Sbjct  336  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKILEDQMSKPGYVPNTAQIKLAEEVTRFV  395

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V  +S++DLSVS+G
Sbjct  396  HGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGLSIVDLSVSAG  454

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKNK+VVRIS
Sbjct  455  LFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKNKVVVRIS  511



>ref|XP_008347911.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347912.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347913.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365305.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365306.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365307.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQY FSVPD DVVRFLKILTFL +++I++L+++M  PGY PNTAQRRLAEEVTRFV
Sbjct  305  PYKLYQYLFSVPDVDVVRFLKILTFLDMDDIKQLESEMERPGYLPNTAQRRLAEEVTRFV  364

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS  + QVL +S+LDLSVSSG
Sbjct  365  HGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFLYHQVLDLSILDLSVSSG  423

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGKKNK++V+IS
Sbjct  424  LLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGKKNKVLVQIS  480



>ref|XP_009348746.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348747.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348748.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348749.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQY FSVPD DVVRFLKILTFL +++I++L+ +M  PGY PNTAQ RLAEEVTRFV
Sbjct  305  PYKLYQYLFSVPDVDVVRFLKILTFLDMDDIKQLEREMERPGYLPNTAQCRLAEEVTRFV  364

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS P+ QVL +S++DLSVSSG
Sbjct  365  HGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFPYHQVLDLSLVDLSVSSG  423

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKKNK++V+I+
Sbjct  424  LLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKKNKVLVQIN  480



>ref|XP_002447960.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
 gb|EES12288.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
Length=521

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DV+RF+KILTFL+++EIEEL+  M  PGY PNT Q+RLAEEVTRFV
Sbjct  346  PYKFYQYFFAVPDIDVIRFMKILTFLSLDEIEELEDSMKKPGYVPNTVQKRLAEEVTRFV  405

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQV    ++DL+VS+G
Sbjct  406  HGEEGLEEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVFKSPLVDLAVSTG  464

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL SKSA +R++KQGGLYLNN R+DSE K +E+ DIVDGKVLLLSAGKKNKMVVRIS
Sbjct  465  LLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEDGDIVDGKVLLLSAGKKNKMVVRIS  521



>ref|XP_009348745.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQY FSVPD DVVRFLKILTFL +++I++L+ +M  PGY PNTAQ RLAEEVTRFV
Sbjct  309  PYKLYQYLFSVPDVDVVRFLKILTFLDMDDIKQLEREMERPGYLPNTAQCRLAEEVTRFV  368

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS P+ QVL +S++DLSVSSG
Sbjct  369  HGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFPYHQVLDLSLVDLSVSSG  427

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKKNK++V+I+
Sbjct  428  LLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKKNKVLVQIN  484



>ref|XP_010463686.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010463687.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++ I+ L+ QM  PGY PNT Q +LAEEVTRFV
Sbjct  336  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDAIKILEDQMSKPGYVPNTVQIKLAEEVTRFV  395

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V   S++DLSVS+G
Sbjct  396  HGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGSSIVDLSVSAG  454

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKNK+VVRIS
Sbjct  455  LFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKNKVVVRIS  511



>emb|CAN64191.1| hypothetical protein VITISV_016956 [Vitis vinifera]
Length=868

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 155/167 (93%), Gaps = 1/167 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPDADVVRFLKILTFL ++EI EL+ +M +P Y PNTAQRRLAEE TRFV
Sbjct  310  PYKFYQYFFSVPDADVVRFLKILTFLDMDEIMELEVKMRSPSYVPNTAQRRLAEEATRFV  369

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGLDEALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D+VL++S+LDLS+S+G
Sbjct  370  HGQEGLDEALKATEALRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVLNLSLLDLSISTG  428

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  227
            LLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAG
Sbjct  429  LLESKSAARRLLKQGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAG  475



>ref|XP_009414004.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=535

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFF+VPD DV+RFLKILTFL++EEI EL+ +M  PGY PNT QRRLAEEVTRFV
Sbjct  360  PYKFYQYFFAVPDVDVIRFLKILTFLSMEEIRELEEEMKKPGYVPNTVQRRLAEEVTRFV  419

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKATEALRPG A+T+LD +TIEGI+ DVPSCSL + QVL+ S++DLSVS+G
Sbjct  420  HGEDGLAEALKATEALRPG-AETRLDAETIEGISEDVPSCSLAYYQVLNSSLIDLSVSTG  478

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL +KSA RR++KQGGLYLNN RVD+E K++EE DI+DGK+LLLSAGKKNKMVVRIS
Sbjct  479  LLSTKSAVRRLMKQGGLYLNNKRVDTEEKRVEEADIIDGKILLLSAGKKNKMVVRIS  535



>ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|ABK32110.1| At3g02660 [Arabidopsis thaliana]
 gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
Length=511

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L+ QM  PGY PNTAQ +LAEEVTRFV
Sbjct  336  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKILEDQMSKPGYVPNTAQIKLAEEVTRFV  395

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V  +S++DLSVS+G
Sbjct  396  HGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGLSIVDLSVSAG  454

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG Y+NN RVD E K+++E+DIV+G+ L+LSAGKKNK+VVRIS
Sbjct  455  LFESKSAARRMLKQGGFYMNNERVDDENKRVDEEDIVEGRGLVLSAGKKNKVVVRIS  511



>ref|XP_010485586.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010485587.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 152/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL++++I+ L+ QM  PGY PNTAQ +LAEEVTRFV
Sbjct  336  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDDIKILEDQMSKPGYVPNTAQIKLAEEVTRFV  395

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSL  D+V   S++DLSVS+G
Sbjct  396  HGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLSIDRVSGSSIVDLSVSAG  454

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKNK+VVRIS
Sbjct  455  LFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKNKVVVRIS  511



>ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
 gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
Length=548

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L  QM  PGY PNTAQ +LAEEVTRFV
Sbjct  373  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKILGDQMSKPGYVPNTAQIKLAEEVTRFV  432

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE I+ D+PSCSLP D+VL +S++DLSVS+G
Sbjct  433  HGEEGLKEAIKATEALRPG-AETKLDWNLIERISEDIPSCSLPIDRVLGLSIVDLSVSAG  491

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG Y+NN RVD E +++EE+DIV+GK L+LSAGKKNK+VVRIS
Sbjct  492  LFESKSAARRMLKQGGFYMNNERVDDENRRVEEEDIVEGKGLVLSAGKKNKVVVRIS  548



>ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
Length=499

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L+ QM  PGY PNTAQ +LA EVTRFV
Sbjct  324  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKILEDQMSKPGYVPNTAQIKLAAEVTRFV  383

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKL+W  IE IA D+PSCSLP D+V   SV+DLSVS+G
Sbjct  384  HGEEGLKEAIKATEALRPG-AETKLEWNLIERIAEDIPSCSLPIDRVSGFSVVDLSVSAG  442

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAA+RMLKQGG+Y+NNARVD E K++EE DI+DGK L+LS+GKKNK+VVRIS
Sbjct  443  LFESKSAAKRMLKQGGIYMNNARVDDENKRVEEADIIDGKGLVLSSGKKNKVVVRIS  499



>gb|EYU42284.1| hypothetical protein MIMGU_mgv1a005712mg [Erythranthe guttata]
Length=473

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQYFFS+ D DVVRFLKILTFL+I+EI +++T+M  P Y PN+AQR+LAEEVTRFV
Sbjct  298  PYQFYQYFFSISDTDVVRFLKILTFLSIDEISQIETEMRGPNYVPNSAQRKLAEEVTRFV  357

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL+EA+KAT ALRPG ++TKLDW +IE IA DVPS SL  DQVL++S+LDLSV SG
Sbjct  358  HGEEGLEEAMKATMALRPG-SETKLDWNSIESIAEDVPSVSLGKDQVLNLSLLDLSVCSG  416

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARRMLKQGGLYLNN RVDSE ++IE DDIVDGKV+LLSAGKKNKM+VRIS
Sbjct  417  LLDSKSAARRMLKQGGLYLNNNRVDSEGRRIEIDDIVDGKVILLSAGKKNKMIVRIS  473



>ref|XP_010549888.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Tarenaya hassleriana]
Length=516

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI  L+ QMG  GY PNTAQ++LAEEVTRFV
Sbjct  340  PYKFYQYFFSVPDTDVIRFLKTLTFLSLDEIRALEDQMGRSGYVPNTAQKKLAEEVTRFV  399

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA++ATEALRPG  +TKLDWK IE IA D+PSCSL  ++VL+ S++D++VSSG
Sbjct  400  HGEEGLREAIRATEALRPGT-ETKLDWKMIEKIAEDIPSCSLAKEEVLNSSIIDIAVSSG  458

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LLES+SAARRM+KQGG+YLNN RV+ E+K++ +DDIV+GKVLLLSAGKKNK+VVRIS
Sbjct  459  LLESRSAARRMMKQGGIYLNNERVEEESKRVGDDDIVEGKVLLLSAGKKNKIVVRIS  515



>ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
 gb|ESW14056.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
Length=478

 Score =   218 bits (554),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFS+PD DV+RFL+ILTFL IEEI  L+ +M  P Y PNTAQ+RLA+EVT FV
Sbjct  303  PYKFYQYFFSIPDTDVIRFLRILTFLDIEEIVALEREMMKPDYVPNTAQQRLAKEVTLFV  362

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EAL+ATEAL+PG+  TKLDWK+IEGIA D+PSCSLP++ VL++S++DLSVSSG
Sbjct  363  HGEDGLAEALQATEALKPGSG-TKLDWKSIEGIAEDLPSCSLPYEDVLNLSLVDLSVSSG  421

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR+LKQGGLYLNN+RVD+E K+IE  DIVDGKVLLLSAGKKNK++VRI+
Sbjct  422  LFESKSAARRLLKQGGLYLNNSRVDNEGKRIEAADIVDGKVLLLSAGKKNKVLVRIA  478



>gb|EYU24457.1| hypothetical protein MIMGU_mgv1a005745mg [Erythranthe guttata]
Length=472

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQYFFS+ D DVVRFLKILTFL+I+EI +++T+M  P Y PN+AQR+LAEEVTRFV
Sbjct  297  PYQFYQYFFSISDTDVVRFLKILTFLSIDEISQIETEMRGPNYVPNSAQRKLAEEVTRFV  356

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL+EA+KAT ALRPG ++TKLDW +IE IA DVPS SL  D+VL++S+LDLSV SG
Sbjct  357  HGEEGLEEAMKATMALRPG-SETKLDWNSIESIAEDVPSVSLEKDRVLNLSLLDLSVCSG  415

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SKSAARRMLKQGGLYLNN RVDSE ++IE DDIVDGKV+LLSAGKKNKM+VRIS
Sbjct  416  LLDSKSAARRMLKQGGLYLNNNRVDSEGRRIEIDDIVDGKVILLSAGKKNKMIVRIS  472



>ref|XP_009134705.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134706.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134707.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
Length=500

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L+ +M  PGY PNT Q +LAEEVTRFV
Sbjct  325  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKTLEDEMRKPGYVPNTVQMKLAEEVTRFV  384

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V  +S++D+SVS+G
Sbjct  385  HGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVAGVSIVDVSVSAG  443

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GKKNK+V+RIS
Sbjct  444  LFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGKKNKVVIRIS  500



>emb|CDX74240.1| BnaA03g28070D [Brassica napus]
Length=500

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L+ +M  PGY PNT Q +LAEEVTRFV
Sbjct  325  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKTLEDEMRKPGYVPNTVQMKLAEEVTRFV  384

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V  +S++D+SVS+G
Sbjct  385  HGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVAGVSIVDVSVSAG  443

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GKKNK+V+RIS
Sbjct  444  LFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGKKNKVVIRIS  500



>ref|XP_009134703.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Brassica rapa]
Length=520

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ L+ +M  PGY PNT Q +LAEEVTRFV
Sbjct  345  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKTLEDEMRKPGYVPNTVQMKLAEEVTRFV  404

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V  +S++D+SVS+G
Sbjct  405  HGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVAGVSIVDVSVSAG  463

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GKKNK+V+RIS
Sbjct  464  LFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGKKNKVVIRIS  520



>gb|EPS58486.1| hypothetical protein M569_16327, partial [Genlisea aurea]
Length=428

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ+FFSV D++V+RFL++LTFL IE+I +++ QM +PGY PNTAQ RLAEE+TRFV
Sbjct  254  PYRFYQHFFSVADSEVIRFLRMLTFLPIEDISQIEEQMQSPGYIPNTAQIRLAEELTRFV  313

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KAT AL PGN +T L W++IEGIA DVPSC L  +QVL+ S++DLSV++G
Sbjct  314  HGEEGLAEAVKATRALNPGN-ETNLRWESIEGIAGDVPSCRLNRNQVLNSSLVDLSVATG  372

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L+ES+SAARR+LKQGGLYLNN RVD+E KKIE+DDIVDGK+LLLSAGKKNKMVVRI
Sbjct  373  LVESRSAARRLLKQGGLYLNNVRVDNEGKKIEDDDIVDGKILLLSAGKKNKMVVRI  428



>ref|XP_009118453.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118460.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118468.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118475.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=503

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RFLK LTFL+++EI+ ++ +M  PGY PN+AQ +LAEEVTRFV
Sbjct  328  PYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKIVEDEMRRPGYVPNSAQMKLAEEVTRFV  387

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V  +S++D+SVS+G
Sbjct  388  HGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPTCSLPIDRVSGVSIVDVSVSAG  446

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L ESKSAARR LKQGG+Y+NN RVD E K++EE+DIV+GK L+LS+GKKNK+V+RIS
Sbjct  447  LFESKSAARRTLKQGGVYMNNQRVDDENKRVEEEDIVEGKGLVLSSGKKNKVVIRIS  503



>ref|XP_006826574.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Amborella 
trichopoda]
 gb|ERM93811.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
Length=495

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQYFFSVPDADV+ FLKILTFL++EEI EL+  M  PGY PN+ QRRLAEEVTRFV
Sbjct  318  PYQFYQYFFSVPDADVINFLKILTFLSLEEIAELEKGMSGPGYEPNSVQRRLAEEVTRFV  377

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EA+KATEAL+PG ++ KLD K IE I +DVPSC L + +VL+ S++DLSV+SG
Sbjct  378  HGKDGLLEAVKATEALKPG-SEAKLDSKIIEEIGADVPSCCLDYHEVLNRSLVDLSVASG  436

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LLESKSAARR++KQGGLYLNN RV+ E   +EE+DIVDGKVLLLSAGKKNKMV++I
Sbjct  437  LLESKSAARRLMKQGGLYLNNKRVNGEDILVEEEDIVDGKVLLLSAGKKNKMVIKI  492



>ref|XP_002992920.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
 gb|EFJ06009.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
Length=467

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ+ F+ PD+DV++ L++LTF+ +EEIE L+  M  PGY  NTAQRRLAEEVTRFV
Sbjct  293  PYHFYQHLFATPDSDVIKMLRMLTFVELEEIEALEKSMSEPGYVANTAQRRLAEEVTRFV  352

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EALK T+AL PG+  T LDW  IE I+ DVPSC+L    V+   V+DL VS G
Sbjct  353  HGEDGLEEALKVTQALSPGST-TTLDWTAIEAISRDVPSCTLD-SSVVVGPVVDLCVSCG  410

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L  SK+ ARR++KQGG+Y+NNA+VD E   + E DI+DGK+LLLSAGKKNKMVVRI
Sbjct  411  LAPSKAVARRLIKQGGIYMNNAKVDDERLLVAESDIIDGKMLLLSAGKKNKMVVRI  466



>ref|XP_002980036.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
 gb|EFJ18906.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
Length=467

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ+ F+ PD+DV++ L++LTF+ +EEIE L+  M  PGY  NTAQRRLAEEVTRFV
Sbjct  293  PYHFYQHLFATPDSDVIKMLRMLTFVELEEIEALEKSMSEPGYVANTAQRRLAEEVTRFV  352

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL+EALK T+AL PG+  T LDW  IE I+ DVPSC+L    ++   V+DL VS G
Sbjct  353  HGEDGLEEALKVTQALAPGST-TTLDWTAIEAISKDVPSCTLD-SSIVVGPVVDLCVSCG  410

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L  SK+ ARR++KQGG+Y+NNA+VD E   + E DI+DGK+LLLSAGKKNKMVVRI
Sbjct  411  LAPSKAVARRLIKQGGIYMNNAKVDDERLLVAESDIIDGKMLLLSAGKKNKMVVRI  466



>ref|XP_002955541.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
 gb|EFJ43394.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
Length=520

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQY F V DADV++ LK+LTFL +EEI+ L+  MG PGY PNTAQRRLAEEVTRFV
Sbjct  343  PYKFYQYLFQVTDADVIKLLKMLTFLPLEEIDGLQAAMGAPGYVPNTAQRRLAEEVTRFV  402

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL +A+KATEAL+PG A T+LD  T+E +A D PS +L    V  + + D+ V+  
Sbjct  403  HGEEGLAQAIKATEALKPGAA-TQLDAATLETVAGDAPSATLTRGSVEGVPLADILVAVK  461

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L  SKSAAR+++K GG+YLNNA+V  E   ++  D++DG++LL++AGKKNKM+VR++
Sbjct  462  LQPSKSAARKLIKGGGVYLNNAKVSEELYTVKPSDLIDGRLLLIAAGKKNKMLVRVA  518



>ref|XP_001699082.1| hypothetical protein CHLREDRAFT_139405 [Chlamydomonas reinhardtii]
 gb|EDO98937.1| predicted protein [Chlamydomonas reinhardtii]
Length=492

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQY F V DADVV+ LK+LTFL + E+E L+  M  PGY PNTAQ+RLAEEVTRFV
Sbjct  316  PYKFYQYLFQVTDADVVKLLKMLTFLPLPEVEALEAAMRAPGYVPNTAQKRLAEEVTRFV  375

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL +ALKATEAL+PG A T+LD  T+E +A D PS SLP   V    + D+ V+  
Sbjct  376  HGEEGLAQALKATEALKPGAA-TQLDAATLEEVAGDAPSASLPRASVAGAPLADVMVAIK  434

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L  SKSAAR+++K GG+YLNNA+V  E   +  +D++DG++LL++AGKKNKM+VRI
Sbjct  435  LQPSKSAARKLIKGGGVYLNNAKVVEELYVVRPEDLIDGRLLLVAAGKKNKMLVRI  490



>ref|XP_005848281.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
 gb|EFN56179.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
Length=440

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 136/177 (77%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ+ F   DADV++FL++LTFL +EEIE L   M +PGY  NTAQRRLAEEVTRFV
Sbjct  265  PYQFYQFLFKTADADVLKFLRMLTFLPLEEIEALGASMQSPGYVANTAQRRLAEEVTRFV  324

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL +ALKATEAL PG A TKLD  ++E  A D PS SLP DQV+   + D+ V+ G
Sbjct  325  HGEEGLRQALKATEALAPGAA-TKLDADSLEAAAGDAPSASLPRDQVVGAPLADVMVAVG  383

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            +  SK+A RRM+K GG+ +NN +VD E   + EDD++DG+++L++AGKKNKM+VR++
Sbjct  384  MQPSKAAVRRMIKGGGVRVNNEKVDDELAALGEDDLIDGRLVLIAAGKKNKMLVRVA  440



>ref|XP_003059850.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55802.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=430

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQ+     DADVVRF+K LTF+ IEEIE ++  M   GYAPNTAQ+RLAEEVTRFV
Sbjct  256  PYKFYQHLLQSTDADVVRFMKTLTFVPIEEIEAMEAAMKEDGYAPNTAQKRLAEEVTRFV  315

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+ GL +ALKATE L+PG ADT LD  T+E +A D+PS  L   +V+  +V+D+  ++G
Sbjct  316  HGEAGLSQALKATEGLKPG-ADTVLDADTLEALAGDIPSAELSLGEVVGRTVVDVMAATG  374

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L +SK  A+R++K GG  +NN +V+ E K IEE D+VDG+VLLL+AGKKNK++VR+
Sbjct  375  LQKSKGEAKRLIKGGGARVNNVKVEDEGKVIEEGDVVDGRVLLLAAGKKNKLLVRV  430



>ref|XP_002504529.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65787.1| predicted protein [Micromonas sp. RCC299]
Length=506

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQY     DADVVRF+++LTF+ + EIE ++  M   GY PNTAQ+RLAEEVTRFV
Sbjct  331  PYKFYQYMLQSTDADVVRFMRMLTFVPLAEIEAIEASMSADGYVPNTAQKRLAEEVTRFV  390

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL +ALKATE L+PG ADT LD  T+E +A D+P+  L  D+V+  +V+D+  ++G
Sbjct  391  HGKEGLTQALKATEGLKPG-ADTVLDAATLEALAGDIPTAELARDEVVGKTVVDVMAATG  449

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L +SK  A+RM+K GG  LNN +V+ E   I EDD+++G+VLLL+AGKKNK++VR+
Sbjct  450  LQKSKGEAKRMIKGGGARLNNVKVEDEEATIGEDDVIEGRVLLLAAGKKNKLLVRV  505



>ref|XP_001751567.1| predicted protein [Physcomitrella patens]
 gb|EDQ83884.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ+ F+ PDADV++F+K LTF+ I+EIE L+  M  PGYAPN+ Q+RLAEEVTRFV
Sbjct  327  PYNFYQHLFATPDADVIKFMKRLTFVDIKEIEALEASMKQPGYAPNSVQKRLAEEVTRFV  386

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++GL EALKAT+AL P  A   LD +T+E IA DVPSCS+ +  V+   ++D+SVS+G
Sbjct  387  HGEQGLTEALKATQALAP-GAAAALDSQTLEAIAQDVPSCSISYS-VVGKPLVDVSVSTG  444

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            LL+SK+A RR++KQGGLYLNN +V+ E K +  +DI+D K+ LLSAGKKN++VVR++
Sbjct  445  LLQSKAAVRRLIKQGGLYLNNVKVEDEGKTMVAEDIIDDKIFLLSAGKKNRLVVRVT  501



>ref|XP_005650588.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE26044.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=450

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = -2

Query  727  PYKFYQYFF-SVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            P+KFYQY   SV DA+V++FL++LTF+ +E+I +L+  M  PGY PNTAQR LA EVTRF
Sbjct  273  PFKFYQYLLTSVGDAEVIKFLRMLTFVPLEDIAQLEASMQQPGYQPNTAQRLLASEVTRF  332

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHGQ GLD+AL AT+AL PG +DTKLD  T+E +A   P+  LP  QVL  ++ D+ V+ 
Sbjct  333  VHGQLGLDQALNATQALAPG-SDTKLDIDTLEAVAGSAPTVELPAGQVLGQTLADIMVAI  391

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
             L ESKSA RR++K GG+ +NN +V  E +++ EDD +DG++ L++AGKKNKM++RIS
Sbjct  392  KLQESKSAGRRLIKGGGVRVNNQKVSDEQRRLSEDDFIDGRLALIAAGKKNKMLLRIS  449



>gb|KIZ02509.1| tyrosyl-tRNA synthetase [Monoraphidium neglectum]
Length=155

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = -2

Query  616  MGNPGYAPNTAQRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDV  437
            M  PGY PNTAQRRLAE +T FVHG EGL  ALKATEALRPG A T+LD  T+E IA D 
Sbjct  17   MAQPGYVPNTAQRRLAEALTEFVHGPEGLATALKATEALRPGAA-TELDAATLEAIAGDA  75

Query  436  PSCSLPFDQvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIV  257
            P+CSL  +QV    ++D+ V+SG+L SK   RRM+K GG+YLNNA+V  + + +   D++
Sbjct  76   PTCSLKREQVEGQLLVDVVVASGMLPSKGEVRRMVKNGGVYLNNAKVADDKRALTPADLI  135

Query  256  DGKVLLLSAGKKNKMVVRI  200
            DG++ LL+ GKKNKM+VR+
Sbjct  136  DGRLALLACGKKNKMLVRV  154



>ref|XP_001416448.1| Tyrosyl-tRNA synthetase, probable [Ostreococcus lucimarinus CCE9901]
 gb|ABO94741.1| Tyrosyl-tRNA synthetase, probable [Ostreococcus lucimarinus CCE9901]
Length=484

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 125/177 (71%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYF +V DADV+R LK+LTF+ + E+ E +  M  P Y  NT QRRLAEEVTRFV
Sbjct  309  PYKFYQYFLNVDDADVIRLLKMLTFVPLAEVLEYERHMSQPSYIVNTVQRRLAEEVTRFV  368

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG +GL+EA  AT  L+PG ADT LD   +  +   VPS +LP  QVL IS++ L+V  G
Sbjct  369  HGVQGLEEAQAATSVLKPG-ADTDLDVTALTALEGIVPSATLPMQQVLGISLVQLAVDVG  427

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L  SK A +R+++ GGL LNN +V S+   +   DIVDG++LLL+AGKKNK+++ ++
Sbjct  428  LQPSKGATKRLIQGGGLRLNNIKVLSDEATVSMADIVDGRLLLLAAGKKNKLLISVT  484



>ref|XP_010229641.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Brachypodium distachyon]
Length=473

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQYFFSVPD DV+RF+KILTFL+++EI EL+  M  PGY PNT QR LAEE+TRFV
Sbjct  337  PYKFYQYFFSVPDVDVIRFMKILTFLSLDEILELEKSMKRPGYVPNTVQRILAEEITRFV  396

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  410
            HGQEGL+EALKAT+ALRPG A T+LD +TIEGIA DVPSCSLP+DQ
Sbjct  397  HGQEGLEEALKATQALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQ  441



>ref|XP_003075033.1| TyrS Tyrosyl-tRNA synthetase, probable (IC) [Ostreococcus tauri]
 emb|CAL52305.2| Aminoacyl-tRNA synthetase, class Ic [Ostreococcus tauri]
Length=488

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQY  +  D DV+R L++LTFL+++EI  ++  M   GY PNTAQ+ LA EVTRFV
Sbjct  310  PYHFYQYLLNTADGDVIRLLRMLTFLSLDEIASIEGSMAEAGYIPNTAQQILAAEVTRFV  369

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+GLDEA++ATE+LRPG  +T LD   +E  +  +PS ++    V+   V D+ V SG
Sbjct  370  HGQDGLDEAIRATESLRPGT-ETVLDAAALELASDTIPSVAISRVAVVDNLVTDVVVVSG  428

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LLESK AA+RML+ GG+ +NN +V  E + I E DI+   +LLL+AGKKNK+++R+
Sbjct  429  LLESKGAAKRMLRNGGIRVNNNKVTDETRTIVEGDIIGDNMLLLAAGKKNKLLIRL  484



>emb|CBI22389.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 98/104 (94%), Gaps = 1/104 (1%)
 Frame = -2

Query  508  EALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssglleSKSAARRMLK  329
            + +RPG A+TKLDWKTIEGIA DVPSCSL +D+VL++S+LDLS+S+GLLESKSAARR+LK
Sbjct  297  DVVRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVLNLSLLDLSISTGLLESKSAARRLLK  355

Query  328  QGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            QGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  356  QGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  399



>ref|WP_032125960.1| tyrosyl-tRNA synthetase [Chlamydia sp. 'Diamant']
Length=424

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFVH  545
            Y+FYQY   V DADV+  +++LTF+ + EI   +  M    Y P TAQ+RLAEE+TR VH
Sbjct  249  YEFYQYLVRVEDADVINLMRMLTFMDMAEIRTYEKMMKEADYVPRTAQKRLAEEITRMVH  308

Query  544  GQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssgl  365
            G EGL  A+K TE + PG + TKLD + +E +A+D+PSC + FD V++  ++DL V +GL
Sbjct  309  GGEGLKTAIKVTEGIAPG-SQTKLDAEMLESLAADMPSCEMAFDSVVNKKLIDLLVEAGL  367

Query  364  leSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              SK  A+R+L+ GG+Y+NN +++ E   + ++ ++  +++LL+AGKKNKM++R+
Sbjct  368  QASKGDAKRLLRNGGVYINNEKIEDENCVVGDNYLISNRLILLAAGKKNKMLIRL  422



>ref|WP_042103652.1| tyrosyl-tRNA synthetase [Parachlamydiaceae bacterium HS-T3]
Length=420

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 124/176 (70%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ+ F   DADV++ +++LTF+ ++EI++ + +M  P Y+PN AQ+RLAEEVTR V
Sbjct  245  PYEFYQHLFRTTDADVIKLMRMLTFMEMDEIKQYEQEMKLPNYSPNFAQKRLAEEVTRIV  304

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL  A+K T+A +PG A T L  + +E ++ D+PS  LP   +++  ++D+   SG
Sbjct  305  HGEEGLQTAIKVTQAAKPG-AQTDLSLEALEMLSRDMPSIQLPLADLVNKKIVDVLALSG  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L  SKS AR+++K GG YLNN +V      I+  D++  K+LLL+ GKKNK++V++
Sbjct  364  LQSSKSEARKLIKNGGFYLNNHQVLDIDAAIQPSDLIGEKMLLLAVGKKNKLLVKV  419



>ref|WP_013182397.1| tyrosyl-tRNA synthetase [Waddlia chondrophila]
 gb|ADI38686.1| Tyrosyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
 emb|CCB90919.1| tyrosyl-tRNA synthetase [Waddlia chondrophila 2032/99]
Length=427

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 124/180 (69%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQY   V D DV+R +K+LTF+ ++EI + ++ M    Y PNTAQ+RLA EVT+ V
Sbjct  248  PYQFYQYLVRVQDNDVIRLMKMLTFMEMDEIRKYESMMEREDYVPNTAQKRLAAEVTQMV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG +GL  ALK TEA +PG  +T L+ + +E IA D+PS +   +++++  ++D+ V +G
Sbjct  308  HGDQGLKTALKVTEAAKPGR-ETDLNAEVLESIAHDMPSETFKAEEIVNNKLIDVVVLTG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS*PI  188
            L ESK  ARR+++ GG YLNN ++  E      DD VDG+++LL+ GKKNK ++R+  P+
Sbjct  367  LQESKGQARRLIRNGGCYLNNKKMTEENHVFTADDFVDGRLILLAVGKKNKKLIRLDKPV  426



>ref|WP_042279297.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia sp. R18]
Length=425

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFVH  545
            Y+FYQ+   V DADV+  +++LTFL + EI   +  M    Y P TAQ+RLAEE+TR VH
Sbjct  249  YEFYQHLIRVEDADVINLMRMLTFLDMGEIRHYEQMMKEADYVPRTAQKRLAEEITRLVH  308

Query  544  GQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssgl  365
            G+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL+  ++DL   + L
Sbjct  309  GEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVLNKKLIDLLAETKL  367

Query  364  leSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              SKS ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGKKNKM++R+
Sbjct  368  QTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGKKNKMIIRL  422



>ref|WP_039359281.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
Length=425

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFVH  545
            Y+FYQ+   V DADV+  +++LTFL + EI   +  M    Y P TAQ+RLAEE+TR VH
Sbjct  249  YEFYQHLIRVEDADVINLMRMLTFLDMGEIRHYEQMMKEADYVPRTAQKRLAEEITRLVH  308

Query  544  GQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssgl  365
            G+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL+  ++DL   + L
Sbjct  309  GEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVLNKKLIDLLAETKL  367

Query  364  leSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              SKS ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGKKNKM++R+
Sbjct  368  QTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGKKNKMIIRL  422



>ref|WP_011175719.1| tyrosine--tRNA ligase [Candidatus Protochlamydia amoebophila]
 sp|Q6MC06.1|SYY_PARUW RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23893.1| probable tyrosine-tRNA ligase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=425

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 120/175 (69%), Gaps = 1/175 (1%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFVH  545
            Y+FYQ+   V DADV+  +++LTFL + EI   +  M    Y P TAQ+RLAEE+TR VH
Sbjct  249  YEFYQHLIRVEDADVINLMRMLTFLDMGEIRHYEQMMKEADYVPRTAQKRLAEEITRLVH  308

Query  544  GQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssgl  365
            G+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL+  ++DL V + L
Sbjct  309  GEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVLNKKLIDLLVETKL  367

Query  364  leSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              SKS ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGKKNKM++R+
Sbjct  368  QTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGKKNKMIIRL  422



>gb|KIC71389.1| Tyrosine--tRNA ligase [Candidatus Protochlamydia amoebophila]
Length=437

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFVH  545
            Y+FYQ+   V DADV+  +++LTFL + EI   +  M    Y P TAQ+RLAEE+TR VH
Sbjct  261  YEFYQHLIRVEDADVINLMRMLTFLDMGEIRHYEQMMKEADYVPRTAQKRLAEEITRLVH  320

Query  544  GQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssgl  365
            G+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL+  ++DL   + L
Sbjct  321  GEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVLNKKLIDLLAETKL  379

Query  364  leSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              SKS ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGKKNKM++R+
Sbjct  380  QTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGKKNKMIIRL  434



>emb|CDZ80947.1| Tyrosine--tRNA ligase [Chlamydia sp. 'Rubis']
Length=419

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 122/177 (69%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQYF  V DADV++ +K+LTF+ + EI  ++ QM    Y PNTAQ+RLA  +T  V
Sbjct  243  PYEFYQYFIRVSDADVIKLMKMLTFMDLSEICTIERQMKESDYIPNTAQKRLAHVMTELV  302

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+  L  ALK T+ + PG A T+LD +T++ ++ D+ SC L + +V++  +LDL V SG
Sbjct  303  HGENNLQLALKVTQGIAPG-AITQLDSQTLQALSKDLGSCQLSYKEVVNHKILDLLVKSG  361

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L  SK+ AR+ +  GG+YLNN ++  E   + +  ++DG +LLLS GKKNK+VV+++
Sbjct  362  LQPSKTQARKSMTSGGIYLNNEKITDEEAVLLDKHLIDGNMLLLSFGKKNKIVVQLN  418



>ref|WP_006340872.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|EFB41848.1| hypothetical protein pah_c022o146 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86267.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
Length=430

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQY F V DADV++ +KILTF+ ++EI   +  M    Y  NTAQR+LAEEVTR V
Sbjct  248  PYEFYQYLFRVADADVIKLMKILTFMEMDEIRIYEKMMTQSDYVANTAQRKLAEEVTRIV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL  ALK TE   PG A T LD + +  +A D+P+ ++  + +L+  ++D+     
Sbjct  308  HGEEGLRIALKVTEGAAPGAA-TALDAEVLNNLADDMPNYTVSMENILNRRLVDVVSEIT  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
               SK   R+++K GG+YLNN R++ E   +    ++DG ++L++ GKKNK++VR+S
Sbjct  367  PERSKGDLRKLIKNGGVYLNNLRIEEENYILTPKALIDGNLMLIAFGKKNKILVRVS  423



>ref|WP_039384881.1| tyrosyl-tRNA synthetase [Neochlamydia sp. TUME1]
 gb|KIC75964.1| Tyrosine--tRNA ligase [Neochlamydia sp. TUME1]
Length=424

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 120/176 (68%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQY   V D DV++ +++LTF+ +EEI + + QM  P Y PNTAQ+RLA+EVTR V
Sbjct  248  PYEFYQYLVRVSDVDVIKMMRMLTFMDMEEIRKYQAQMQQPDYVPNTAQKRLAKEVTRIV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V++  +L+L    G
Sbjct  308  HGEENLKIALGVTEAAAPG-AKANLDATTLELMAQNMPSRILNNKTVINAKLLELICQVG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LL SKS ARR+ + GG+YLNN +V+ E   I+ DD++  +++LL+ GKKNK+++ I
Sbjct  367  LLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANRLMLLAVGKKNKILISI  422



>ref|WP_042240888.1| tyrosyl-tRNA synthetase [Neochlamydia sp. S13]
Length=424

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 120/176 (68%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQY   V D DV++ +++LTF+ +EEI + + QM  P Y PNTAQ+RLA+EVTR V
Sbjct  248  PYEFYQYLVRVSDVDVIKMMRMLTFMDMEEIRKYQEQMQQPDYVPNTAQKRLAKEVTRIV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V++  +L+L    G
Sbjct  308  HGEENLKIALGVTEAAAPG-AKANLDAPTLELMAQNMPSRILNNKTVINAKLLELICQVG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LL SKS ARR+ + GG+YLNN +V+ E   I+ DD++  +++LL+ GKKNK+++ I
Sbjct  367  LLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANRLMLLAVGKKNKILISI  422



>ref|WP_044882238.1| tyrosyl-tRNA synthetase [Neochlamydia sp. EPS4]
 gb|KIC73976.1| Tyrosine--tRNA ligase [Neochlamydia sp. EPS4]
Length=424

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 119/176 (68%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQY   V D DV++ +++LTF+ +EEI + + QM  P Y PNTAQ+RLA+EVTR V
Sbjct  248  PYEFYQYLVRVSDVDVIKMMRMLTFMDMEEIRKYQEQMQQPDYVPNTAQKRLAKEVTRIV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V++  +L+L    G
Sbjct  308  HGEENLKIALGVTEAAAPG-AKANLDAPTLELMAQNMPSRILNNKTVINAKLLELICQVG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            LL SKS ARR+ + GG+YLNN +V+ E   I+ DD++   ++LL+ GKKNK+++ I
Sbjct  367  LLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANHLMLLAVGKKNKILISI  422



>gb|AFG55783.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQ+F  +PDADV+ FLK LTFL++EEI EL+  M  PGY PN+ QR+LAEEVT FV
Sbjct  35   PYKFYQHFIGIPDADVIVFLKKLTFLSLEEISELEAGMRKPGYVPNSVQRKLAEEVTCFV  94

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  410
            HG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  95   HGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>gb|AFG55790.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55791.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55792.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55793.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55795.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55797.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQ+F  +PDADV+ FLK LTFL +EEI EL+  M  PGY PN+ QR+LAEEVT FV
Sbjct  35   PYKFYQHFIGIPDADVIVFLKKLTFLNLEEISELEEGMRKPGYVPNSVQRKLAEEVTCFV  94

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  410
            HG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  95   HGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>gb|AEW07904.1| hypothetical protein 0_14069_01, partial [Pinus radiata]
 gb|AFG55785.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55786.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55788.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55789.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55794.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55796.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55798.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55799.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQ+F  +PDADV+ FLK LTFL++EEI EL+  M  PGY PN+ QR+LAEEVT FV
Sbjct  35   PYKFYQHFIGIPDADVIVFLKKLTFLSLEEISELEEGMRKPGYVPNSVQRKLAEEVTCFV  94

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  410
            HG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  95   HGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>ref|XP_005713019.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
 emb|CDF33216.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
Length=510

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ+    PD DV+ FLK LTF+ ++EI+ +  +M  P Y  N+AQ+RLAEEVTR V
Sbjct  335  PYEFYQFLVRTPDDDVIPFLKRLTFMPLDEIDRIAEEMQRPDYTQNSAQKRLAEEVTRMV  394

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++G+  AL AT A  PG+    L  + +E I++D+PS ++    V+   +LDL V SG
Sbjct  395  HGEKGVVSALAATAAAAPGSKAV-LSVEALEAISADMPSATMTRADVVGGGILDLMVQSG  453

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L +SK  ARR++K GG YLNN ++ +E   I E+D+V GK++LL+AGKKNK+VVR+
Sbjct  454  LQKSKGEARRLIKGGGAYLNNGKITTEKLSISEEDLVGGKLILLAAGKKNKLVVRV  509



>gb|AFG55784.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55787.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQ+F  +PDADV+ FLK LTFL++EEI EL+  M  P Y PN+ QR+LAEEVT FV
Sbjct  35   PYKFYQHFIGIPDADVIVFLKKLTFLSLEEISELEEGMRKPEYVPNSVQRKLAEEVTCFV  94

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  410
            HG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  95   HGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>ref|WP_039376683.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|KIA77993.1| Tyrosine--tRNA ligase [Parachlamydia acanthamoebae]
Length=437

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 110/171 (64%), Gaps = 1/171 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQY F V DADV++ +KILTF+ ++EI   +  M    Y  NTAQR+LAEEVTR V
Sbjct  248  PYEFYQYLFRVADADVIKLMKILTFMEMDEIRIYEKMMTQSDYVANTAQRKLAEEVTRIV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL  ALK TE   PG A T LD + +  +A D+P+ ++  + +L+  ++D+     
Sbjct  308  HGEEGLRIALKVTEGAAPGAA-TALDAEVLNNLADDMPNYTVSMENILNRRLVDVVSEIT  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  215
               SK   R+++K GG+YLNN R++ E   +    ++DG ++L++ GKK K
Sbjct  367  PERSKGDLRKLIKNGGVYLNNLRIEEENYILTPKALIDGNLMLIAFGKKIK  417



>ref|WP_013943141.1| tyrosyl-tRNA synthetase [Simkania negevensis]
 emb|CCB88674.1| tyrosyl-tRNA synthetase [Simkania negevensis Z]
Length=424

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 116/177 (66%), Gaps = 1/177 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ+   V DADV + +++LTF+ + EIE  + ++ +  + P  AQ+RLAEEVTRFV
Sbjct  248  PYQFYQHLIRVADADVTKLMRMLTFIDVREIEAFEAEIASGEFIPFAAQKRLAEEVTRFV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EG+  AL+ T A+ PG ++  LD + +E IA D+P  +L   +VL     D+   +G
Sbjct  308  HGEEGVQIALRVTAAIAPG-SNASLDPEILEEIARDMPHVALDVSEVLDQKYTDVITKAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
             + SKS A R+++ GG YLNN +V+  A  I +  ++  K ++L +GKK KM+++I+
Sbjct  367  FVTSKSEAARLIQNGGAYLNNEKVEDPAFTITKKHLIGNKYVMLGSGKKKKMLIKIA  423



>ref|WP_041017153.1| tyrosyl-tRNA synthetase [Criblamydia sequanensis]
 emb|CDR33719.1| Tyrosyl-tRNA synthetase [Criblamydia sequanensis CRIB-18]
Length=420

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQY   VPDADV++ +K+LTFL ++ I E +  M   GY PNTAQ++LAEEVTRFV
Sbjct  245  PYEFYQYLVRVPDADVIKLMKMLTFLDLDVIAEYENAMKQEGYLPNTAQKKLAEEVTRFV  304

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL++AL AT+A  PG ++T LD  ++E    D+P    P + ++   ++DL   SG
Sbjct  305  HGEEGLEKALLATKAAAPG-SETVLDADSLEIAMKDMPYFE-P-ELLVGSKLIDLIADSG  361

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
            L  SKSAARR++++GG+ LNN +++ E K I+ +D++  + ++++ GKK KM+V+
Sbjct  362  LRPSKSAARRLIREGGVSLNNKKINDEEKVIQTEDLIGNRFVVVTLGKKQKMLVK  416



>ref|XP_007509051.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO19508.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
Length=486

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 116/176 (66%), Gaps = 1/176 (1%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            P+KFYQY  +  D DV+R +K+LTFL + EIE     M +  Y  N+AQ RLAEEVTRFV
Sbjct  310  PFKFYQYLLNTKDEDVLRLMKMLTFLPLNEIETYSKLMNSKNYVQNSAQVRLAEEVTRFV  369

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+ GL +A+ AT+ L PG +DT+LD   +E +   VP+       ++ I ++D++V  G
Sbjct  370  HGEVGLQKAITATKGLLPG-SDTELDIDVLESLIDVVPTAICARTDIIGIPIVDVAVKVG  428

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L +SK+  RRM+  GG+ +NN +V   +  I  ++++ G++LL+S GKKNK ++++
Sbjct  429  LRKSKAEVRRMIDGGGVRINNKKVLDVSTCISPEELIAGRMLLISMGKKNKFLIQV  484



>ref|XP_005538192.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82156.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
Length=522

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 120/188 (64%), Gaps = 11/188 (6%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNP---GYAPNTAQRRLAEEVT  557
            PY+FYQY   V D DV  +L+ LTFL +E+I+ L+  M N    GY  NTAQ+ LA EVT
Sbjct  333  PYEFYQYLVKVADDDVCNYLRKLTFLPLEQIDALENDMRNSERSGYQANTAQKLLAMEVT  392

Query  556  RFVHGQEGLDEALKATEALRPG--------NADTKLDWKTIEGIASDVPSCSLPFDQvls  401
            R VHG +G++ AL AT    PG        N  T+L    +E ++S +P  +LP   ++ 
Sbjct  393  RIVHGDKGVETALAATAVAAPGHVPGGEHTNGSTRLRADVLEAVSSSLPGATLPRTALVG  452

Query  400  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  221
            + ++D+ V +GL +SK  ARR++  GG Y+N+ +V    + IE  D+++G++LLL+AGKK
Sbjct  453  VPLVDVMVRAGLQKSKGEARRLIANGGAYVNDEKVSDSGRTIEATDLIEGRLLLLAAGKK  512

Query  220  NKMVVRIS  197
            NKM+VR+S
Sbjct  513  NKMLVRVS  520



>ref|XP_005707106.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME30586.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
Length=501

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 115/177 (65%), Gaps = 3/177 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPG-YAPNTAQRRLAEEVTRF  551
            P++FYQ+ +   DADV+R LK LTFL + EI EL+  M N   Y PNTAQ+ LAEEVTR 
Sbjct  321  PFEFYQFLYQTSDADVIRLLKYLTFLPLSEIGELELSMKNSSFYKPNTAQKLLAEEVTRL  380

Query  550  VHGQEGLDEALKATEALRPGNA--DTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsv  377
            VHG EG+  A + T A  PG    ++ LD+ T+  +  ++PS  +  + +L  S++++ V
Sbjct  381  VHGDEGVKFAQRVTSASSPGRLVEESILDFDTLRQLKDEIPSKEIRKEHLLKKSLIEVLV  440

Query  376  ssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVV  206
              G+++SKS A+R +  GG Y+NN RV+   + I ++D+V+  +LLL  GKK K+++
Sbjct  441  ECGIMKSKSEAKRFIINGGCYINNRRVEELDRSIGQEDLVENSMLLLGIGKKQKILL  497



>gb|ENO19082.1| tyrosine--tRNA ligase [Actinomyces cardiffensis F0333]
Length=423

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 106/177 (60%), Gaps = 4/177 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V DADVVRFLKI TFL    IEEL+ ++    +   +AQ+ LA EVTR V
Sbjct  251  PYAFYQFWLQVEDADVVRFLKIFTFLDRARIEELEVEVAERPHI-RSAQKALAAEVTRLV  309

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E LD  L AT AL  G     +D +T+    SD+P   L   +    +++D  V +G
Sbjct  310  HGEEELDRVLAATNALWGGGDLHAIDEQTLSSATSDLPQACLKLGE---ATIIDALVETG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L + KSAARR L  GG YLNN +V+ E   I  +D++ G  +L+  G++N  VV +S
Sbjct  367  LEKGKSAARRTLASGGAYLNNIKVEDEDAPICVEDLLAGSRVLVRKGRRNLAVVELS  423



>ref|WP_040313631.1| tyrosyl-tRNA synthetase [Actinomyces cardiffensis]
Length=420

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 106/177 (60%), Gaps = 4/177 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V DADVVRFLKI TFL    IEEL+ ++    +   +AQ+ LA EVTR V
Sbjct  248  PYAFYQFWLQVEDADVVRFLKIFTFLDRARIEELEVEVAERPHI-RSAQKALAAEVTRLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E LD  L AT AL  G     +D +T+    SD+P   L   +    +++D  V +G
Sbjct  307  HGEEELDRVLAATNALWGGGDLHAIDEQTLSSATSDLPQACLKLGE---ATIIDALVETG  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L + KSAARR L  GG YLNN +V+ E   I  +D++ G  +L+  G++N  VV +S
Sbjct  364  LEKGKSAARRTLASGGAYLNNIKVEDEDAPICVEDLLAGSRVLVRKGRRNLAVVELS  420



>ref|XP_011397334.1| Tyrosine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM24446.1| Tyrosine-tRNA ligase [Auxenochlorella protothecoides]
Length=476

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 110/177 (62%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ   +  D DV R L+ LTFL +E+I+ L      PG  P  AQR LA EVTRFV
Sbjct  300  PYAFYQALLATADDDVARMLRALTFLPLEQIDALLA----PGQPPAAAQRALAAEVTRFV  355

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIE-GIASDVPSCSLPFDQvlsisvldlsvss  371
            HG+EGL  AL AT AL PG+++  +D +T+E  +A   P  ++  +  L   ++DL V  
Sbjct  356  HGEEGLRGALAATRALAPGSSEGSVDLQTLEAAVAGGAPKFAVDREAALGGPLIDLLVRV  415

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            G   SK AARR+++  GL +NN  V  E + +  DD+VDG+++++S GKK K+V+ +
Sbjct  416  GAQPSKGAARRLVQGRGLRVNNKVVTDEGRGLAADDLVDGRLVMVSLGKKKKLVLEL  472



>ref|WP_022848286.1| tyrosyl-tRNA synthetase [Chloroflexi bacterium oral taxon 439]
Length=430

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 108/181 (60%), Gaps = 7/181 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +  D+DV+ F++  TF T E+I EL+ +  N P      AQR LAEE+T  
Sbjct  251  PYKFYQFWLNADDSDVIDFIRFYTFFTPEKIAELEDKTANRP--EERAAQRALAEEMTYL  308

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSL---PFDQvlsisvldls  380
            +HGQ+ LD+A +AT AL  G+ D  L    I+ I +DVPS ++               LS
Sbjct  309  MHGQKALDKARQATSALFGGDID-GLSADDIQDIFADVPSKTIRPAELSGAPVDLAAFLS  367

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
             +SG L+SK  ARR + +GG+YLNN R D+ A  +   D ++G  L+L  GKKN  +VR+
Sbjct  368  ETSGFLKSKGEARRAIAEGGIYLNNHRADNAAAIVTRSDFIEGAFLVLRRGKKNYFLVRL  427

Query  199  S  197
            S
Sbjct  428  S  428



>ref|WP_022864835.1| tyrosyl-tRNA synthetase [Varibaculum cambriense]
Length=421

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 106/170 (62%), Gaps = 4/170 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ++    DADVVRFLK+ TFL+ EEIE L  ++    +    AQ+ LA EVTR V
Sbjct  248  PYEFYQFWLGAEDADVVRFLKVFTFLSREEIEALAVEVAERPH-KREAQKALAAEVTRLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQE LD+ L ATEAL       ++D KT++G  + +PS ++   +    +++DL +++G
Sbjct  307  HGQEALDQVLAATEALWGSGDLRQVDGKTLKGATAHLPSATVEIGK---TNLVDLLIAAG  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
              + + AA R +K GG YLNN ++    + I  +D++ G ++L   GK+N
Sbjct  364  FEKGRGAAMRTIKNGGAYLNNQKITDPDRTITSEDVLPGSLVLFRKGKRN  413



>ref|WP_024058184.1| tyrosyl-tRNA synthetase [Varibaculum cambriense]
 gb|ETI82476.1| hypothetical protein Q618_VCMC00001G0057 [Varibaculum cambriense 
DORA_20]
Length=421

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 105/173 (61%), Gaps = 4/173 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ++    DADVVRFLK+ TFL+ EEIE L  ++    +    AQ+ LA EVTR V
Sbjct  248  PYEFYQFWLGAEDADVVRFLKVFTFLSREEIEALAVEVAERPH-KREAQKALAAEVTRLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQE LD+ L ATEAL       ++D  T++G  + +PS  +   +    +++DL +++G
Sbjct  307  HGQEALDQVLAATEALWGSGDLHQVDGNTLKGATAHLPSAKVEIGK---TNLVDLLIAAG  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  209
              + + AA R +K GG YLNN +V    + I  +D++ G ++L   GK+N  V
Sbjct  364  FEKGRGAAMRTIKNGGAYLNNQKVTDPDRVITSEDVLPGSLVLFRKGKRNLAV  416



>ref|WP_016445042.1| tyrosyl-tRNA synthetase [Actinomyces europaeus]
 gb|EPD29409.1| tyrosine-tRNA ligase [Actinomyces europaeus ACS-120-V-Col10b]
Length=421

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 108/176 (61%), Gaps = 6/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +V DADVVRFLK+ TFL   EIE L+  + +  Y    AQ+ LA EVT+ V
Sbjct  248  PYAFYQFWLNVDDADVVRFLKVFTFLDRPEIERLEKTVADAPY-KREAQKTLAAEVTKLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E L   L+AT+AL  G    K+D  T+    +++PS  + F +    +++D  V++G
Sbjct  307  HGEETLQRVLEATDALWGGGDLKKIDPATLSAATAELPSGKIVFGE---ATIVDALVAAG  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIE-EDDIVDGKVLLLSAGKKNKMVVR  203
            L + K AAR  +  GG YLNN RV++E   I  ED + DG V L+  G++N  VVR
Sbjct  364  LEKGKRAARTTVASGGAYLNNERVENEDLIISGEDALADGTV-LIRKGRRNLAVVR  418



>ref|WP_034510938.1| tyrosyl-tRNA synthetase [Actinomyces sp. S4-C9]
 gb|KGE99688.1| tyrosyl-tRNA synthetase [Actinomyces sp. S4-C9]
Length=421

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 108/176 (61%), Gaps = 6/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +V DADVVRFLK+ TFL   EIE L+  + +  Y    AQ+ LA EVT+ V
Sbjct  248  PYAFYQFWLNVDDADVVRFLKVFTFLDRPEIERLEKTVEDAPY-KREAQKALAAEVTKLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E L   L+AT+AL       K+D  T+    S++P+  + F +    +++D  V++G
Sbjct  307  HGEETLQRVLEATDALWGSGDLKKVDAATLSAATSELPAGEVAFGE---ATIVDALVAAG  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIE-EDDIVDGKVLLLSAGKKNKMVVR  203
            L + K AAR  +  GG YLNN RV+SE + I  ED + DG V L+  G++N  VVR
Sbjct  364  LEKGKRAARTTVSSGGAYLNNERVESEDQIISAEDALADGTV-LIRKGRRNLAVVR  418



>ref|WP_024332044.1| tyrosyl-tRNA synthetase [Actinomyces neuii]
Length=420

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 104/174 (60%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVVRFLK+ TF + EEIEEL+    N       AQ+ LAE VTR V
Sbjct  248  PYAFYQFWLTAEDADVVRFLKVFTFKSREEIEELERLT-NEKPHLRAAQKALAESVTRLV  306

Query  547  HGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  D+ L ATEAL  G  D K +D KT+      +P+      +V + SV+DL V +
Sbjct  307  HGDQATDQVLAATEALW-GKGDLKAIDEKTLASATESLPATHF---EVGTSSVVDLLVGT  362

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  209
            GL   K AARR +K GG YLNN +V+ E + I   D++ G  +L+  GK+N  V
Sbjct  363  GLERGKGAARRTIKSGGAYLNNVKVEDEDRVISTSDLLSGGKVLIRKGKRNLAV  416



>ref|WP_028851238.1| tyrosyl-tRNA synthetase [Thermocrispum municipale]
Length=424

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 103/176 (59%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V DADV+R+LK+ TFL+ EEI EL+ Q     +    AQRRLAEE+T  V
Sbjct  250  PYAWYQYFVNVADADVIRYLKLFTFLSQEEIAELERQTEEQPFR-RAAQRRLAEELTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG +   + + A++AL      + LD  T+E + ++VP+  +      +I  L ++    
Sbjct  309  HGADQTAQVVAASQALFGKGEFSALDEPTLESVMAEVPTGEVALSDEPTIVDLLVAAGLS  368

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                K AARR +++GG Y+NN ++  E  + E  D + GK L++  GK+N   VR+
Sbjct  369  ES--KGAARRTVREGGAYVNNTKISDEEWRPEPADALHGKWLIVRRGKRNVAGVRL  422



>ref|WP_007324558.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 gb|EGF29422.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica WH47]
Length=432

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 6/179 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY FYQY+ +V D DV+R L  LT +   E +EL+ +  N PG    TAQ+RLA+ +T  
Sbjct  255  PYAFYQYWINVADEDVMRCLAYLTEIERAEYDELEDKTKNDPG--QRTAQKRLAQWLTEL  312

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +    +  +    
Sbjct  313  VHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEGEGLWIVEALQ  371

Query  370  glleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                  S   ARR L +GG+Y+NN RV+   K++  DD+    VL+L  GK+   +++I
Sbjct  372  TAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTADDLDGRSVLVLRRGKRKYALLKI  430



>ref|WP_017176881.1| tyrosyl-tRNA synthetase [Actinomyces timonensis]
Length=420

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 96/176 (55%), Gaps = 6/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMG-NPGYAPNTAQRRLAEEVTRF  551
            PY FYQ++  V D DVVRFLK+ TFL   EIE L T +  NP      AQR LA EVTR+
Sbjct  248  PYAFYQFWLQVDDDDVVRFLKVFTFLDRAEIERLATAVAENP--KAREAQRALAREVTRW  305

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+  L +A  AT AL      T +D  T+    +D+PS  L   +   + +L  +   
Sbjct  306  VHGEAALAQAEVATAALWGRGDLTGIDEATMAAATADLPSAELVVGESTIVDLLVGAGLE  365

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
                 + AARR +  GG YLNNA+V  E   + E D++ G V+L+  G++   V R
Sbjct  366  KG---RGAARRTIAAGGAYLNNAKVTDEEAVVTESDLLAGGVVLVRKGRRTLSVAR  418



>ref|WP_013600598.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
 gb|ADX72661.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans Sphe3]
Length=438

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 104/180 (58%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EI+EL   +    +A    QR+LA EVT  V
Sbjct  264  PYAFYQFWLNTADADVVNRLKVFTFLTRAEIDELAAAVAERPFA-REGQRKLAYEVTSLV  322

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E  ++ + A+ AL  GN D T LD  T++   S++PS ++  D++  + +L  S  S
Sbjct  323  HGVEATEKVIAASAALF-GNGDLTALDKTTLQAATSELPSATVQVDEMGIVDLLVASGLS  381

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS*P  191
                 KSAARR + +GG Y+NN +V      I E +++ G+ LLL  GKKN   V +  P
Sbjct  382  ES---KSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRGKKNLATVEVLVP  438



>ref|WP_008661113.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea]
 gb|EMB13997.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea 6C]
 gb|EMI25131.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea SH398]
Length=432

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 6/179 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY FYQY+ +V D DV+R L  LT +   E +EL+ +  N PG    TAQ+RLA+ +T  
Sbjct  255  PYAFYQYWINVADEDVMRCLAYLTEIERAEYDELEDKTKNDPG--QRTAQKRLAQWLTEL  312

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +    +  +    
Sbjct  313  VHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEGEGLWIVEALQ  371

Query  370  glleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                  S   ARR L +GG+Y+NN RV+   K++  DD+    VL+L  GK+   +++I
Sbjct  372  TAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRRGKRKYALLKI  430



>gb|EKY16477.1| tyrosine--tRNA ligase [Actinomyces sp. oral taxon 181 str. F0379]
Length=350

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 102/176 (58%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V D DVVRFLKI TFL+ EEIE L+ ++    +    AQ+ LA  VT  V
Sbjct  179  PYAFYQFWLQVADDDVVRFLKIFTFLSREEIEALEVEVAERPH-QRAAQKALAASVTALV  237

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+ L+    ATEAL      + +D  T+    SD+P   LP       +++D  V +G
Sbjct  238  HGQDELERVQAATEALWGTGDLSSIDEATLAAATSDLPRAELPLG----ATLVDALVETG  293

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L + +SAARR L  GG Y+N  +V+ E   +  DD++ G ++L+  G++N  VV +
Sbjct  294  LEKGRSAARRTLAGGGAYVNKVKVEDEEAVLSADDLLAGGLVLIRKGRRNLAVVAV  349



>ref|WP_007332625.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 gb|EKK01795.1| Tyrosyl-tRNA synthetase [Rhodopirellula baltica SH28]
Length=432

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 6/179 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY FYQY+ +V D DV+R L  LT +   E +EL+ +  N PG    TAQ+RLA+ +T  
Sbjct  255  PYAFYQYWINVADEDVMRCLAYLTEIERAEYDELEDKTKNDPG--QRTAQKRLAQWLTEL  312

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +    +  +    
Sbjct  313  VHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEGEGLWIVEALQ  371

Query  370  glleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                  S   ARR L +GG+Y+NN RV+   K++  DD+    VL+L  GK+   +++I
Sbjct  372  TAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRRGKRKYALLKI  430



>ref|WP_011122161.1| tyrosine--tRNA ligase [Rhodopirellula baltica]
 ref|NP_868726.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica SH 1]
 sp|Q7UM14.1|SYY_RHOBA RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Rhodopirellula baltica SH 1]
 emb|CAD76103.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica SH 1]
Length=438

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 6/179 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY FYQY+ +V D DV+R L  LT +   E +EL+ +  N PG    TAQ+RLA+ +T  
Sbjct  261  PYAFYQYWINVADEDVMRCLAYLTEIERAEYDELEDKTKNDPG--QRTAQKRLAQWLTEL  318

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +    +  +    
Sbjct  319  VHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEGEGLWIVEALQ  377

Query  370  glleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                  S   ARR L +GG+Y+NN RV+   K++  DD+    VL+L  GK+   +++I
Sbjct  378  TAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRRGKRKYALLKI  436



>ref|WP_043536564.1| tyrosyl-tRNA synthetase [Actinomyces sp. MS2]
Length=420

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 94/175 (54%), Gaps = 4/175 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V D DVVRFLKI TFL    IEEL  ++     A   AQ+ LA  VT  V
Sbjct  248  PYAFYQFWLQVADEDVVRFLKIFTFLPRRRIEELALEVSERPQA-RVAQKELAARVTELV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++ LD  L ATEAL        LD +T+E   +++PS  +   +   +  L  +    
Sbjct  307  HGRDELDRVLAATEALWGRGELGALDARTLESATAELPSGDIVAGESTIVDALVATGLEK  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
                +SAARR +  GG YLNN +V  E   I   D++ G + L+  G++N  VVR
Sbjct  367  G---RSAARRTVASGGAYLNNVKVTDEDAPISTGDLLAGGLALVRKGRRNLAVVR  418



>ref|XP_009516786.1| hypothetical protein PHYSODRAFT_552811 [Phytophthora sojae]
 gb|EGZ29511.1| hypothetical protein PHYSODRAFT_552811 [Phytophthora sojae]
Length=428

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 108/177 (61%), Gaps = 6/177 (3%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTRF  551
            + FYQ+F    D DV + LK  TF  +EEI ++  +      AP    AQ+ LAE++T  
Sbjct  255  FDFYQFFLRSDDRDVEQLLKSFTFREVEEIRDIVAEHEK---APEKRAAQKVLAEDITAM  311

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            +HGQEGL  AL ATE L  G     L  + +  +A D P  +L    V+  S++DL+V  
Sbjct  312  MHGQEGLKAALDATELL-FGKKSGPLTAEEMLRMAGDAPMSALSRADVVDQSLVDLAVRI  370

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            G  +SK+  RR++K GG+YLNN RV+SEA ++E  +++DGK+L+L  G++N  +V++
Sbjct  371  GAAKSKAECRRLIKGGGVYLNNERVESEALRVEAANLLDGKLLVLRIGRRNNFIVQV  427



>ref|WP_041569078.1| tyrosyl-tRNA synthetase [Chloracidobacterium thermophilum]
Length=425

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 102/180 (57%), Gaps = 7/180 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNT--AQRRLAEEVTR  554
            PY+FYQ++F+  DA V+ +LK  TFL+  EI +L+  +     AP    AQR LA  VT 
Sbjct  245  PYEFYQFWFNTEDASVINYLKAFTFLSAAEIADLEAAVAT---APEKREAQRSLAAAVTE  301

Query  553  FVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLP--FDQvlsisvldls  380
            FVHG  GL  AL AT  L  G+  T +D  T+  +  D PS  +P            DL+
Sbjct  302  FVHGAAGLRTALAATNILFGGDPITDIDADTLLAVFHDAPSTEVPAALFADDGALPSDLA  361

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            V++ L+ SKS ARR+++ GGLY NN RV+S   +I  + ++ G+  +L  G +   ++R+
Sbjct  362  VAARLVSSKSEARRLIEGGGLYFNNQRVESVHARITRERLIGGQYGVLRKGARTYHLLRV  421



>gb|AEP11643.1| tyrosyl-tRNA synthetase [Chloracidobacterium thermophilum B]
Length=426

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 102/180 (57%), Gaps = 7/180 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNT--AQRRLAEEVTR  554
            PY+FYQ++F+  DA V+ +LK  TFL+  EI +L+  +     AP    AQR LA  VT 
Sbjct  246  PYEFYQFWFNTEDASVINYLKAFTFLSAAEIADLEAAVAT---APEKREAQRSLAAAVTE  302

Query  553  FVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLP--FDQvlsisvldls  380
            FVHG  GL  AL AT  L  G+  T +D  T+  +  D PS  +P            DL+
Sbjct  303  FVHGAAGLRTALAATNILFGGDPITDIDADTLLAVFHDAPSTEVPAALFADDGALPSDLA  362

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            V++ L+ SKS ARR+++ GGLY NN RV+S   +I  + ++ G+  +L  G +   ++R+
Sbjct  363  VAARLVSSKSEARRLIEGGGLYFNNQRVESVHARITRERLIGGQYGVLRKGARTYHLLRV  422



>ref|WP_034251080.1| tyrosyl-tRNA synthetase [Actinomyces sp. oral taxon 181]
Length=419

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 102/176 (58%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V D DVVRFLKI TFL+ EEIE L+ ++    +    AQ+ LA  VT  V
Sbjct  248  PYAFYQFWLQVADDDVVRFLKIFTFLSREEIEALEVEVAERPH-QRAAQKALAASVTALV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+ L+    ATEAL      + +D  T+    SD+P   LP       +++D  V +G
Sbjct  307  HGQDELERVQAATEALWGTGDLSSIDEATLAAATSDLPRAELPLG----ATLVDALVETG  362

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L + +SAARR L  GG Y+N  +V+ E   +  DD++ G ++L+  G++N  VV +
Sbjct  363  LEKGRSAARRTLAGGGAYVNKVKVEDEEAVLSADDLLAGGLVLIRKGRRNLAVVAV  418



>ref|WP_006889016.1| tyrosyl-tRNA synthetase [Rothia aeria]
 gb|EID50266.1| tyrosine--tRNA ligase [Rothia aeria F0474]
Length=434

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 100/176 (57%), Gaps = 4/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EI E + ++    Y    AQ+RLA EVT  V
Sbjct  262  PYAFYQFWLNTADADVVDRLKVFTFLTRAEIGEYEHKVETEAY-KREAQKRLAYEVTALV  320

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ   + ++ +    G
Sbjct  321  HGVEATHQAIAASEALFGKGDFAALDESTLQTVMSELPSVELSSDQ---LDLITVLTELG  377

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
               SKS ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GKKN+  + +
Sbjct  378  FASSKSEARRILKEGGASVNGAKVQGEDAVITAEQLLHGKYAIVRRGKKNQGAITV  433



>ref|WP_037233127.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|KGI99536.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|KGJ35093.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
Length=434

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 100/176 (57%), Gaps = 4/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EI E + ++    Y    AQ+RLA EVT  V
Sbjct  262  PYAFYQFWLNTADADVVDRLKVFTFLTRAEIGEYEHKVETEAY-KREAQKRLAYEVTALV  320

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ   + ++ +    G
Sbjct  321  HGVEATHQAIAASEALFGKGDFAALDESTLQAVMSELPSVELSSDQ---LDLITVLTELG  377

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
               SKS ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GKKN+  + +
Sbjct  378  FASSKSEARRILKEGGASVNGAKVQGEDAVITPEQLLHGKYAIVRRGKKNQGAITV  433



>ref|WP_034277502.1| tyrosyl-tRNA synthetase [Amycolatopsis halophila]
Length=426

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 103/177 (58%), Gaps = 3/177 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V DADVVRFLK+ TFL  EEI EL  Q+          QR+LAEE+T  V
Sbjct  253  PYAWYQYFVNVADADVVRFLKMFTFLDREEIAELA-QLTEEKPFLRAGQRKLAEELTTLV  311

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E  ++ + A++AL        LD  T++   ++VP+  +      +I  L L+    
Sbjct  312  HGKEQTEQVIAASQALFGKGELGALDSSTLDAAMAEVPTGEVALGDGPTIIDLLLAADLV  371

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                K AARR++K+GG Y+NNA+V  +  +   DD++  + L++  GK+N   VRI+
Sbjct  372  ES--KGAARRVIKEGGAYVNNAKVTDDTWQPSRDDLLHDRWLVVRRGKRNLGGVRIA  426



>gb|ERT67692.1| tyrosine--tRNA ligase [Rothia aeria F0184]
Length=439

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 100/176 (57%), Gaps = 4/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EI E + ++    Y    AQ+RLA EVT  V
Sbjct  267  PYAFYQFWLNTADADVVDRLKVFTFLTRAEIGEYEHKVETEAY-KREAQKRLAYEVTALV  325

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ   + ++ +    G
Sbjct  326  HGVEATHQAIAASEALFGKGDFAALDESTLQTVMSELPSVELSSDQ---LDLITVLTELG  382

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
               SKS ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GKKN+  + +
Sbjct  383  FASSKSEARRILKEGGASVNGAKVQGEDAVITAEQLLHGKYAIVRRGKKNQGAITV  438



>ref|WP_019127035.1| tyrosyl-tRNA synthetase [Actinomyces sp. ph3]
Length=419

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 102/176 (58%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V D DVVRFLKI TFL+ EEIE L+ ++    +    AQ+ LA  VT  V
Sbjct  248  PYAFYQFWLQVADDDVVRFLKIFTFLSREEIEALEVEVAERPH-QRAAQKALAASVTALV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+ L+    ATEAL      + +D  T+    SD+P   LP       +++D  V +G
Sbjct  307  HGQDELERVQAATEALWGTGDLSSIDEATLAAATSDLPRAELPLG----ATLVDALVETG  362

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L + +SAARR L  GG Y+N  +V+ E   +  DD++ G ++L+  G++N  VV +
Sbjct  363  LEKGRSAARRTLAGGGAYVNKIKVEDEEAVLSADDLLAGGLVLIRKGRRNLAVVAV  418



>dbj|BAI65246.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa DY-18]
Length=211

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 100/176 (57%), Gaps = 4/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADV+  LK+ TFLT  EI E   ++    +    AQ+ LA  VT  V
Sbjct  39   PYAFYQFWLNTADADVLDRLKVFTFLTRAEIAEFAEKVEKEPF-KREAQKTLAYLVTSLV  97

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  D+A+ A+EAL        LD  T+E + +++PS  LP D+   + ++ +    G
Sbjct  98   HGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLPADR---LDMISVLTELG  154

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              +S S ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GKKN+  V +
Sbjct  155  FAKSNSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGKKNQGAVEL  210



>ref|WP_044150629.1| tyrosyl-tRNA synthetase, partial [Rothia mucilaginosa]
Length=211

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 100/176 (57%), Gaps = 4/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADV+  LK+ TFLT  EI E   ++    +    AQ+ LA  VT  V
Sbjct  39   PYAFYQFWLNTADADVLDRLKVFTFLTRAEIAEFAEKVEKEPF-KREAQKTLAYLVTSLV  97

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  D+A+ A+EAL        LD  T+E + +++PS  LP D+   + ++ +    G
Sbjct  98   HGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLPADR---LDMISVLTELG  154

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              +S S ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GKKN+  V +
Sbjct  155  FAKSNSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGKKNQGAVEL  210



>ref|WP_005987818.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii]
 gb|EHM87143.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii C83]
Length=423

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 93/178 (52%), Gaps = 8/178 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkilt-fltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY FYQ++  V D DVVRFLK+ T        E  +    NP      AQ+ LA EVT +
Sbjct  249  PYAFYQFWLQVEDVDVVRFLKVFTFLSRERIEELERETQENP--RARAAQKALAHEVTTW  306

Query  550  VHGQEGLDEALKATEALRPGNADT--KLDWKTIEGIASDVPSCSLPFDQvlsisvldlsv  377
            VHG++       AT AL  G+AD+  K+D  T+ G  +D+PS  L   +   I +L  + 
Sbjct  307  VHGEQETARVEAATAALWGGDADSLRKIDAFTLAGATADLPSAQLEVGKSTIIDLLVATG  366

Query  376  ssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
                   + AAR+ + QGG YLN  +V  E   I EDD++ G V+L+  G++   V R
Sbjct  367  LEKG---RGAARKTVAQGGAYLNMRKVSDEDAVITEDDLLAGGVVLVRKGRRKLAVAR  421



>ref|WP_037604940.1| tyrosyl-tRNA synthetase [Streptacidiphilus rugosus]
Length=420

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 106/177 (60%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  D DV +FL+I +F + EEIE L+ +     Y    AQR LAEE+T  V
Sbjct  248  PYAFYQFWLNADDRDVSKFLRIFSFKSHEEIEALERETEEAPY-KRAAQRALAEELTVMV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQE LD A+ A++AL       +LD +T+    +++PS  +         ++DL V++G
Sbjct  307  HGQEQLDRAIAASKALFGQGELAELDERTLAAAVAELPSAKV----TELGEIVDLFVATG  362

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L  S+SAARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK+N   V ++
Sbjct  363  LSASRSAARRTVGEGGAYVNNTKVEDEAALATPADLLHGRWLVLRRGKRNLAAVELT  419



>ref|WP_012892535.1| tyrosyl-tRNA synthetase [Streptosporangium roseum]
 gb|ACZ88800.1| Tyrosine--tRNA ligase [Streptosporangium roseum DSM 43021]
Length=422

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY FYQY+ +  D DVVRFLK+ TF T +EI EL+  + + P  A   AQR LAE+VT  
Sbjct  249  PYAFYQYWLNADDRDVVRFLKVFTFRTQDEIAELEKAVADRP--AAREAQRTLAEDVTTL  306

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG + L   + A+ AL    +  +LD +T+    ++VP   +P    L  S +DL   S
Sbjct  307  VHGADELARVVAASRALFGQGSLEELDARTLGSALAEVPRAEVP---ALGASFVDLLAES  363

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL+ESKSAARR +K+GG YLNN ++  EA     DD++ G+ L+L  GK++   V ++
Sbjct  364  GLVESKSAARRAVKEGGAYLNNVKITDEAYVPSADDLLHGRFLVLRRGKRSIGGVEVT  421



>ref|WP_017614427.1| tyrosyl-tRNA synthetase [Nocardiopsis salina]
Length=434

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 108/171 (63%), Gaps = 3/171 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++F+  D DVVRFLK  +F + EEIE+L+ +      A   AQ+ LAEE+T  V
Sbjct  258  PYAFYQFWFNADDRDVVRFLKTFSFRSQEEIEDLERRTEERPQA-RAAQKALAEELTTLV  316

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG+E   +A+ A+ AL  G AD ++LD +T+E   S+VP            SV+DL   S
Sbjct  317  HGEEECRKAIDASLALF-GRADLSELDGRTLESALSEVPKVETDTPVGELPSVVDLFAES  375

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            GL  SKSAARR +K+GG Y+NNA+V  E  +++ +D++  + ++L  GK+N
Sbjct  376  GLTPSKSAARRAIKEGGAYVNNAKVTDEDARLDAEDLLADRFVVLRRGKRN  426



>ref|WP_021271485.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. BSW11_IV]
 gb|EQC46963.1| tyrosine--tRNA ligase [Bacteriovorax sp. BSW11_IV]
Length=423

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 103/179 (58%), Gaps = 7/179 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYK YQ+  +  D+ VV+ LK  TFL+++EI+ L+ +M +  +    AQ+ LAEEV + V
Sbjct  248  PYKMYQFLLNSEDSIVVKLLKFYTFLSMDEIKALEEKMQSEPHL-RAAQKTLAEEVVKLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EGL+ AL+AT+    G A TK+  K +  I  DVPS  L  D+ L    +++     
Sbjct  307  HGEEGLEAALRATKFFF-GEAITKISDKEVAAIFEDVPSVKL--DKALLEEGIEICELLV  363

Query  367  lle---SKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                  SK  A+R L Q G+ LNN ++D  A K+  D++V    L+L  GKKN  VVR 
Sbjct  364  QTPLFPSKKEAKRSLDQKGVSLNNNKIDDTAMKVTRDNLVSETSLILRKGKKNYCVVRF  422



>ref|WP_021949404.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:1124]
 emb|CCY65731.1| tyrosine--tRNA ligase [Prevotella sp. CAG:1124]
Length=486

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 104/180 (58%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQM-GNPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  E I+ L  +   +PG    T QRRLAEEVT  
Sbjct  307  PYKFYQFWLNVSDDDAERYIKIFTSLDKETIDALVEEHRQDPG--RRTLQRRLAEEVTVM  364

Query  550  VHGQEGLDEALKATEAL---RPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH +E LD A++A+  L       +  KLD +T+  I   VP   +  DQ+   +V   +
Sbjct  365  VHSREALDAAIEASNILFGKSTKESLLKLDEQTLLDIFEGVPQYEIGRDQLGQPAVEIFT  424

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
             ++ +  SK   R++++ GG+ LN  ++ +  ++I  DD++DGK LL+  GKKN  +V +
Sbjct  425  QAAAVFASKGEMRKLVQGGGVSLNKEKLTAFDRQITADDLIDGKYLLVQRGKKNYYLVIV  484



>ref|WP_036788433.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
 gb|KGL51208.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
 gb|KGN93641.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
Length=431

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 102/185 (55%), Gaps = 11/185 (6%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlki-ltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V DAD  +++KI  +    E +   + Q   P   P   Q+RLAEEVT  
Sbjct  250  PYKFYQFWLNVSDADAAKYIKIFTSLTKEEIMALEEEQAAAPHLRP--LQKRLAEEVTCM  307

Query  550  VHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFDQvlsisvldl  383
            VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP D++    +  L
Sbjct  308  VHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPMDKINGEGINIL  366

Query  382  svssglle---SKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKM  212
             + +  +    S+   R++LK GG+ +N  +V+SE   +   D++ GK +L   GKKN  
Sbjct  367  DLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKYILAQKGKKNYF  426

Query  211  VVRIS  197
            ++  +
Sbjct  427  LITFA  431



>ref|WP_021604636.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii]
 gb|ERH17231.1| tyrosine--tRNA ligase [Actinomyces graevenitzii F0530]
Length=423

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 93/178 (52%), Gaps = 8/178 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkilt-fltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY FYQ++  V D DVVRFLK+ T        E  +    NP      AQ+ LA EVT +
Sbjct  249  PYGFYQFWLQVEDIDVVRFLKVFTFLSRERIEELERETQENP--RARAAQKALAHEVTTW  306

Query  550  VHGQEGLDEALKATEALRPGNADT--KLDWKTIEGIASDVPSCSLPFDQvlsisvldlsv  377
            VHG++       AT AL  G+AD+  K+D  T+ G  +D+PS  L   +   I +L  + 
Sbjct  307  VHGEQETARVEAATAALWGGDADSLRKIDAFTLAGATADLPSSQLEVGKSTIIDLLVATG  366

Query  376  ssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
                   + AAR+ + QGG YLN  +V  E   I EDD++ G V+L+  G++   V R
Sbjct  367  LEKG---RGAARKTVAQGGAYLNMRKVSDEDAVITEDDLLAGGVVLVRKGRRKLAVAR  421



>ref|WP_021352198.1| tyrosyl-tRNA synthetase [Corynebacterium pseudodiphtheriticum]
 gb|ERJ46266.1| tyrosyl-tRNA synthetase [Corynebacterium pseudodiphtheriticum 
090104]
Length=421

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 98/171 (57%), Gaps = 5/171 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +  DADVVR+LK+ TFL+ EEI E +  +    +    AQRRLAEE+T  V
Sbjct  247  PYAWYQYFVNAGDADVVRYLKMFTFLSQEEIAEYERAVAEEPH-KRAAQRRLAEEMTDLV  305

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E       A++AL  G AD   LD +T+EG   +     +   +  SI  L +    
Sbjct  306  HGVEARKAVQLASQAL-FGRADLADLDERTLEGALQETTVAKICAGEARSIVDLLVVSGL  364

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
                 K AARR +K+GG Y+NN R++S   + E DD++ GK L+L  GKKN
Sbjct  365  AES--KGAARRTIKEGGAYVNNQRIESAEWEPETDDLLHGKWLVLRRGKKN  413



>ref|WP_008470064.1| tyrosyl-tRNA synthetase [Lactobacillus hominis]
 emb|CCI81347.1| Tyrosyl-tRNA synthetase [Lactobacillus hominis DSM 23910 = CRBIP 
24.179]
Length=420

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 101/176 (57%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ++ +  D DVV++LK  TFL+ EEIE+L   +    +   TAQRRLAEEVT+FV
Sbjct  249  PYEFYQFWLNQDDRDVVKYLKYFTFLSREEIEDLAESVEKEPW-KRTAQRRLAEEVTKFV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGLDEA   TEAL  GN    L    IE    + PS         + +++D  V + 
Sbjct  308  HGQEGLDEAQFITEALFKGNV-KDLSVAQIEQGFKNAPSTEAT---KEAKNIVDFLVETK  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            +  SK  AR  +K G +Y+N  R +     IE D   DGK +++  GKK   +VRI
Sbjct  364  IEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSAFDGKFVIIRKGKKKYTLVRI  419



>ref|WP_027017834.1| tyrosyl-tRNA synthetase [Corynebacterium pseudodiphtheriticum]
Length=421

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 97/171 (57%), Gaps = 5/171 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +  DADVVR+LK+ TFL  EEI E +  +    +    AQRRLAEE+T  V
Sbjct  247  PYAWYQYFVNAGDADVVRYLKMFTFLLQEEIAEYERAVAEEPH-KRAAQRRLAEEMTDLV  305

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E       A++AL  G AD   LD +T+EG   +     +   +  SI  L +    
Sbjct  306  HGVEARKAVQLASQAL-FGRADLADLDERTLEGALQETTVAEICAGEARSIVDLLVVSGL  364

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
                 K AARR +K+GG Y+NN R++S   + E DD++ GK L+L  GKKN
Sbjct  365  AES--KGAARRTIKEGGAYVNNQRIESAEWEPETDDLLHGKWLVLRRGKKN  413



>ref|WP_043455304.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
 gb|KIC64694.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
Length=437

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 104/180 (58%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EI+EL   +    +A    QR+LA EVT  V
Sbjct  263  PYAFYQFWLNTADADVVDRLKVFTFLTRAEIDELAVSVAERPFA-REGQRKLAFEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E  ++ + A+ AL  GN D + LD  T++   S++PS ++  D++  + +L  S  S
Sbjct  322  HGVEATEKVIAASAALF-GNGDLSTLDKATLQAATSELPSTTVQVDEMGIVDLLVASGLS  380

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS*P  191
                 KSAARR + +GG Y+NN +V      I E +++ G+ LLL  GKKN   V +  P
Sbjct  381  ES---KSAARRTVGEGGAYVNNEKVSDPDAVISESELLHGQYLLLRRGKKNLATVEVLVP  437



>ref|WP_005439705.1| tyrosyl-tRNA synthetase [Saccharomonospora azurea]
 gb|EHY88204.1| tyrosyl-tRNA synthetase [Saccharomonospora azurea NA-128]
Length=424

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 100/177 (56%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVR-FlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY +YQYF ++PDADVVR    +      E  E        P  A   AQRRLA+E+T  
Sbjct  250  PYAWYQYFLNLPDADVVRCLKLLTFLDADEIDELDTATRERP--AARQAQRRLAQELTDL  307

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG E   + + A++AL        LD  T++   ++VP+  +   Q    +++DL V++
Sbjct  308  VHGPEQTQQVVAASQALFGRGELRDLDAATLDAAMAEVPTGEVSSAQ--GPTIIDLLVAA  365

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            GL++SK AARR +K+GG Y+NN ++  E  K E  D + G+ L++  GKKN   VR+
Sbjct  366  GLVDSKGAARRTVKEGGAYVNNIKITDEGWKPEPADALHGRWLVVRRGKKNMAGVRV  422



>ref|WP_005448890.1| tyrosyl-tRNA synthetase [Saccharomonospora azurea]
 gb|EHK87025.1| tyrosyl-tRNA synthetase [Saccharomonospora azurea SZMC 14600]
Length=424

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 100/177 (56%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVR-FlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY +YQYF ++PDADVVR    +      E  E        P  A   AQRRLA+E+T  
Sbjct  250  PYAWYQYFLNLPDADVVRCLKLLTFLDADEIDELDTATRERP--AARQAQRRLAQELTDL  307

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG E   + + A++AL        LD  T++   ++VP+  +   Q    +++DL V++
Sbjct  308  VHGPEQTQQVVAASQALFGRGELRDLDAATLDAAMAEVPTGEVSSAQ--GPTIIDLLVAA  365

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            GL++SK AARR +K+GG Y+NN ++  E  K E  D + G+ L++  GKKN   VR+
Sbjct  366  GLVDSKGAARRTVKEGGAYVNNIKITDEGWKPEPADALHGRWLVVRRGKKNMAGVRV  422



>ref|WP_015786857.1| tyrosyl-tRNA synthetase [Saccharomonospora viridis]
 gb|ACU97545.1| tyrosyl-tRNA synthetase [Saccharomonospora viridis DSM 43017]
 gb|KHF42075.1| tyrosyl-tRNA synthetase [Saccharomonospora viridis]
Length=424

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +VPDADVVR LK+LTFL  +EI EL+T   N   A   AQRRLA+E+T  V
Sbjct  250  PYAWYQYFLNVPDADVVRCLKLLTFLDADEIGELETAT-NERPAARQAQRRLAQELTDLV  308

Query  547  HGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E   + + A++AL  G  D + LD  T++   ++VP+  +        ++++L V+ 
Sbjct  309  HGPEQTRQVVAASQALF-GRGDLRELDAATLDAAMAEVPTGEVRL--ADEPTIVELLVAG  365

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            GL+ESK AARR +K+GG Y+NN ++  E  K E  D++ G  L++  GK+    VR+
Sbjct  366  GLVESKGAARRTVKEGGAYVNNTKITEEDWKPEPSDVLHGHWLVVRRGKRTLAGVRV  422



>ref|WP_016335378.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis]
 gb|AGM07632.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis HCCB10007]
Length=424

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V DADV+R+L++ +FL  EEI  L        +   +AQR+LAEE T  V
Sbjct  250  PYAWFQYFVNVADADVIRYLRMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEEFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E   + + A++AL       +LD  T++   ++VP+  +  D     +++DL +++G
Sbjct  309  HGAEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNGESTIVDLLIAAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIADEEWKPSSDDALHGRWLVVRKGKRNVAGVRV  422



>ref|WP_007338393.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 gb|ELP32535.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica SWK14]
Length=432

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 96/179 (54%), Gaps = 6/179 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY FYQY+ +V D DV+R L  LT +   E +EL+    N PG    TAQ+RLA+ +T  
Sbjct  255  PYAFYQYWINVADEDVMRCLAYLTEIERAEYDELEDTTKNDPG--QRTAQKRLAQWLTEL  312

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +    +  +    
Sbjct  313  VHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEGEGLWIVEALQ  371

Query  370  glleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                  S   ARR L +G +Y+NN RV+   K++  DD+    VL+L  GK+   +++I
Sbjct  372  TAKLCNSGGDARRALSEGSVYVNNTRVEDVQKRLTVDDLDGRSVLVLRRGKRKYALLKI  430



>ref|WP_003795411.1| tyrosyl-tRNA synthetase [Actinomyces odontolyticus]
 gb|EFF80144.1| tyrosine--tRNA ligase [Actinomyces odontolyticus F0309]
Length=420

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 93/177 (53%), Gaps = 4/177 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V D DVVRFLKI TF + EEIE L  ++    +    AQ+ LA  VT  V
Sbjct  248  PYAFYQFWLQVADDDVVRFLKIFTFKSREEIEALAVEVAERPH-QRAAQKALAASVTELV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG + L+  L AT+AL  G     LD  T+    +D+P  SL   +      L       
Sbjct  307  HGADQLERVLAATDALWGGGDIRDLDEATLVAATADLPRASLTIGESTVADALVALGFEK  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                K+AARR +  GG  +NN +V+     + ++D+V G + L+  G+KN  V+ +S
Sbjct  367  G---KTAARRTISSGGASINNVKVEDPEAVLRDEDVVAGGLALIRKGRKNLAVLELS  420



>ref|WP_024963599.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
Length=418

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 97/176 (55%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQ++ +  D DVVR LK+ TFL    IEEL+  +     A   AQR LAEEVT +V
Sbjct  248  PYKFYQFWLNTADEDVVRMLKVFTFLDRARIEELEQAVTARPQA-REAQRVLAEEVTTWV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  + A +A+  L        LD +T+    +++PS     +  +   ++ L +  G
Sbjct  307  HGAEATERAKRASLVLFGKAEPAGLDEQTLRDATAELPSGKASMNDAVVDVLVSLGLEKG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                  AARR +  GGLY+NN ++D   + IEE D++ G ++LL  GKKN   + I
Sbjct  367  A----GAARRTIAGGGLYINNVKIDDPERVIEEGDVLPGSIVLLRKGKKNMTAIHI  418



>ref|WP_020629629.1| tyrosyl-tRNA synthetase [Amycolatopsis alba]
Length=424

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V DADV+R+L++ +FL  EEI  L        +   +AQR+LAE+ T  V
Sbjct  250  PYAWFQYFVNVADADVIRYLRMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEDFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL       +LD  T++   ++VP+  +  D     +++DL +++G
Sbjct  309  HGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNGESTIVDLLIAAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  EA     DD + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIADEAWTPSSDDALHGRWLVVRKGKRNVAGVRV  422



>gb|ETI39233.1| tyrosine-tRNA ligase [Phytophthora parasitica P1569]
 gb|ETK79440.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETL32852.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETL86112.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETM39261.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETO67974.1| tyrosine-tRNA ligase [Phytophthora parasitica P1976]
 gb|ETP09145.1| tyrosine-tRNA ligase [Phytophthora parasitica CJ01A1]
 gb|ETP37177.1| tyrosine-tRNA ligase [Phytophthora parasitica P10297]
Length=428

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTRF  551
            + FYQ+F    D DV +  K  TF  ++EI ++  +      AP    AQ+ LAE++T  
Sbjct  255  FDFYQFFLRSDDRDVEKLFKSFTFREVDEIRDIVAEHEK---APEKRAAQKVLAEDITVM  311

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V+  S++DL+V  
Sbjct  312  MHGQEGLKAALDATELL-FGKKQGPLTAEEMLQMAGDAPMTILSRTDVVDQSLVDLAVRI  370

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            G ++SK+  RR++K GG+YLNN RV+SEA ++E  +++D KVL++  G++N  +V++
Sbjct  371  GAVKSKAECRRLIKGGGVYLNNERVESEALRVEPSNLLDDKVLMVRVGRRNNFIVQV  427



>ref|XP_008910914.1| tyrosine-tRNA ligase [Phytophthora parasitica INRA-310]
 gb|ETN03687.1| tyrosine-tRNA ligase [Phytophthora parasitica INRA-310]
Length=428

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTRF  551
            + FYQ+F    D DV +  K  TF  ++EI ++  +      AP    AQ+ LAE++T  
Sbjct  255  FDFYQFFLRSDDRDVEKLFKSFTFREVDEIRDIVAEHEK---APEKRAAQKVLAEDITVM  311

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V+  S++DL+V  
Sbjct  312  MHGQEGLKAALDATELL-FGKKQGPLTAEEMLQMAGDAPMTILSRTDVVDQSLVDLAVRI  370

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            G ++SK+  RR++K GG+YLNN RV+SEA ++E  +++D KVL++  G++N  +V++
Sbjct  371  GAVKSKAECRRLIKGGGVYLNNERVESEALRVEPSNLLDDKVLMVRVGRRNNFIVQV  427



>ref|WP_025295943.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
 gb|AHU89057.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
 gb|AJC69525.1| tyrosyl-tRNA synthetase [Trueperella pyogenes TP8]
Length=418

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 97/176 (55%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PYKFYQ++ +  D DVVR LK+ TFL    IEEL+  +     A   AQR LAEEVT +V
Sbjct  248  PYKFYQFWLNTADEDVVRMLKVFTFLDRARIEELEQAVTARPQA-REAQRVLAEEVTTWV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  + A +A+  L        LD +T+    +++PS     +  +   ++ L +  G
Sbjct  307  HGAEATERAKRASLVLFGKAEPAGLDEQTLRDATAELPSGKASVNDAVVDVLVSLGLEKG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                  AARR +  GGLY+NN ++D   + IEE D++ G ++LL  GKKN   + I
Sbjct  367  A----GAARRTIAGGGLYINNVKIDDPERVIEEGDVLPGSIVLLRKGKKNMTAIHI  418



>ref|WP_023019532.1| MULTISPECIES: tyrosyl-tRNA synthetase [Corynebacterium]
 gb|ERS38571.1| tyrosyl-tRNA synthetase [Corynebacterium sp. KPL1995]
 gb|ERS71349.1| tyrosyl-tRNA synthetase [Corynebacterium sp. KPL1989]
Length=421

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 97/171 (57%), Gaps = 5/171 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +  D DVVR+LK+ TFL+ EEI E +  +    +    AQRRLAEE+T  V
Sbjct  247  PYAWYQYFVNAGDTDVVRYLKMFTFLSQEEIAEYERAVAEEPH-KRAAQRRLAEEMTDLV  305

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E       A++AL  G AD   LD +T+EG   +     +   +  SI  L +    
Sbjct  306  HGVEARKAVQLASQAL-FGRADLADLDERTLEGALQETTVAKICAGEARSIVDLLVVSGL  364

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
                 K AARR +K+GG Y+NN R++S   + E DD++ GK L+L  GKKN
Sbjct  365  AES--KGAARRTIKEGGAYVNNQRIESAEWEPETDDLLHGKWLVLRRGKKN  413



>ref|WP_038511529.1| tyrosyl-tRNA synthetase [Amycolatopsis japonica]
 gb|AIG75731.1| Tyrosine-tRNA ligase [Amycolatopsis japonica]
Length=424

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V D+DV+R+L++ +FL  EEI  L        +   +AQR+LAE+ T  V
Sbjct  250  PYAWFQYFLNVADSDVIRYLRMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEDFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL       +LD  T++   ++VP+  +  D     +++DL +++G
Sbjct  309  HGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKI--DPNGEATIVDLLIAAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIADEEWKPSSDDALHGRWLVVRKGKRNVAGVRV  422



>ref|WP_013132266.1| tyrosyl-tRNA synthetase [Thermobispora bispora]
 gb|ADG88733.1| tyrosyl-tRNA synthetase [Thermobispora bispora DSM 43833]
Length=421

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 104/171 (61%), Gaps = 6/171 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY FYQ++ +  D DVVR LK+ TF T EEIEEL+  +   P  A   AQR LAE+VT  
Sbjct  249  PYAFYQFWLNADDRDVVRLLKVFTFRTREEIEELEKAVAERP--AAREAQRALAEDVTAL  306

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+E L+  + A+ AL       +LD +T+E   ++VP   +P    L    +DL  +S
Sbjct  307  VHGREELERVVAASRALFGHGTLQELDERTLEAALNEVPKAKVP---ALGAPYVDLLAAS  363

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            G++ESKSAARR +++GG YLNN +V  E      DD++ G+ L+L  GKK 
Sbjct  364  GIVESKSAARRAVREGGAYLNNVKVTDEDYVPTADDLLHGRFLVLRRGKKT  414



>ref|WP_022513249.1| tyrosyl-tRNA synthetase [Dialister sp. CAG:588]
 emb|CDF27526.1| tyrosine--tRNA ligase [Dialister sp. CAG:588]
Length=420

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 106/177 (60%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ++F+  D DVV++LK  TFL+ EEI  L+ ++ N       AQR+LAEEVTRFV
Sbjct  246  PYEFYQFWFNQDDRDVVKYLKYFTFLSQEEINALEEEV-NTHPEKREAQRKLAEEVTRFV  304

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQEGL+EAL+ TEAL  GN   +L    IEG   +    +L     + +++++  VS  
Sbjct  305  HGQEGLNEALRVTEALFSGNVQ-ELSAAEIEGAFRNTKGGTL---HSVPMNIVEALVSGE  360

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            +++SK  AR  +  G + +N  ++      I      +GK +++  GKKN  ++++S
Sbjct  361  VIKSKRQAREDVSNGAIRINGEKITDIEATITAHPNTNGKHIIVKKGKKNYFLLKVS  417



>ref|WP_004806341.1| tyrosyl-tRNA synthetase [Actinomyces neuii]
 gb|EJZ87547.1| tyrosine-tRNA ligase [Actinomyces neuii BVS029A5]
Length=420

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 102/173 (59%), Gaps = 4/173 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADV+RFLK+ TF + EEIEEL+ ++         AQ+ LAE VTR V
Sbjct  248  PYAFYQFWLTAEDADVIRFLKVFTFKSREEIEELE-KLTAEKPQLRAAQKELAESVTRLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  D+ L ATEAL        +D  T+      +P+  L   +V + +++DL V +G
Sbjct  307  HGDEVTDQVLAATEALWGKGDLASIDASTLASATESLPATEL---EVGTSTIVDLLVGTG  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  209
            L + K AARR +K GG YLNN +V+     I E D++ G  +L+  GK+N  V
Sbjct  364  LEKGKGAARRTIKSGGAYLNNQKVEDVDYVIAETDLLSGGKVLVRKGKRNLAV  416



>ref|WP_028912082.1| tyrosyl-tRNA synthetase [Prevotella sp. MA2016]
Length=431

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMG-NPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  + I+ L  +   +PG      Q+RLAEEVT  
Sbjct  253  PYKFYQFWLNVSDDDAERYIKIFTSLEKDVIDALVEEHKQDPG--RRVLQKRLAEEVTVM  310

Query  550  VHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH QE LD A++A+  L   +      KLD +T+  +   VP   +  DQ+   ++  L+
Sbjct  311  VHSQEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQLGQPAIELLT  370

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
              + +  SK   R+M++ GG+ LN  ++  + + I  DD++DGK LL   GKKN
Sbjct  371  TVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITADDLIDGKYLLAQKGKKN  424



>ref|WP_039240672.1| tyrosyl-tRNA synthetase [Arthrobacter sp. MWB30]
 gb|KIA73795.1| tyrosyl-tRNA synthetase TyrS [Arthrobacter sp. MWB30]
Length=436

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 109/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFL+  EIE L   +    +A    Q++LA EVT  V
Sbjct  263  PYTFYQFWLNTADADVVDRLKVFTFLSRAEIEALGEAVAERPFA-REGQKKLAYEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATINAD---GLGIIDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL ESKSAARR + +GG Y+NN +V      I  D+++ G+ LLL  GKKN   + +S
Sbjct  378  GLSESKSAARRTVGEGGAYVNNTKVSDPDAVIAPDELLHGRYLLLRRGKKNLATIEVS  435



>ref|WP_033435726.1| tyrosyl-tRNA synthetase [Saccharothrix syringae]
Length=424

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V DADVVR+L++ TFL+ EE+ EL+ Q     +    AQ+RLA+E T  V
Sbjct  250  PYAWYQYFVNVGDADVVRYLRMFTFLSREEVAELERQTAEQPHL-RAAQKRLAQEFTDLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+    + + A++AL       +LD  T+    ++VP+  +        +++DL V SG
Sbjct  309  HGEHETRQVIAASQALFGRGELRELDASTLGAAMAEVPTGEVAL--ADGPTIVDLLVGSG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L +SK AARR +K+GG Y+NNA+V  E     +DD++ G+ L++  GK+N   VR+
Sbjct  367  LADSKGAARRTVKEGGAYVNNAKVTDEEWVPAKDDLLHGEWLVVRRGKRNTAGVRV  422



>gb|AJK58517.1| tyrosyl-tRNA synthetase [Amycolatopsis lurida NRRL 2430]
Length=424

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V DADV+R+L++ +FL  EEI  L        +   +AQR+LAE+ T  V
Sbjct  250  PYAWFQYFVNVADADVIRYLRMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEDFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL       +LD  T++   ++VP+  +  D     +++DL +++G
Sbjct  309  HGEEATRQVIAASQALFGRGELRELDSATLDAAMAEVPNGKV--DPNGESTIVDLLIAAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIADEEWKPSADDALHGRWLVVRKGKRNVAGVRV  422



>ref|WP_007000220.1| tyrosyl-tRNA synthetase [Actinobaculum massiliense]
 gb|EKU95914.1| tyrosine-tRNA ligase [Actinobaculum massiliae ACS-171-V-Col2]
Length=424

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 95/176 (54%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  D DVVR LK+ TF T EEIE L  ++     A   AQR LA +VT +V
Sbjct  248  PYAFYQFWLNTADEDVVRMLKVFTFRTREEIEALAKEVEERPQA-REAQRTLARDVTTWV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  +    A+ AL  G    +LD  T+    +++PS      Q +    +      G
Sbjct  307  HGAEATERVEAASRALFGGEELFELDVATLRDAVAELPSTGAEVGQPVVELFVGTGQERG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            +     AARR +  GGLY+NN +VD +A  +  + I+DG ++LL  GKKN  V R+
Sbjct  367  I----GAARRTVASGGLYINNQKVDDDAAVLSAEQILDGGLVLLRKGKKNLAVARV  418



>emb|CCQ46715.1| tyrosyl-tRNA synthetase [Arthrobacter siccitolerans]
Length=437

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 111/180 (62%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EIE++   +    +A    QR+LA EVT  V
Sbjct  263  PYAFYQFWLNTADADVVDRLKVFTFLTRAEIEDIAAAVAERPFA-REGQRKLAFEVTALV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E  ++ + A+ AL  GN D + LD +T++   S++PS ++  D   ++ ++DL V+S
Sbjct  322  HGVEATEKVIAASAALF-GNGDLSALDKQTLQAATSELPSTTVQVD---ALGIVDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS*P  191
            GL +SKSAARR + +GG Y+NN +V      I E +++ G+ LLL  GKKN   V +  P
Sbjct  378  GLSDSKSAARRTVGEGGAYVNNEKVLDPEAVISESELLHGQYLLLRRGKKNLATVEVLVP  437



>ref|WP_026460182.1| tyrosyl-tRNA synthetase [Actinomyces suimastitidis]
Length=421

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 94/177 (53%), Gaps = 4/177 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V D DV+RFLKI TF+T EE+  L+ ++    +    AQ+ LA  VT  V
Sbjct  248  PYAFYQFWLQVADEDVIRFLKIFTFITREEVAALEVEVAERPH-QRAAQKELAARVTALV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+  LD  L AT AL       +LD  T+    +D+P   +   +   +  L  +    
Sbjct  307  HGETELDRVLAATAALWGSGDLRQLDEVTLRSAVADLPRAQVKLGEGTVVDALVGAGVEK  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                +SAARR +  GG YLNN +VD E   I   D + G + L+  G++N +VV ++
Sbjct  367  G---RSAARRTVASGGAYLNNIKVDDEDAPIGHADALPGGLALVRKGRRNLIVVELT  420



>ref|WP_042409186.1| tyrosyl-tRNA synthetase [Corynebacterium sp. JCB]
Length=423

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 103/170 (61%), Gaps = 3/170 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +  DADV+R+L+  TFL  EE+E L+T++    +    AQRRLA+E+T  V
Sbjct  250  PYTWYQYFVNTADADVIRYLRWFTFLDQEELERLETEVAERPF-KREAQRRLAQEMTDLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E  +    A++AL      T LD  T+    S+       F      +++DL V +G
Sbjct  309  HGREAREAVELASQALFGRAELTDLDEATLAAAVSETDV--FEFSAGDQPTIVDLLVGAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            L +SK AARR +K+GG+Y+NN R++ E+   E DD++ G  L+L  GKKN
Sbjct  367  LADSKGAARRSIKEGGVYVNNQRIEDESWAPEADDLLHGSWLVLRRGKKN  416



>ref|XP_009837943.1| tyrosine-tRNA ligase [Aphanomyces astaci]
 gb|ETV72715.1| tyrosine-tRNA ligase [Aphanomyces astaci]
Length=439

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 97/178 (54%), Gaps = 8/178 (4%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTRF  551
            Y FYQ+F    DADV   LK  T L ++EI+ +   +     AP    AQ+ LAE  TR 
Sbjct  262  YDFYQFFIRTDDADVGTLLKTFTLLDMDEIDTI---VATHSAAPEKRHAQQILAEHTTRM  318

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            +HG+  L  A  A + L  G+ D       ++ +A D P  SL  + V    V+D+    
Sbjct  319  IHGEVALKAAQVAAKVLFGGSLDGV---DAVDILAIDAPRSSLALELVRGKRVVDVLALI  375

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
              + +K+  RR++K GG+Y+NN RVDS+A  IE   +++G+ +L+  GK+N  V+ IS
Sbjct  376  RAVPTKAEGRRLIKAGGVYINNVRVDSDAAVIEASQVIEGRAVLVRVGKRNYHVLHIS  433



>ref|WP_034466497.1| tyrosyl-tRNA synthetase [Actinomyces sp. ICM54]
 gb|EWC96222.1| tyrosine--tRNA ligase [Actinomyces sp. ICM54]
Length=420

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 92/177 (52%), Gaps = 4/177 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V D DVVRFLKI TF + EEIE L  ++    +    AQ+ LA  VT  V
Sbjct  248  PYAFYQFWLQVADDDVVRFLKIFTFKSREEIEALAVEVAERPH-QRAAQKALAASVTELV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG + L   L AT+AL  G     LD  T+    +D+P  SL   +      L       
Sbjct  307  HGADQLQRVLAATDALWGGGDIRDLDEATLVAATADLPRASLTVGESTVADALVALGFEK  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                K+AARR +  GG  +NN +V+     + E+D++ G + L+  G+KN  V+ +S
Sbjct  367  G---KTAARRTISSGGASINNVKVEDPEAVLAEEDVLAGGLALIRKGRKNLAVLELS  420



>ref|WP_008674495.1| tyrosyl-tRNA synthetase [Rhodopirellula sallentina]
 gb|EMI57784.1| tyrosine--tRNA ligase [Rhodopirellula sallentina SM41]
Length=449

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 99/179 (55%), Gaps = 6/179 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQM-GNPGYAPNTAQRRLAEEVTRF  551
            PY FYQY+ +V D DV+R +  LT +  +E +EL  +   +PG     AQ+RLA+ +T  
Sbjct  268  PYAFYQYWVNVADDDVMRCIAQLTEIEKDEYDELAERTEKSPG--ERAAQKRLAQWITTL  325

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+EG++ A +AT+ L  G      D +  E I +DVPSC++  DQ+    +  +    
Sbjct  326  VHGEEGVESAQRATQILFGGELGNTTDSQLRE-IFADVPSCNITQDQIDGDGLWIVEALQ  384

Query  370  glleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
             +    S   ARR +K+  +YLNN RV  E K+I   D     V++L  GK+   ++++
Sbjct  385  LVKLCSSGGEARRSVKENSIYLNNNRVTDEQKRITASDFDGRSVVVLRRGKRKYALLKL  443



>ref|WP_003099613.1| tyrosyl-tRNA synthetase [Amycolatopsis vancoresmycina]
 gb|EOD65437.1| tyrosyl-tRNA ligase [Amycolatopsis vancoresmycina DSM 44592]
Length=424

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 104/170 (61%), Gaps = 3/170 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V DADVVR+L++ TFL  EEI  L        +    AQ+RLAEE T  V
Sbjct  250  PYAWYQYFVNVGDADVVRYLRMFTFLDQEEIAALAEDTEQRPHL-RAAQKRLAEEFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL       +LD +T++   ++VP+  +  D     +++DL ++ G
Sbjct  309  HGEEQTRQVINASQALFGRGELGELDERTLDAAMAEVPNGKV--DPAGEPTIVDLLLAGG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            L++SK AARR LK+GG Y+NN ++  E  K   +D + GK L++  GK+N
Sbjct  367  LVDSKGAARRTLKEGGAYVNNVKIADEEWKPAREDALHGKWLVVRKGKRN  416



>gb|KDQ21806.1| hypothetical protein BOTBODRAFT_99200 [Botryobasidium botryosum 
FD-172 SS1]
Length=473

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 102/177 (58%), Gaps = 5/177 (3%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTRF  551
            + FYQ+F  V DADV ++LK+LTF +++EI+ L   M      P    AQR LA EVT  
Sbjct  298  FDFYQFFLRVADADVSKYLKLLTFRSVDEIDTL---MAEHERHPERRAAQRMLASEVTEL  354

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+EG+ +A   T AL   +         I+ + +D     +P  +VL   +  LS + 
Sbjct  355  VHGEEGVKQAEATTRALFDTDPSNVRASDVIKALQNDPRLVLVPAAEVLDEPLTKLSSNF  414

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                S+S AR++L  GGLYLNN+R+    K +++ D++DG++ +L AGK N +++ +
Sbjct  415  KQTRSRSEARKLLLAGGLYLNNSRIQDVNKVLQQSDLIDGRLAILRAGKDNHLIIAL  471



>ref|WP_028927384.1| tyrosyl-tRNA synthetase [Pseudonocardia acaciae]
Length=425

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 108/177 (61%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V D+DV R+L++ TFL  EE++ L  Q  +   A   AQRRLAEE+T  V
Sbjct  250  PYAWYQYFVNVADSDVGRYLRLFTFLGREELDALDEQTASRPQA-RAAQRRLAEELTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  D  ++A++AL  G A+ + LD  T+    ++VPS +         ++++L V +
Sbjct  309  HGADETDRVIRASQALF-GRAELRELDPGTLRAALAEVPSSTTSL--AAGPTIVELLVDT  365

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            GL  SK AARR + +GG Y+NNA+V  E  +   DD++ G+ L++  GK++   V I
Sbjct  366  GLAASKGAARRTVAEGGAYVNNAKVVDEEWRPSGDDLLHGRWLVVRRGKRHTAGVEI  422



>ref|WP_018779124.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 161MFSha2.1]
Length=436

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 109/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFL+  EIE L   +    +A    Q++LA EVT  V
Sbjct  263  PYTFYQFWLNTADADVVDRLKVFTFLSRAEIEALGEAVAERPFA-REGQKKLAYEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATINAD---GLGIIDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL ESKSAARR + +GG Y+NN +V      I  D+++ G+ LLL  GKKN   + ++
Sbjct  378  GLSESKSAARRTVGEGGAYVNNTKVSDPDAVIARDELLHGRYLLLRRGKKNLATIEVA  435



>ref|WP_020645475.1| tyrosyl-tRNA synthetase [Amycolatopsis balhimycina]
Length=424

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 103/170 (61%), Gaps = 3/170 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V DADVVR+L++ TFL  EEI  L        +    AQRRLAEE T  V
Sbjct  250  PYAWYQYFVNVGDADVVRYLRMFTFLGQEEIAALADDTEQRPHL-RAAQRRLAEEFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A+ AL  G     LD +T++   ++VP+  +  D   + +++DL ++ G
Sbjct  309  HGEEQTRQVIAASRALFGGGELRDLDERTLDAAMAEVPNGKV--DPSGAPTIVDLLLAGG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            L++SK+AARR +K+GG Y+NN +V  E       D + GK L++  GK+N
Sbjct  367  LVDSKAAARRAVKEGGAYVNNVKVADEEWTPSAGDALHGKWLVVRKGKRN  416



>ref|WP_019194888.1| tyrosyl-tRNA synthetase [Corynebacterium timonense]
Length=421

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 105/177 (59%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +  DADV+RFL+  TFLT EE++EL  ++    YA   AQ+RLA E+T  V
Sbjct  250  PYTWYQYFVNTADADVIRFLRWFTFLTKEELDELAVEVEERPYA-REAQKRLAREMTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  +    A++AL        LD  T+E    +    +  +      +++D  V +G
Sbjct  309  HGAEATEAVELASQALFGRAELAALDRATLESAVKE----TAVYQASQEDTIVDYLVGTG  364

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            L +S+ AARR +K+GG+Y NN RV+SE    + DD++ G+ L+L  GKKN   V+++
Sbjct  365  LADSRGAARRSIKEGGVYANNVRVESEEWTPDADDLLHGEWLVLRRGKKNFAGVKVA  421



>ref|WP_043622222.1| tyrosyl-tRNA synthetase [Nonomuraea candida]
Length=421

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 104/170 (61%), Gaps = 4/170 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQYF +  D DV+ +LK+ TF   EEIE L+  +    +A   AQR LAE++T  +
Sbjct  249  PYAFYQYFLNSDDRDVIHYLKVFTFRGREEIEALEKAVAERPFA-REAQRTLAEDLTEML  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++ LD  L A++AL    A  +L   T+    ++VP  ++P    L  S +DL   SG
Sbjct  308  HGRQELDAVLAASKALFGQGALEELPAATLGAALAEVPKATVP---ALGASFVDLLADSG  364

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            L+ESKSAARR +K+GG YLNN ++  E+     DD++ G+ ++L  GKK+
Sbjct  365  LVESKSAARRAVKEGGAYLNNRKITDESYTPTADDLLGGRFMVLRRGKKS  414



>ref|WP_005163244.1| tyrosyl-tRNA synthetase [Amycolatopsis azurea]
 gb|EMD24423.1| Tyrosyl-tRNA synthetase [Amycolatopsis azurea DSM 43854]
Length=424

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V D+DV+R+L++ +FL  EEI  L        +   +AQR+LAE+ T  V
Sbjct  250  PYAWFQYFVNVADSDVIRYLRMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEDFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL       +LD  T++   ++VP+  +  D     +++DL ++ G
Sbjct  309  HGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNGESTIVDLLIAGG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  EA K   +D + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIADEAWKPSAEDALHGRWLVVRKGKRNVAGVRV  422



>ref|XP_004334902.1| tyrosine-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR12889.1| tyrosine-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=480

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 101/176 (57%), Gaps = 1/176 (1%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFVH  545
            Y+FYQYF +  DAD+ RFLK+ T L +  IEE+  Q  +     +  Q+ LAEEVTR V 
Sbjct  304  YEFYQYFRNTRDADLRRFLKLFTLLPLPRIEEIA-QAHDLRPEEHAGQKVLAEEVTRLVR  362

Query  544  GQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssgl  365
            G++GL  ALKAT  +        L    +  +  DVPS +LP   V+   +  L V+   
Sbjct  363  GEQGLHTALKATRVMFGDEPVDSLPPSELLAVLKDVPSVTLPRSSVVGQPLSGLMVACRA  422

Query  364  leSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
              SK  ARR++K GG+Y+N+ RV ++  ++  DD++   + +L  GKK+  +V+++
Sbjct  423  TASKGEARRLVKGGGVYVNSKRVPNDDYQVGPDDVLGDALCVLRVGKKSYFLVKLT  478



>ref|WP_013227826.1| tyrosyl-tRNA synthetase [Amycolatopsis mediterranei]
 ref|YP_003768175.1| tyrosyl-tRNA synthetase [Amycolatopsis mediterranei U32]
 gb|ADJ47773.1| tyrosyl-tRNA synthetase [Amycolatopsis mediterranei U32]
 gb|AEK44661.1| tyrosyl-tRNA synthetase [Amycolatopsis mediterranei S699]
 gb|AFO79484.1| tyrosyl-tRNA synthetase [Amycolatopsis mediterranei S699]
 gb|AGT86612.1| tyrosyl-tRNA synthetase [Amycolatopsis mediterranei RB]
 gb|KDO10309.1| tyrosyl-tRNA synthetase [Amycolatopsis mediterranei]
 gb|KDU85365.1| tyrosyl-tRNA synthetase [Amycolatopsis mediterranei]
Length=426

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 103/170 (61%), Gaps = 3/170 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V DADVVR+L++ TFL  EEI  L        +    AQ+RLAEE T  V
Sbjct  252  PYAWYQYFVNVGDADVVRYLRMFTFLDQEEIAALAEDTEQRPHL-RAAQKRLAEEFTTLV  310

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL        LD +T++   ++VP+  +  D     +++DL ++ G
Sbjct  311  HGEEQTRQVINASQALFGRGELGDLDERTLDAAMAEVPNGKV--DPGAEPTIVDLLLAGG  368

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            L++SK AARR LK+GG Y+NN ++  E  K   +D + GK L++  GK+N
Sbjct  369  LVDSKGAARRTLKEGGAYVNNVKIADEEWKPSREDALHGKWLVVRKGKRN  418



>ref|WP_041314757.1| tyrosyl-tRNA synthetase [Saccharothrix espanaensis]
Length=424

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTR  554
            PY +YQYF +V DADV+R+L++ TFL+ EEI EL+ Q      AP+   AQ++LAEE T 
Sbjct  250  PYAWYQYFVNVGDADVLRYLRLFTFLSQEEIAELERQTTE---APHLRAAQKKLAEEFTD  306

Query  553  FVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvs  374
             VHG+    + + A++AL       +LD  T+E   ++ P+  +      + +++DL V+
Sbjct  307  LVHGERETQQVITASQALFGRGELRELDLSTLEAAMAEAPTGEVRL--ADAPTIVDLLVN  364

Query  373  sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            SGL +S  AARR +K+GG Y+NN +V  EA    +DD++ G  L++  GK+N   VR+
Sbjct  365  SGLADSNGAARRTVKEGGAYVNNTKVTDEAWVPAKDDLLHGSWLVVRRGKRNTAGVRV  422



>gb|AAP58586.1| putative tyrosyl-tRNA synthetase [uncultured Acidobacteria bacterium]
Length=422

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 95/178 (53%), Gaps = 5/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfl-tieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY+FYQ++ +  D D VR+LK  TFL      E   + +  P      AQR LA EVTR 
Sbjct  247  PYEFYQFWLNTDDRDAVRYLKFFTFLDAARVGELEASSLAEP--EKRVAQRELAREVTRL  304

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG + + +A  A+E L  G+  T++    +  + ++VPS ++ F          ++   
Sbjct  305  VHGSQAVLDAEAASEKLFRGDV-TQMSVDELLQVFANVPSSTVAFSDDGWALADLVTSVG  363

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                 K  A+R+++ GGLY+N  R+  E  ++  +D + G+V ++  GKK+  +VRIS
Sbjct  364  VTKS-KGEAQRLVRAGGLYVNERRIGEEKARLTAEDAIGGQVFVIRKGKKDNFLVRIS  420



>ref|WP_042457579.1| tyrosyl-tRNA synthetase [Streptacidiphilus jiangxiensis]
Length=421

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 107/176 (61%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  D D+ +FL+I +F + EEIEEL+ ++         AQR LAEE+T  V
Sbjct  248  PYAFYQFWLNADDRDISKFLRIFSFKSHEEIEELE-RLTEEAPFKRAAQRALAEELTVLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQE LD A+ A++AL       +LD +T+    +++PS  +         ++DL V++G
Sbjct  307  HGQEQLDRAVAASKALFGQGELGELDERTLAAAVAELPSAQV----GELGEIVDLFVATG  362

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L  S+SAARR + +GG Y+NNA+++ EA      D++ G+ L+L  GK+N   V +
Sbjct  363  LSASRSAARRTVNEGGAYVNNAKIEDEAALATPADLLHGRWLVLRRGKRNLAAVEL  418



>ref|WP_037345658.1| tyrosyl-tRNA synthetase [Amycolatopsis sp. MJM2582]
 gb|KFZ78350.1| tyrosyl-tRNA synthetase [Amycolatopsis sp. MJM2582]
Length=424

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V D+DV+R+L++ +FL  EEI  L        +   +AQR+LAE+ T  V
Sbjct  250  PYAWFQYFVNVADSDVIRYLRMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEDFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL       +LD  T++   ++VP+  +  D     +++DL +++G
Sbjct  309  HGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNGESTIVDLLIAAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIVDEEWKPSSDDALHGRWLVVRKGKRNVAGVRV  422



>ref|WP_013398793.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|ADP41072.1| tyrosine--tRNA ligase [Rothia dentocariosa ATCC 17931]
Length=434

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 99/176 (56%), Gaps = 4/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADV+  LK+ TFLT  EI E + ++    Y   T Q+RLA EVT  V
Sbjct  262  PYAFYQFWLNTADADVIDRLKVFTFLTRAEIGEYEHKVEAEAYKRET-QKRLAYEVTALV  320

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  ++A+ A+EAL        LD  T++ +  ++PS  L  D++  I+ L     + 
Sbjct  321  HGVEPTEQAIAASEALFGKGDFAALDESTLQAVMDELPSVELSSDRLDLITALTELGFAS  380

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                KS ARR+LK+GG  +N  +V  E  +I  + ++ GK  ++  GKKN+  + +
Sbjct  381  S---KSEARRILKEGGASVNGVKVQGEDARISSEQLLHGKYAIVRRGKKNQGAITV  433



>ref|WP_018771549.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 162MFSha1.1]
Length=437

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 108/180 (60%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EIEE+   +    +A    QR+LA EVT  V
Sbjct  263  PYAFYQFWLNTADADVVDRLKVFTFLTRAEIEEIAVSVAERPFA-REGQRKLAFEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D   LD  T++   S++PS ++  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLAALDKATLQAATSELPSATVQVD---GMGIVDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS*P  191
            GL ESKSAARR + +GG Y+NN +V      I E +++ G+ LLL  GKKN   V +  P
Sbjct  378  GLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRGKKNLATVEVLVP  437



>ref|WP_030504916.1| tyrosyl-tRNA synthetase [Microbispora rosea]
Length=421

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 102/170 (60%), Gaps = 6/170 (4%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRFV  548
            Y FYQY+ +  D DVVRFLK+ TF T EEI+EL+  +   P  A   AQR LAE++T  V
Sbjct  250  YAFYQYWLNADDRDVVRFLKVFTFRTREEIDELEKAVAERP--AAREAQRALAEDLTTLV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG + L   + A+ AL    +  +LD +T+E   ++VP   +P    L    ++L   SG
Sbjct  308  HGSDELARVIAASRALFGQGSLAELDARTLESALAEVPKAVVP---TLGAPYVELLAQSG  364

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            L+ESKSAARR +K+GG YLNN ++  E      DD++ G+ L+L  GKK 
Sbjct  365  LVESKSAARRAVKEGGAYLNNTKITDEEYVPSADDLLHGRFLVLRRGKKT  414



>ref|WP_036865421.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH2963]
 gb|KGN94389.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH2963]
Length=431

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 101/185 (55%), Gaps = 11/185 (6%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlki-ltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V DAD  +++KI  +    E     + Q   P   P   Q+RLAEEVT  
Sbjct  250  PYKFYQFWLNVSDADAAKYIKIFTSLTKEEIAALEEEQAAAPHLRP--LQKRLAEEVTCM  307

Query  550  VHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFDQvlsisvldl  383
            VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP D++    +  L
Sbjct  308  VHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPMDKINGEGINIL  366

Query  382  svssglle---SKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKM  212
             + +  +    S+   R++LK GG+ +N  +V+SE   +   D++ GK +L   GKKN  
Sbjct  367  DLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKYILAQKGKKNYF  426

Query  211  VVRIS  197
            ++  +
Sbjct  427  LITFA  431



>ref|WP_028846608.1| tyrosyl-tRNA synthetase [Thermocrispum agreste]
Length=424

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V DADV+R+LK+ TFL  EEI EL+    +  +    AQRRLAEE+T  V
Sbjct  250  PYAWFQYFINVADADVIRYLKLFTFLPQEEIAELERLTKDEPFR-RAAQRRLAEELTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG +   + + A++AL        LD  T++ + ++VP+  +        +++DL V SG
Sbjct  309  HGPDQTAQVIAASQALFGKGEFAALDEATLDAVMAEVPTGEVAL--ADDPTIVDLLVVSG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +++GG Y+NN ++  E  + +  D + GK L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTIREGGAYVNNTKISDEEWRPQASDALHGKWLIVRRGKRNVAGVRV  422



>ref|WP_013838509.1| tyrosyl-tRNA synthetase [Isoptericola variabilis]
 gb|AEG44117.1| Tyrosyl-tRNA synthetase [Isoptericola variabilis 225]
Length=419

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 101/173 (58%), Gaps = 5/173 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVVR+LK+ TF T +EI EL+  +    +A   AQR LA +VT  V
Sbjct  248  PYAFYQFWLNTADADVVRYLKVFTFRTRDEIAELEQAVAERPFA-REAQRTLASDVTTLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ   D  + A++AL        LD +T+    +++P  +          V+D  V SG
Sbjct  307  HGQGATDAVIAASQALFGRGDLGSLDARTLGAAVAELPRTT----AKAGDLVVDAFVGSG  362

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  209
            L+ SK+AARR + +GG Y+NN +V SE + +E DD++ G+  +L  GKK   V
Sbjct  363  LVASKAAARRAIAEGGAYVNNVKVTSEEQVLEPDDLLHGRYAVLRRGKKTLAV  415



>ref|WP_044851982.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis]
Length=424

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V DADV+R+LK+ +FL  EEI  L        +   +AQR+LAE+ T  V
Sbjct  250  PYAWFQYFLNVADADVIRYLKMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEDFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+    + + A++AL       +LD  T++   ++VP+  +  D     +++DL +++G
Sbjct  309  HGEAATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNGESTIVDLLIAAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIADEEWKPSADDALHGRWLVVRKGKRNVAGVRV  422



>ref|WP_007028024.1| tyrosyl-tRNA synthetase [Amycolatopsis decaplanina]
 gb|EME65067.1| tyrosyl-tRNA ligase [Amycolatopsis decaplanina DSM 44594]
Length=424

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V D DV+R+LK+ +FL  EEI  L        +   +AQR+LAE+ T  V
Sbjct  250  PYAWFQYFVNVADVDVIRYLKMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEDFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL       +LD  T++   ++VP+  +  D     +++DL +++G
Sbjct  309  HGEEATRQVIAASQALFGRGELRELDSATLDAAMAEVPNGKV--DPNGESTIVDLLIAAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIADEEWKPSADDALHGRWLVVRKGKRNVAGVRV  422



>emb|CCH33827.1| Tyrosyl-tRNA synthetase [Saccharothrix espanaensis DSM 44229]
Length=476

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTR  554
            PY +YQYF +V DADV+R+L++ TFL+ EEI EL+ Q      AP+   AQ++LAEE T 
Sbjct  302  PYAWYQYFVNVGDADVLRYLRLFTFLSQEEIAELERQTTE---APHLRAAQKKLAEEFTD  358

Query  553  FVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvs  374
             VHG+    + + A++AL       +LD  T+E   ++ P+  +      + +++DL V+
Sbjct  359  LVHGERETQQVITASQALFGRGELRELDLSTLEAAMAEAPTGEVRL--ADAPTIVDLLVN  416

Query  373  sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            SGL +S  AARR +K+GG Y+NN +V  EA    +DD++ G  L++  GK+N   VR+
Sbjct  417  SGLADSNGAARRTVKEGGAYVNNTKVTDEAWVPAKDDLLHGSWLVVRRGKRNTAGVRV  474



>ref|WP_017197962.1| tyrosyl-tRNA synthetase [Arthrobacter sp. M2012083]
Length=436

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 109/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFL+  EIE L   +    +A    Q++LA EVT  V
Sbjct  263  PYTFYQFWLNTADADVVDRLKVFTFLSRAEIEALGQAVEERPFA-REGQKKLAFEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATVGAD---GLGIIDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL +SKSAARR + +GG Y+NN +V      I  D+++ G+ LLL  GKKN   + +S
Sbjct  378  GLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIARDELLHGRYLLLRRGKKNLATIEVS  435



>ref|WP_037313083.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis]
Length=424

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY ++QYF +V DADV+R+LK+ +FL  EEI  L        +   +AQR+LAE+ T  V
Sbjct  250  PYAWFQYFLNVADADVIRYLKMFSFLGQEEIAALAEDTEQRPHL-RSAQRKLAEDFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+    + + A++AL       +LD  T++   ++VP+  +  D     +++DL +++G
Sbjct  309  HGEAATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNGESTIVDLLIAAG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+N   VR+
Sbjct  367  LVDSKGAARRTVKEGGAYVNNTKIADEEWKPSADDALHGRWLVVRKGKRNVAGVRV  422



>ref|WP_004600657.1| tyrosyl-tRNA synthetase [Turicella otitidis]
 emb|CCI83472.1| tyrosyl-tRNA synthetase [Turicella otitidis ATCC 51513]
 gb|EJZ82246.1| tyrosyl-tRNA synthetase [Turicella otitidis ATCC 51513]
Length=424

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 102/172 (59%), Gaps = 7/172 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYFF+  DADVVR+L+  TFL  EE++EL  Q+ N  +    AQRRLA+E+T  V
Sbjct  251  PYAWYQYFFNTADADVVRYLRWFTFLGKEELDELAEQVENEPH-RRAAQRRLAQEMTDLV  309

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGI--ASDVPSCSLPFDQvlsisvldlsvs  374
            HG++   +   A++AL       +LD  T+      +DV   + P ++   +S+L  S  
Sbjct  310  HGEDARKQVELASQALFGRAELRELDEATLSAALRETDVAEVA-PGEERDIVSLLVASGL  368

Query  373  sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            +     + AARR LK+GG+Y+NN RV  EA +   DD++ G  L+L  GKKN
Sbjct  369  AKS---RGAARRSLKEGGIYVNNERVTDEAYEPASDDLLFGHWLVLRRGKKN  417



>ref|WP_018296313.1| tyrosyl-tRNA synthetase [Corynebacterium lubricantis]
Length=423

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +  DADV+R+L+  TFLT EE++EL+ ++    +    AQ+RLA+E+T  V
Sbjct  249  PYTWYQYFINASDADVIRYLRWFTFLTKEELDELEVEVAERPF-KREAQKRLAQEMTNLV  307

Query  547  HGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E       A++AL  G AD + LD KT+    S+     +   +  +I  L +    
Sbjct  308  HGTEATKAVELASQALF-GRADLEDLDEKTLASSVSETEVFEVAPGEARTIVDLLVGTGL  366

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                 + AARR +K+GG Y+NN RVDSE  + + +D++ GK L+L  GKKN   V+I+
Sbjct  367  VDS--RGAARRAIKEGGAYVNNQRVDSEEWEPQSEDLLHGKWLVLRRGKKNFAGVKIT  422



>ref|WP_012825381.1| tyrosyl-tRNA synthetase [Haliangium ochraceum]
 gb|ACY12754.1| tyrosyl-tRNA synthetase [Haliangium ochraceum DSM 14365]
Length=432

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 108/178 (61%), Gaps = 7/178 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTR  554
            PY FYQY+ + PD DV R L++ ++ +++EI+EL    G    AP     Q  LAE++T 
Sbjct  255  PYAFYQYWLNTPDDDVARLLRVFSWRSLDEIDELVRAHGE---APQKRLGQSALAEDLTD  311

Query  553  FVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis-vldlsv  377
            +VHG+E    AL A++ +  G+ +  L+   ++ + +D+P+ SLP  Q+ S   +L+L  
Sbjct  312  WVHGEEAKRNALAASQVMFGGSLE-NLNDAALQPLTADLPTTSLPRQQLESGIPLLELLA  370

Query  376  ssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
             + L  SK AARR+++ GG+Y+NN RV    K +  +D+    +++L AGKKN  +V+
Sbjct  371  QTKLAASKGAARRLVQGGGVYVNNIRVADVNKTLLPEDLGTETIMILRAGKKNYHLVQ  428



>ref|WP_033442848.1| tyrosyl-tRNA synthetase [Saccharothrix sp. NRRL B-16314]
Length=424

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 111/178 (62%), Gaps = 7/178 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTR  554
            PY +YQYF +V DADV+R+L++ TFL+ +E+ EL+ Q      AP+   AQ++LA+E T 
Sbjct  250  PYAWYQYFVNVGDADVLRYLRLFTFLSRDEMSELERQTSE---APHLRAAQKKLAQEFTD  306

Query  553  FVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvs  374
             VHG+    + + A++AL       +LD  TIE   ++ P+  +      + +++DL VS
Sbjct  307  LVHGEHETRQVIAASQALFGRGELRELDLSTIEAAMAEAPTGEVRL--ADAPTIVDLLVS  364

Query  373  sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            SGL ESK AARR +K+GG Y+NNA+V  E     ++D++ G  L++  GK+N   VR+
Sbjct  365  SGLAESKGAARRTVKEGGAYVNNAKVADEEWVPAKEDLLHGTWLVVRRGKRNTAGVRV  422



>ref|WP_042380116.1| tyrosyl-tRNA synthetase [Streptacidiphilus melanogenes]
Length=420

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 106/176 (60%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  D D+ +FL+I +F + EEIEEL+ +M         AQR LAEE+T  V
Sbjct  248  PYAFYQFWLNADDRDISKFLRIFSFKSHEEIEELE-RMTEEAPFKRAAQRALAEELTVLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+ LD A+ A++AL      ++LD  T+    +++PS  +         ++DL V++G
Sbjct  307  HGQDQLDRAVAASKALFGQGDLSELDAPTLAAAVAELPSAQV----GELGELVDLFVATG  362

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L  S+SAARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK+N   V +
Sbjct  363  LSASRSAARRTINEGGAYVNNTKVEDEAATAAPADLLHGRWLVLRRGKRNLAAVEL  418



>ref|WP_021852743.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:1058]
 emb|CCX65061.1| tyrosine--tRNA ligase [Prevotella sp. CAG:1058]
Length=433

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 101/180 (56%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQM-GNPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  E I+ L  +   +PG    T QRRLAEEVT  
Sbjct  254  PYKFYQFWLNVSDDDAERYIKIFTSLDKETIDALVEEHRQDPG--RRTLQRRLAEEVTVM  311

Query  550  VHGQEGLDEALKATEAL---RPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH +E  D A++A+  L       +  KLD +T+  I   VP   +  D++   ++   +
Sbjct  312  VHSREDYDAAVEASNILFGKSTKESLMKLDEQTLLDIFEGVPQFEISRDKLGLQAIELFT  371

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              + +  SK   R++++ GG+ LN  ++ +  + I  DD++DGK LL+  GKKN  +V +
Sbjct  372  TEAAVFASKGEMRKLVQGGGVSLNKDKLTAFDRAITADDLIDGKYLLVQRGKKNYYLVTV  431



>ref|XP_002907836.1| tyrosyl-tRNA synthetase, putative [Phytophthora infestans T30-4]
 gb|EEY64400.1| tyrosyl-tRNA synthetase, putative [Phytophthora infestans T30-4]
Length=428

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 103/176 (59%), Gaps = 6/176 (3%)
 Frame = -2

Query  724  YKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTRF  551
            + FYQ+F    D DV + L   TF  ++EI  +  +      AP    AQ+ LAEE+T  
Sbjct  255  FDFYQFFLRSDDRDVEKLLNSFTFREVDEIHGIIAEHEK---APEKRAAQKVLAEEITVM  311

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V++ S++DL+V  
Sbjct  312  MHGQEGLKAALDATEML-FGKKTGPLTSEEMLCMAGDAPMTVLSRADVINQSLVDLAVRI  370

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
            G  +SK+  RR++K GG+YLNN RV+S A +I + +++D KVL++  G++N  +V+
Sbjct  371  GATKSKAECRRLIKSGGVYLNNERVESAALRIGKSNLLDDKVLVVRVGRRNNFIVQ  426



>ref|WP_013515994.1| tyrosyl-tRNA synthetase [Desulfovibrio aespoeensis]
 gb|ADU64093.1| tyrosyl-tRNA synthetase [Desulfovibrio aespoeensis Aspo-2]
Length=427

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (57%), Gaps = 8/176 (5%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPN--TAQRRLAEEVTR  554
            PY FYQ+F +  D DV++FLK+ TFL  +EI  L+ ++     AP+  +AQ+RLAEEVTR
Sbjct  255  PYAFYQFFINTDDRDVIKFLKLFTFLDQDEINALERELAE---APHLRSAQKRLAEEVTR  311

Query  553  FVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvs  374
             VHGQ  LD  + ATEAL    +   +D  T+       P C   +       +  + + 
Sbjct  312  MVHGQPELDRVMAATEALFGEGSLKGVDPATLRAALETAPHCH--YAPSNVPDLPQMLLD  369

Query  373  sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVV  206
              L  SK  AR+ +  GG+Y+N  RV+++ + + E D + G++L++  GKK+  +V
Sbjct  370  LQLAASKGQARKDIASGGVYINGERVEAD-QGVAEADFIGGELLIIRKGKKHYGLV  424



>ref|WP_018763582.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 135MFCol5.1]
Length=437

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 108/180 (60%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EIEE+   +    +A    QR+LA EVT  V
Sbjct  263  PYAFYQFWLNTSDADVVDRLKVFTFLTRAEIEEIAVSVAERPFA-REGQRKLAFEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D   LD  T++   S++P+ ++  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLAALDKATLQAATSELPTTTVQVD---GMGIVDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS*P  191
            GL ESKSAARR + +GG Y+NN +V      I E +++ G+ LLL  GKKN   V +  P
Sbjct  378  GLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRGKKNLATVEVLVP  437



>ref|WP_005457874.1| tyrosyl-tRNA synthetase [Saccharomonospora cyanea]
 gb|EHR62236.1| tyrosyl-tRNA synthetase [Saccharomonospora cyanea NA-134]
Length=424

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 97/176 (55%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVR-FlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY +YQYF ++PDADVVR    +      E  E        P  A   AQRRLAEE+T  
Sbjct  250  PYAWYQYFLNLPDADVVRCLKLLTFLDADEIGELETATRERP--AARQAQRRLAEELTDL  307

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG E   + + A++AL       +LD  T++ + ++VP+  +        +++DL V+ 
Sbjct  308  VHGPEQTRQVVAASQALFGRGELRELDGATLDAVMAEVPTGEVKL--ADGPTIVDLLVAG  365

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
            GL+ESK AARR +K+GG Y+NN ++  E    E  D + G+ L++  GKK    VR
Sbjct  366  GLVESKGAARRTVKEGGAYVNNTKIVDEDWTPESSDALHGRWLVVRRGKKTLAGVR  421



>ref|WP_026547366.1| tyrosyl-tRNA synthetase [Arthrobacter nicotinovorans]
Length=436

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFL+  EIE L   +    +A    Q++LA EVT  V
Sbjct  263  PYTFYQFWLNTADADVVDRLKVFTFLSRAEIEALGEAVAERPFA-REGQKKLAFEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D   LD +T+E   +++PS ++  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLGVLDEQTLEAATAELPSATVAAD---GLGIIDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL +SKSAARR + +GG Y+NN +V      I +D ++ G+ LLL  GKKN   + +S
Sbjct  378  GLSDSKSAARRTVGEGGAYVNNTKVSDPEAVIGQDQLLHGRYLLLRRGKKNLATIEVS  435



>ref|WP_026541624.1| tyrosyl-tRNA synthetase [Arthrobacter nicotinovorans]
Length=436

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFL+  EIE L   +    +A    Q++LA EVT  V
Sbjct  263  PYTFYQFWLNTADADVVDRLKVFTFLSRAEIEALGEAVAERPFA-REGQKKLAFEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D   LD +T+E   +++PS ++  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLGVLDEQTLEAATAELPSATVAAD---GLGIIDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL +SKSAARR + +GG Y+NN +V      I +D ++ G+ LLL  GKKN   + +S
Sbjct  378  GLSDSKSAARRTVGEGGAYVNNTKVSDPEAVIGQDQLLHGRYLLLRRGKKNLATIEVS  435



>ref|WP_028931561.1| tyrosyl-tRNA synthetase [Pseudonocardia asaccharolytica]
Length=426

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 104/178 (58%), Gaps = 5/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY ++QYF +V DADV R+L++ TFL  EEI EL+  + + P       QRRLAEE+T  
Sbjct  251  PYAWFQYFVNVTDADVGRYLRLFTFLPPEEIVELEKDVADRPQL--RAGQRRLAEELTTL  308

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG+    + + A++AL       +LD  T++   ++VP+ ++   +  +I  L +    
Sbjct  309  VHGEHQTRQVVAASQALFGRGELAELDAATLDAAMAEVPTATVRIGERPTIVDLLVETGL  368

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                 + AARR +K+GG Y+NNA+V  EA    E D++ G+ L++  GK+N   VR++
Sbjct  369  TDS--RGAARRTVKEGGAYVNNAKVADEAWLPGEADLLHGRWLVVRRGKRNMAGVRVA  424



>ref|WP_011956798.1| tyrosine--tRNA ligase [Roseiflexus sp. RS-1]
 sp|A5UUZ9.1|SYY_ROSS1 RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Roseiflexus sp. RS-1]
 gb|ABQ90452.1| tyrosyl-tRNA synthetase [Roseiflexus sp. RS-1]
Length=424

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 111/178 (62%), Gaps = 4/178 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ++++V DADV ++L+  T+L+ +EIEEL+ ++        TAQ+RLA EVTR V
Sbjct  248  PYRFYQFWYNVDDADVGKYLRYFTWLSADEIEELE-RITASQPERRTAQQRLAREVTRMV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFD--Qvlsisvldlsvs  374
            HG+  L  A +A++AL  G+   +L    +  I  DVPS +LP    +     ++D+ + 
Sbjct  307  HGETALARAEEASQALFGGSL-ARLSAGDVIDIFEDVPSTTLPRQDFEGDGFPLIDVLLR  365

Query  373  sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
             G+  SKS ARR ++ GG+Y+NN +     +++  +D +DG+ ++L  G+K   +V++
Sbjct  366  CGIATSKSDARRTIEGGGIYVNNIQCPDVGRRLTLNDSIDGQFIVLRKGRKQYHLVKV  423



>ref|WP_021853510.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:255]
 emb|CCX68294.1| tyrosine--tRNA ligase [Prevotella sp. CAG:255]
Length=432

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 102/180 (57%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQM-GNPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  E I+ L  +   +PG    T QRRLAEEVT  
Sbjct  254  PYKFYQFWLNVSDDDAERYIKIFTSLDKETIDALVEEHRQDPG--RRTLQRRLAEEVTVM  311

Query  550  VHGQEGLDEALKATEAL---RPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH +E  D A++A+  L      ++  KLD +T   I   VP   +  D++   +V   +
Sbjct  312  VHSREDYDAAVEASNILFGKSTKDSLLKLDEQTFLDIFEGVPQFEVSKDKIGLPAVELFT  371

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              + +  SK   R++++ GG+ LN  ++ +  ++I  DD++DGK LL+  GKKN  ++ +
Sbjct  372  TEAAVFASKGEMRKLVQGGGVSLNKEKLAAFDREITSDDLIDGKYLLVQRGKKNYFLITV  431



>ref|WP_024366580.1| tyrosyl-tRNA synthetase [Arthrobacter sp. TB 26]
Length=437

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 107/178 (60%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  D+DV   LK+ TFL+  EIE L+  +    +A    QR+LA EVT  V
Sbjct  263  PYAFYQFWLNTADSDVAARLKVFTFLSRAEIEALEGAVAERPFA-REGQRKLAYEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D T LD  T++   S++PS S+       + ++DL V++
Sbjct  322  HGVDATEKVIAASAALF-GNGDLTVLDEATLKAATSELPSASV---DAAGLGIIDLLVAT  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL ESKSAARR + +GG Y+NNA+V      IE   ++ G+ LLL  GKKN   V +S
Sbjct  378  GLSESKSAARRTVGEGGAYVNNAKVSDPDALIERGQLLHGRYLLLRRGKKNLATVEVS  435



>ref|WP_014921325.1| tyrosyl-tRNA synthetase [Arthrobacter sp. Rue61a]
 gb|AFR28470.1| tyrosyl-tRNA synthetase TyrS [Arthrobacter sp. Rue61a]
Length=436

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 109/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFL+  EIE L   +    +A    Q++LA EVT  V
Sbjct  263  PYTFYQFWLNTADADVVDRLKVFTFLSRAEIEALGQAVEERPFA-REGQKKLAFEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATIGAD---GLGIIDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL +SKSAARR + +GG Y+NN +V      I  ++++ G+ LLL  GKKN   + +S
Sbjct  378  GLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIAREELLHGRYLLLRRGKKNLATIEVS  435



>ref|WP_003798662.1| tyrosyl-tRNA synthetase [Arthrobacter globiformis]
 dbj|GAB12490.1| tyrosyl-tRNA synthetase [Arthrobacter globiformis NBRC 12137]
Length=437

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 109/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFLT  EI+E+   +    +A    QR+LA EVT  V
Sbjct  263  PYTFYQFWLNTADADVVDRLKVFTFLTRAEIDEIAVSVAERPFA-REGQRKLAYEVTALV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG E  ++ + A+ A+  GN D + LD +T+    +++PS S+       + ++DL V+S
Sbjct  322  HGAEATEKVIAASAAVF-GNGDLSVLDEQTLAAATAELPSASV---DGTGLGIIDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL +SKSAARR++ +GG Y+NNA+V      I    ++ GK LLL  GKKN   V++S
Sbjct  378  GLSDSKSAARRVVGEGGAYVNNAKVTDPDAVIPPSQLLHGKYLLLRRGKKNLATVQVS  435



>ref|WP_006061976.1| tyrosyl-tRNA synthetase [Corynebacterium durum]
 gb|EKX91997.1| tyrosine--tRNA ligase [Corynebacterium durum F0235]
Length=421

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 100/176 (57%), Gaps = 3/176 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +  DADV+R+L+  TFLT EE+ EL+  +    +A   AQRRLA+E+T  V
Sbjct  248  PYAWYQYFINAADADVIRYLRWFTFLTQEELAELQQAVDERPHA-REAQRRLAQEMTNLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG++       A +AL      T+LD +T+ G  S+     +  +   +I  L ++    
Sbjct  307  HGKDATHAVELAAQALFGRAELTELDEETLAGALSETTIAEIGANDPRTIVDLLVATGLV  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                K AARR + +GG Y+NN R+ S+  +   +D++ G+ L+L  GKKN   VRI
Sbjct  367  ES--KKAARRAVNEGGAYVNNQRITSDEWQPTNEDLLHGRWLVLRRGKKNFAGVRI  420



>ref|WP_009103310.1| tyrosyl-tRNA synthetase [Rhodopirellula sp. SWK7]
 gb|EMI41459.1| Tyrosyl-tRNA synthetase [Rhodopirellula sp. SWK7]
Length=449

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 93/178 (52%), Gaps = 4/178 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQY+ +V D DV+R +  LT +  +E +EL  +          AQ+RLA+ +T  V
Sbjct  268  PYAFYQYWVNVADDDVMRCIAYLTEIEKDEYDELAERTEQSA-GERAAQKRLAQWMTTLV  326

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+EG++ A +AT+ L  G      D   +  I +DVPSC +  DQ+    +  +     
Sbjct  327  HGEEGIESAQRATQILFGGELGNTTD-DQLREIFADVPSCDISQDQIDGDGLWIVEALQL  385

Query  367  lleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                 S   ARR +K+  +YLNN RV  E K+I   D     V++L  GK+   ++++
Sbjct  386  AGLCSSGGEARRSVKENSIYLNNCRVTDEQKRIVGTDFDGRSVIVLRRGKRKYALLKL  443



>ref|WP_035732891.1| tyrosyl-tRNA synthetase [Gulosibacter molinativorax]
Length=440

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 105/177 (59%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADV+  LK+ TF + EEI E + ++ +  +    AQR LA  VT  V
Sbjct  268  PYAFYQFWLNTDDADVISRLKVFTFYSREEIGEFERKVADEPF-RREAQRALARAVTVLV  326

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E  D A+ A+EAL        L+ +T++   +++P+     +  +   +  + V +G
Sbjct  327  HGEEATDNAIAASEALFGQGDLLALNAETLQQAIAELPNT----ESTVGAELSQVLVDTG  382

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
             +ES SAARR +KQGG+ LNNAR++ E + IE  D++ G V+++  GKK  +   IS
Sbjct  383  AVESLSAARRAIKQGGVSLNNARIEDEHRVIESGDLLPGSVIVVRRGKKTLVGATIS  439



>gb|EXX57162.1| tyrosine--tRNA ligase MSY1 [Rhizophagus irregularis DAOM 197198w]
Length=360

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 107/178 (60%), Gaps = 4/178 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieei-eelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY+FYQYF  + DADV ++L++ T L++EEI + +KT M +P       Q +LA E+T F
Sbjct  183  PYEFYQYFMKLADADVEKYLRMFTILSMEEIDQIVKTHMKSP--EERKGQEKLASEITEF  240

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCS-LPFDQvlsisvldlsvs  374
            VHG  GL +A  AT  L   + +       IE    D    + +  +++++ ++  ++V+
Sbjct  241  VHGVAGLQKAQLATRVLFGDSLENIRGHDLIEAFLHDSQRLTPIHRNEIVNRTIDRVAVA  300

Query  373  sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            +G  +S++ A +++K GGLYLNN RV     K+ EDD++DG V ++  GK N  ++++
Sbjct  301  AGACKSRNEANKLIKVGGLYLNNQRVIEPHHKVIEDDLLDGVVCVIRTGKSNYHLIQV  358



>gb|EIE99747.1| tyrosyl-tRNA synthetase [Saccharomonospora glauca K62]
Length=426

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 98/177 (55%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVR-FlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY +YQYF ++PDADVVR    +      E  E        P  A   AQRRLA+E+T  
Sbjct  253  PYAWYQYFLNLPDADVVRCLKLLTFLDADEIGELETATKERP--AARQAQRRLAQELTDL  310

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG E   + + A++AL       +LD  T++   ++VP+  +   +    +++DL V+ 
Sbjct  311  VHGPEQTRQVVAASQALFGRGELRELDAATLDAAMAEVPTGEVKLSE--GPTIVDLLVAG  368

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            GL++SK AARR +K+GG Y+NN ++  E    E  D + G+ L++  GKK    VR+
Sbjct  369  GLVDSKGAARRTVKEGGAYVNNTKITQEDWAPELSDALHGRWLVVRRGKKTLAGVRV  425



>ref|WP_036910525.1| tyrosyl-tRNA synthetase [Prevotella sp. FD3004]
Length=431

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMG-NPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  + I+ L  +   +PG      Q+RLAEEVT  
Sbjct  253  PYKFYQFWLNVSDDDAERYIKIFTSLEKDVIDALIEEHKQDPG--RRILQKRLAEEVTVM  310

Query  550  VHGQEGLDEALKATEAL---RPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH QE L+ A++A+  L       +  KLD +T   +   VP   +  DQ+   ++  L+
Sbjct  311  VHSQEALNTAIEASNILFGKSTKESLEKLDEQTFLDVFDGVPQFEICKDQLGQPAIELLT  370

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
             ++ +  SK   R+M++ GG+ LN  ++  + + I  DD++DGK LL   GKKN
Sbjct  371  TAAPVFPSKGEMRKMVQGGGVSLNKEKITDQNQAITADDLIDGKYLLAQKGKKN  424



>ref|WP_004355960.1| tyrosyl-tRNA synthetase [Prevotella disiens]
 gb|EFL46699.1| tyrosine--tRNA ligase [Prevotella disiens FB035-09AN]
 gb|ERJ79539.1| tyrosine--tRNA ligase [Prevotella disiens JCM 6334 = ATCC 29426]
 gb|KGF48647.1| tyrosyl-tRNA synthetase [Prevotella disiens DNF00882]
Length=432

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 99/181 (55%), Gaps = 7/181 (4%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQM-GNPGYAPNTAQRRLAEEVTRF  551
            PY FYQ++ +V D D  +++KI T L    I+ L  +   +PG    T QRRLAEEVTR 
Sbjct  253  PYAFYQFWLNVSDNDAEKYIKIFTSLDKATIDSLIEEHRQDPG--RRTLQRRLAEEVTRM  310

Query  550  VHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH QE LD A+ A+  L   +      +LD +T   +  DVP   +  D +   +V   +
Sbjct  311  VHSQEDLDMAIAASNILFGKSTKENLLQLDEQTFNDVFKDVPHYEISKDLLGQPAVEVFN  370

Query  379  vssglle-SKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVR  203
                 +  SKS  R+++K GG+ LN  ++ +  + I  +D++DGK LL+  GKKN  +V 
Sbjct  371  QEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLLMQKGKKNYFLVI  430

Query  202  I  200
            +
Sbjct  431  V  431



>ref|WP_040919996.1| tyrosyl-tRNA synthetase [Saccharomonospora glauca]
Length=423

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 98/177 (55%), Gaps = 5/177 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVR-FlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PY +YQYF ++PDADVVR    +      E  E        P  A   AQRRLA+E+T  
Sbjct  250  PYAWYQYFLNLPDADVVRCLKLLTFLDADEIGELETATKERP--AARQAQRRLAQELTDL  307

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG E   + + A++AL       +LD  T++   ++VP+  +   +    +++DL V+ 
Sbjct  308  VHGPEQTRQVVAASQALFGRGELRELDAATLDAAMAEVPTGEVKLSE--GPTIVDLLVAG  365

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            GL++SK AARR +K+GG Y+NN ++  E    E  D + G+ L++  GKK    VR+
Sbjct  366  GLVDSKGAARRTVKEGGAYVNNTKITQEDWAPELSDALHGRWLVVRRGKKTLAGVRV  422



>ref|WP_042427072.1| tyrosyl-tRNA synthetase [Streptacidiphilus anmyonensis]
Length=420

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 105/176 (60%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  D D+ +FL+I +F + EEIEEL+ +M         AQR LAEE+T  V
Sbjct  248  PYAFYQFWLNADDRDISKFLRIFSFKSHEEIEELE-RMTEEAPFKRAAQRALAEELTVLV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HGQ+ LD A+ A++AL       +LD  T+    +++PS  +         ++DL V++G
Sbjct  307  HGQDQLDRAVAASKALFGQGDLGELDAPTLAAAVAELPSAQV----GELGELVDLFVATG  362

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            L  S+SAARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK+N   + +
Sbjct  363  LSASRSAARRTINEGGAYVNNTKVEDEAATASPADLLHGRWLVLRRGKRNLAAIEL  418



>ref|WP_031165781.1| tyrosyl-tRNA synthetase [Streptosporangium roseum]
Length=422

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 106/178 (60%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGN-PGYAPNTAQRRLAEEVTRF  551
            PY FYQY+ +  D DVVRFLK+ TF T +EI EL+  + + P  A   AQR LAE+VT  
Sbjct  249  PYAFYQYWLNADDRDVVRFLKVFTFRTQDEIAELEKAVADRP--AAREAQRTLAEDVTTL  306

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG + L   + A+ AL    +  +LD +T+    ++VP   +     L  S +DL   S
Sbjct  307  VHGADELARVVAASRALFGQGSLEELDARTLGSALAEVPRAEV---SALGASFVDLLAES  363

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL+ESKSAARR +K+GG YLNN ++  EA      D++ G+ L+L  GK++   V ++
Sbjct  364  GLVESKSAARRAVKEGGAYLNNVKITDEAYMPSAGDLLHGRFLVLRRGKRSIGGVEVT  421



>ref|WP_009199613.1| tyrosyl-tRNA synthetase [Actinomyces sp. oral taxon 848]
 gb|EEZ77493.1| tyrosine--tRNA ligase [Actinomyces sp. oral taxon 848 str. F0332]
Length=420

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 99/180 (55%), Gaps = 13/180 (7%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY+FYQ++ +  D DV+  LK+ TF T EEI EL+T +    +A   AQ+ LAE+VT +V
Sbjct  249  PYRFYQFWLNTADDDVIHMLKVFTFRTREEIAELETALAERPHA-REAQKALAEDVTTWV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVP----SCSLPFDQvlsisvldls  380
            HG +  +    A+ AL  G     LD +T+    +++P    S   P  ++   + L+  
Sbjct  308  HGADATERVKAASRALFGGGGLESLDARTLADAVAELPRAEGSVGTPLIELFVATGLEKG  367

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
            +         AARR +  GGLYLNN ++D  AK +   D++ G V+LL  GKKN  VV +
Sbjct  368  L--------GAARRTVASGGLYLNNVKIDDGAKVLGSSDLLPGGVVLLRRGKKNLAVVGV  419



>ref|WP_036847792.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH1349]
 gb|KGN68587.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH1349]
Length=431

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 100/185 (54%), Gaps = 11/185 (6%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlki-ltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  +++KI  +    E     + Q   P   P   Q+RLAEEVT  
Sbjct  250  PYKFYQFWLNVSDIDAAKYIKIFTSLTKEEIAALEEEQAAAPHLRP--LQKRLAEEVTCM  307

Query  550  VHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFDQvlsisvldl  383
            VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP D++    +  L
Sbjct  308  VHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPMDKINGEGINIL  366

Query  382  svssglle---SKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKM  212
             + +  +    S+   R++LK GG+ +N  +V+SE   +   D++ GK +L   GKKN  
Sbjct  367  DLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKYILAQKGKKNYF  426

Query  211  VVRIS  197
            ++  +
Sbjct  427  LITFA  431



>ref|WP_043780313.1| tyrosyl-tRNA synthetase [Amycolatopsis rifamycinica]
 gb|KDN21709.1| tyrosyl-tRNA synthetase [Amycolatopsis rifamycinica]
Length=424

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 102/170 (60%), Gaps = 3/170 (2%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V DADVVR+L++ TFL  EEI  L        +    AQ+RLAEE T  V
Sbjct  250  PYAWYQYFVNVGDADVVRYLRMFTFLDQEEIAALAEDTEQRPHL-RAAQKRLAEEFTTLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG+E   + + A++AL        LD +T++   ++VP+  +  D     +++DL ++ G
Sbjct  309  HGEEQTRQVINASQALFGRGELGDLDERTLDAAMAEVPNGKV--DPGAEPTIVDLLLAGG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            L++SK AARR LK+GG Y+NN ++  E  K   +D + GK L++  GK+ 
Sbjct  367  LVDSKGAARRTLKEGGAYVNNVKIADEEWKPSREDALHGKWLVVRKGKRT  416



>ref|WP_021964934.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:1185]
 emb|CCY81627.1| tyrosine--tRNA ligase [Prevotella sp. CAG:1185]
Length=432

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 101/180 (56%), Gaps = 6/180 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQM-GNPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  E I+ L  +   +PG    T QRRLAEEVT  
Sbjct  254  PYKFYQFWLNVSDEDAERYIKIFTSLDKETIDGLVEEHRQDPG--RRTLQRRLAEEVTVM  311

Query  550  VHGQEGLDEALKATEAL---RPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH +E  D A++A+  L      ++  KLD +T   I   VP   +  D++   +V   +
Sbjct  312  VHSREDYDTAVEASNILFGKSTKDSLLKLDEQTFLDIFEGVPQFEVSKDKIGLPAVELFT  371

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
              + +  SK   R++++ GG+ LN  ++ +  + I  DD++DGK LL+  GKKN  ++ +
Sbjct  372  TEAAVFASKGEMRKLVQGGGVSLNKEKLAAFDRVITSDDLIDGKYLLVQRGKKNYFLITV  431



>ref|WP_033150736.1| tyrosyl-tRNA synthetase [Prevotella sp. RM4]
Length=431

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMG-NPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  + I+ L  +   +PG      Q+RLAEEVT  
Sbjct  253  PYKFYQFWLNVSDDDAERYIKIFTSLEKDVIDALIEEHKQDPG--RRVLQKRLAEEVTVL  310

Query  550  VHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH +E LD A++A+  L   +      KLD +T+  +   VP   +  DQ+   ++  L+
Sbjct  311  VHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQLGQPAIELLT  370

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
              + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL   GKKN
Sbjct  371  TVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQKGKKN  424



>ref|WP_026407733.1| tyrosyl-tRNA synthetase [Actinomyces gerencseriae]
Length=422

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 96/178 (54%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMG-NPGYAPNTAQRRLAEEVTRF  551
            PY FYQ++  V DADV RFL++ TFL   EIE L+     NP      AQR LA EVT +
Sbjct  248  PYAFYQFWLQVDDADVARFLRVFTFLDRAEIERLEAATAENP--KAREAQRTLAREVTAW  305

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            VHG + + +A  ATEAL      + LD  T+    +D+P+  L   +   + +L  +   
Sbjct  306  VHGVDAVRDAQAATEALWGRGRLSGLDEATVTAATADLPAGELVVGESTIVDLLVSTGLE  365

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                 +SAAR+ +  GG YLNN ++  E   +  + ++ G V+L+  G++N  V R S
Sbjct  366  KG---RSAARKTVAGGGAYLNNVKIIDEDAPVTAEQLLAGGVVLVRKGRRNLAVARQS  420



>ref|WP_028266666.1| tyrosyl-tRNA synthetase [Arthrobacter sp. MA-N2]
Length=436

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 109/178 (61%), Gaps = 6/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++ +  DADVV  LK+ TFL+  EIEEL   +    +A    QRRLA EVT  V
Sbjct  263  PYAFYQFWLNTADADVVDRLKVFTFLSRAEIEELGAAVAERPFA-REGQRRLAYEVTSLV  321

Query  547  HGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvss  371
            HG +  ++ + A+ AL  GN D + LD  T+    +++PS S+  D    + ++DL V+S
Sbjct  322  HGVDATEKVIAASAALF-GNGDLSVLDEVTLASATAELPSASISAD---GLGIVDLLVAS  377

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
            GL ESKSAARR + +GG Y+NN++V      I+  +++ G+ LLL  GKKN   V ++
Sbjct  378  GLSESKSAARRTVGEGGAYVNNSKVTDPDAVIDRAELLHGRYLLLRRGKKNLATVEVT  435



>ref|WP_034501447.1| tyrosyl-tRNA synthetase [Actinomyces sp. S6-Spd3]
 gb|KGF00462.1| tyrosyl-tRNA synthetase [Actinomyces sp. S6-Spd3]
Length=419

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 97/176 (55%), Gaps = 5/176 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY FYQ++  V D DVVRFLKI TFL+ EEIE L+ ++    +    AQ+ LA  VT  V
Sbjct  248  PYAFYQFWLQVADDDVVRFLKIFTFLSREEIEALEVEVAERPH-ERAAQKALAASVTALV  306

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E L     AT+AL      + +D  T+    SD+P   L     L  ++++  +  G
Sbjct  307  HGDEELARVQAATDALWGSGDLSSIDEATLAAATSDLPRAELSLGDSLIDALVETGLEKG  366

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRI  200
                +SAARR L  GG Y+N  +V+ E   +  DD++ G ++L+  G++N  VV +
Sbjct  367  ----RSAARRTLAGGGAYVNKVKVEDEEAVLRADDLLAGGLVLIRKGRRNLAVVAV  418



>ref|WP_028906618.1| tyrosyl-tRNA synthetase [Prevotella ruminicola]
Length=431

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMG-NPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  + I+ L  +   +PG      Q+RLAEEVT  
Sbjct  253  PYKFYQFWLNVSDDDAERYIKIFTSLEKDVIDALIEEHKQDPG--RRVLQKRLAEEVTVL  310

Query  550  VHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH +E LD A++A+  L   +      KLD +T+  +   VP   +  DQ+   ++  L+
Sbjct  311  VHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQLGQPAIELLT  370

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
              + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL   GKKN
Sbjct  371  TVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDMIDGKYLLAQKGKKN  424



>ref|WP_013064850.1| tyrosyl-tRNA synthetase [Prevotella ruminicola]
 gb|ADE82864.1| tyrosine--tRNA ligase [Prevotella ruminicola 23]
Length=431

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMG-NPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  + I+ L  +   +PG      Q+RLAEEVT  
Sbjct  253  PYKFYQFWLNVSDDDAERYIKIFTSLEKDVIDALIEEHKQDPG--RRVLQKRLAEEVTVL  310

Query  550  VHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH +E LD A++A+  L   +      KLD +T+  +   VP   +  DQ+   ++  L+
Sbjct  311  VHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQLGQPAIELLT  370

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
              + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL   GKKN
Sbjct  371  TVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQKGKKN  424



>ref|WP_034999926.1| tyrosyl-tRNA synthetase [Corynebacterium sp. GD7]
Length=420

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 99/170 (58%), Gaps = 5/170 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +  DADV+R+L+  TFL  EE+  L+ ++    +    AQRRLA+E+T  V
Sbjct  249  PYTWYQYFVNTADADVIRYLRWFTFLDQEELARLEVEVAERPF-KREAQRRLAQEMTDLV  307

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssg  368
            HG E  +    A++AL      + LD  T+    S+       F+     +++DL V +G
Sbjct  308  HGVEAREAVELASQALFGRAELSDLDEATLAASVSETD----VFEFSGETTIVDLLVGAG  363

Query  367  lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
            L +SK AARR +K+GG Y+NN R++ EA    EDD + G  L+L  GKKN
Sbjct  364  LADSKGAARRSIKEGGAYVNNVRIEDEAWAPTEDDFLHGSWLVLRRGKKN  413



>ref|WP_028903046.1| MULTISPECIES: tyrosyl-tRNA synthetase [Prevotella]
Length=431

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMG-NPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++ +V D D  R++KI T L  + I+ L  +   +PG      Q+RLAEEVT  
Sbjct  253  PYKFYQFWLNVSDDDAERYIKIFTSLEKDVIDALIEEHKQDPG--RRVLQKRLAEEVTVL  310

Query  550  VHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQvlsisvldls  380
            VH QE L+ A++A+  L   +      KLD +T+  +   VP   +  DQ+   ++  L+
Sbjct  311  VHSQEALNTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQLGQPAIELLT  370

Query  379  vssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  218
              + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL   GKKN
Sbjct  371  TVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQKGKKN  424



>ref|WP_044279722.1| tyrosine--tRNA ligase [Bifidobacterium thermophilum]
 gb|KFJ07573.1| tyrosine--tRNA ligase [Bifidobacterium thermophilum]
Length=441

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 96/184 (52%), Gaps = 9/184 (5%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQM-GNPGYAPNTAQRRLAEEVTRF  551
            PYKFYQ++F+ PD  VV+ LK+ TFL   EIE L  ++  NPG     AQ+ LA EVT F
Sbjct  259  PYKFYQFWFNQPDDQVVKLLKVFTFLPKAEIERLAGEVQANPG--AREAQKTLAWEVTSF  316

Query  550  VHGQEGLDEALKATEALRPGNADTKLDWK-----TIEGIASDVPSCSLPFDQvlsisvld  386
            VHG+E   +A+ A  AL     D     K      IEG+  D       F QV     + 
Sbjct  317  VHGEEATQQAIDAAAALFGRGGDLTTIGKDTLEAAIEGLKVDDGEGGRTFAQVAPGDRIA  376

Query  385  lsvssglleSK-SAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  209
             +     L    S AR+ +K GG+Y+NN RV+ + + + EDD +DG   L+  GKK    
Sbjct  377  EAGVKAGLFKSVSEARKTIKSGGVYINNQRVEDQDQLLGEDDFLDGGYALIRRGKKALGA  436

Query  208  VRIS  197
            VR +
Sbjct  437  VRCA  440



>ref|WP_037274388.1| tyrosyl-tRNA synthetase [Rhodococcus rhodnii]
Length=424

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 104/178 (58%), Gaps = 5/178 (3%)
 Frame = -2

Query  727  PYKFYQYFFSVPDADVVRFlkiltfltieeieelkTQMGNPGYAPNTAQRRLAEEVTRFV  548
            PY +YQYF +V DA+ +++L++LTF+  EEI++LK Q          AQ+RLAEE T  V
Sbjct  250  PYAWYQYFVNVDDAEALQYLRMLTFVPREEIDDLKQQTEEKPQL-RAAQKRLAEEFTNLV  308

Query  547  HGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPF-DQvlsisvldlsvss  371
            HG++   + + A++AL  G    +LD  T++   ++VP+  +   DQ   + VL  S   
Sbjct  309  HGEKETQQVIAASQALFGGGELRELDAGTLDAAMAEVPTGDVRLADQPTIVEVLVASGLV  368

Query  370  glleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  197
                   AARR + +GG Y+NN R+ ++  +   DD++ GK L++  GK+N   VR+S
Sbjct  369  AG---NGAARRTVSEGGAYVNNTRIGADDWRPTADDLLHGKWLVVRKGKRNTAGVRVS  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1350961752362