BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5523

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_012072678.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    224   9e-65   
gb|KDP37816.1|  hypothetical protein JCGZ_06718                         224   1e-64   Jatropha curcas
gb|KDP37817.1|  hypothetical protein JCGZ_06719                         219   1e-63   Jatropha curcas
ref|XP_012072679.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    220   8e-63   Jatropha curcas
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                  217   4e-62   Citrus sinensis [apfelsine]
gb|AGK82821.1|  alcohol oxidase                                         216   2e-61   Solanum pimpinellifolium [currant tomato]
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    216   3e-61   Citrus sinensis [apfelsine]
gb|AGK82806.1|  alcohol oxidase                                         215   3e-61   Solanum lycopersicum
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    216   3e-61   
gb|AGK82832.1|  alcohol oxidase                                         215   3e-61   Solanum habrochaites
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             215   3e-61   Citrus clementina [clementine]
ref|XP_011072475.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    213   7e-61   
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                214   9e-61   Erythranthe guttata [common monkey flower]
emb|CDP07225.1|  unnamed protein product                                214   1e-60   Coffea canephora [robusta coffee]
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    213   2e-60   
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    213   2e-60   Sesamum indicum [beniseed]
gb|AGK82825.1|  alcohol oxidase                                         212   3e-60   Solanum pennellii
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...    215   4e-60   
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    212   8e-60   Eucalyptus grandis [rose gum]
ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        211   8e-60   Nicotiana tomentosiformis
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        211   1e-59   Eucalyptus grandis [rose gum]
ref|XP_006368110.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    204   1e-59   Solanum tuberosum [potatoes]
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    211   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    209   4e-59   Solanum tuberosum [potatoes]
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     209   4e-59   Eucalyptus grandis [rose gum]
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    209   4e-59   
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     209   7e-59   Eucalyptus grandis [rose gum]
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    207   3e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002519938.1|  electron carrier, putative                         206   5e-58   Ricinus communis
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    206   6e-58   Solanum lycopersicum
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    203   6e-57   Sesamum indicum [beniseed]
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        203   7e-57   Nicotiana sylvestris
gb|KHN11789.1|  Long-chain-alcohol oxidase FAO4A                        202   7e-57   Glycine soja [wild soybean]
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        203   9e-57   Populus euphratica
ref|XP_010274420.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    202   9e-57   
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    202   2e-56   
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             202   2e-56   
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    201   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    201   4e-56   Glycine max [soybeans]
emb|CBI29206.3|  unnamed protein product                                200   4e-56   Vitis vinifera
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        201   5e-56   Prunus mume [ume]
gb|KHN27504.1|  Long-chain-alcohol oxidase FAO4A                        199   7e-56   Glycine soja [wild soybean]
ref|XP_006385149.1|  alcohol oxidase-related family protein             200   9e-56   
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  200   9e-56   Medicago truncatula
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  200   1e-55   
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            200   1e-55   Medicago truncatula
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        200   1e-55   Vitis vinifera
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    200   1e-55   Cicer arietinum [garbanzo]
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    199   2e-55   Glycine max [soybeans]
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    199   3e-55   Glycine max [soybeans]
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             197   9e-55   Phaseolus vulgaris [French bean]
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    197   2e-54   Cicer arietinum [garbanzo]
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    197   2e-54   
ref|XP_004150760.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        194   4e-54   Cucumis sativus [cucumbers]
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    195   6e-54   Cucumis melo [Oriental melon]
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    195   9e-54   Cucumis melo [Oriental melon]
gb|EPS61567.1|  hypothetical protein M569_13229                         194   1e-53   Genlisea aurea
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        194   2e-53   Glycine soja [wild soybean]
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    194   2e-53   Glycine max [soybeans]
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             193   3e-53   Phaseolus vulgaris [French bean]
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   193   4e-53   
gb|KGN53996.1|  hypothetical protein Csa_4G246910                       179   4e-53   Cucumis sativus [cucumbers]
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                190   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    189   1e-51   Phoenix dactylifera
emb|CAA18625.1|  putative protein                                       187   3e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66156.1|  BnaA01g34950D                                          184   4e-51   Brassica napus [oilseed rape]
ref|XP_008382148.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    187   4e-51   
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                      186   6e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283178.1|  hypothetical protein CARUB_v10004208mg             185   6e-51   
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728             185   1e-50   
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    186   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg             185   2e-50   Capsella rubella
emb|CDX99382.1|  BnaC01g11700D                                          181   6e-50   
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    183   1e-49   Brassica rapa
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        182   1e-49   Brassica rapa
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    182   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    181   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    181   6e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        181   6e-49   Camelina sativa [gold-of-pleasure]
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    180   9e-49   Arabis alpina [alpine rockcress]
gb|EPS64229.1|  hypothetical protein M569_10552                         178   6e-48   Genlisea aurea
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg             177   9e-48   
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        177   1e-47   Elaeis guineensis
emb|CDY01593.1|  BnaC07g35830D                                          177   2e-47   
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    169   1e-44   Phoenix dactylifera
ref|XP_006878629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        166   2e-43   Amborella trichopoda
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    165   3e-43   Tarenaya hassleriana [spider flower]
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        160   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001763007.1|  predicted protein                                  149   2e-37   
gb|ABR17814.1|  unknown                                                 148   4e-37   Picea sitchensis
ref|XP_011628129.1|  PREDICTED: long-chain-alcohol oxidase FAO2         147   1e-36   Amborella trichopoda
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531              146   1e-36   
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621              146   1e-36   
gb|ERN18825.1|  hypothetical protein AMTR_s00067p00112750               147   1e-36   Amborella trichopoda
emb|CDX77516.1|  BnaA07g06540D                                          136   7e-36   
ref|XP_007132926.1|  hypothetical protein PHAVU_011G136600g             143   3e-35   Phaseolus vulgaris [French bean]
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein            142   3e-35   Glycine soja [wild soybean]
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    142   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    142   3e-35   Glycine max [soybeans]
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    142   5e-35   Glycine max [soybeans]
ref|XP_010102592.1|  Long-chain-alcohol oxidase FAO1                    142   7e-35   
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    142   8e-35   
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1         141   8e-35   Nicotiana sylvestris
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    141   9e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004493801.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    141   9e-35   Cicer arietinum [garbanzo]
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein            140   2e-34   Medicago truncatula
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1         140   3e-34   Cucumis melo [Oriental melon]
ref|XP_002528823.1|  disulfide oxidoreductase, putative                 140   3e-34   Ricinus communis
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1         140   3e-34   Populus euphratica
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                     140   4e-34   Eucalyptus grandis [rose gum]
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1         140   4e-34   Eucalyptus grandis [rose gum]
ref|XP_006354464.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    139   4e-34   Solanum tuberosum [potatoes]
ref|XP_010512451.1|  PREDICTED: long-chain-alcohol oxidase FAO3         139   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010488398.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    139   6e-34   Camelina sativa [gold-of-pleasure]
gb|KGN56837.1|  hypothetical protein Csa_3G134850                       138   7e-34   Cucumis sativus [cucumbers]
ref|XP_003607676.1|  Annotation was added to scaffolds in Novembe...    137   7e-34   
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    139   8e-34   Solanum tuberosum [potatoes]
emb|CDO99261.1|  unnamed protein product                                139   9e-34   Coffea canephora [robusta coffee]
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2         138   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001761391.1|  predicted protein                                  138   1e-33   
ref|XP_002314488.2|  alcohol oxidase-related family protein             138   1e-33   
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1         137   2e-33   Cucumis sativus [cucumbers]
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1         137   2e-33   Solanum lycopersicum
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    137   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    137   2e-33   Citrus sinensis [apfelsine]
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    137   3e-33   Lotus japonicus
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    137   3e-33   Nicotiana tomentosiformis
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg             137   3e-33   Citrus clementina [clementine]
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    137   3e-33   
gb|EYU46424.1|  hypothetical protein MIMGU_mgv1a001883mg                137   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_006489751.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    135   3e-33   
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein            137   3e-33   Medicago truncatula
ref|XP_006379996.1|  hypothetical protein POPTR_0008s18750g             133   5e-33   
emb|CAN71289.1|  hypothetical protein VITISV_019349                     136   5e-33   Vitis vinifera
ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2         136   6e-33   Nicotiana sylvestris
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1         136   6e-33   Vitis vinifera
gb|ACF22878.1|  alcohol oxidase                                         136   6e-33   Glycine max [soybeans]
ref|XP_011080082.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    136   7e-33   Sesamum indicum [beniseed]
gb|KJB10007.1|  hypothetical protein B456_001G179800                    135   7e-33   Gossypium raimondii
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    136   8e-33   Glycine max [soybeans]
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                         136   8e-33   Glycine soja [wild soybean]
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    135   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    135   9e-33   Fragaria vesca subsp. vesca
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                         135   1e-32   Gossypium arboreum [tree cotton]
gb|AES61079.2|  long-chain-alcohol oxidase FAO1-like protein            134   1e-32   Medicago truncatula
sp|B5WWZ9.1|FAO2_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    135   1e-32   Lotus japonicus
ref|XP_011080081.1|  PREDICTED: long-chain-alcohol oxidase FAO2         135   1e-32   Sesamum indicum [beniseed]
gb|KJB10008.1|  hypothetical protein B456_001G179800                    135   1e-32   Gossypium raimondii
gb|KJB10006.1|  hypothetical protein B456_001G179800                    135   2e-32   Gossypium raimondii
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1         135   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_003590828.1|  Annotation was added to scaffolds in Novembe...    133   2e-32   
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg                135   2e-32   Erythranthe guttata [common monkey flower]
emb|CDP11641.1|  unnamed protein product                                135   2e-32   Coffea canephora [robusta coffee]
emb|CDX85097.1|  BnaC07g08090D                                          134   2e-32   
ref|XP_002272123.2|  PREDICTED: long-chain-alcohol oxidase FAO2-like    134   2e-32   Vitis vinifera
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3         134   2e-32   Brassica rapa
ref|XP_006589282.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    134   3e-32   
gb|KHN30591.1|  Long-chain-alcohol oxidase FAO1                         134   3e-32   Glycine soja [wild soybean]
emb|CAC87643.1|  alcohol oxidase                                        134   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAL31021.1|AC078948_5  putative alcohol oxidase                      133   3e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AAL31049.1|AC078893_12  putative oxidase                             133   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454188.1|  hypothetical protein SORBIDRAFT_04g026370          134   3e-32   Sorghum bicolor [broomcorn]
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    134   4e-32   Populus euphratica
gb|KEH23951.1|  long-chain-alcohol oxidase FAO1                         132   4e-32   Medicago truncatula
gb|EEE51131.1|  hypothetical protein OsJ_31875                          133   4e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDX94858.1|  BnaC03g43300D                                          134   4e-32   
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg             134   4e-32   Citrus clementina [clementine]
ref|XP_006296686.1|  hypothetical protein CARUB_v10013046mg             134   4e-32   Capsella rubella
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    134   4e-32   Cicer arietinum [garbanzo]
ref|XP_006412937.1|  hypothetical protein EUTSA_v10024496mg             132   5e-32   
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1         134   5e-32   Prunus mume [ume]
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    134   5e-32   Phoenix dactylifera
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg             134   5e-32   
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                   134   5e-32   Citrus sinensis [apfelsine]
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                       134   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006589281.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    133   6e-32   Glycine max [soybeans]
gb|KJB72415.1|  hypothetical protein B456_011G177100                    132   6e-32   Gossypium raimondii
gb|KJB72416.1|  hypothetical protein B456_011G177100                    133   6e-32   Gossypium raimondii
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    133   6e-32   Elaeis guineensis
ref|XP_011459707.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    131   7e-32   Fragaria vesca subsp. vesca
ref|XP_001753124.1|  predicted protein                                  133   7e-32   
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    133   7e-32   Cucumis sativus [cucumbers]
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg                133   8e-32   Erythranthe guttata [common monkey flower]
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g             133   8e-32   Phaseolus vulgaris [French bean]
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1         133   8e-32   Sesamum indicum [beniseed]
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    133   8e-32   Eucalyptus grandis [rose gum]
ref|XP_002311685.2|  alcohol oxidase-related family protein             132   1e-31   Populus trichocarpa [western balsam poplar]
gb|KJB72414.1|  hypothetical protein B456_011G177100                    132   1e-31   Gossypium raimondii
ref|XP_002454190.1|  hypothetical protein SORBIDRAFT_04g026390          132   1e-31   Sorghum bicolor [broomcorn]
gb|EPS66779.1|  hypothetical protein M569_07992                         132   1e-31   Genlisea aurea
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2         132   2e-31   Nicotiana tomentosiformis
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    132   2e-31   
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                    132   2e-31   Morus notabilis
ref|XP_006412936.1|  hypothetical protein EUTSA_v10024496mg             132   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010532671.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    132   2e-31   Tarenaya hassleriana [spider flower]
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                         132   3e-31   Medicago truncatula
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    132   3e-31   Prunus mume [ume]
ref|XP_007035186.1|  Alcohol oxidase, putative isoform 4                131   3e-31   
gb|ACF87929.1|  unknown                                                 129   3e-31   Zea mays [maize]
ref|XP_004247518.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    131   3e-31   Solanum lycopersicum
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    131   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    131   3e-31   Eucalyptus grandis [rose gum]
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    131   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    131   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg             131   4e-31   Citrus clementina [clementine]
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855             131   4e-31   
ref|XP_012069873.1|  PREDICTED: long-chain-alcohol oxidase FAO1         131   4e-31   Jatropha curcas
gb|EPS58840.1|  hypothetical protein M569_15969                         130   5e-31   Genlisea aurea
ref|XP_007035183.1|  Fatty alcohol oxidase 3 isoform 1                  130   6e-31   
ref|XP_007144044.1|  hypothetical protein PHAVU_007G124200g             130   6e-31   Phaseolus vulgaris [French bean]
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    130   6e-31   Setaria italica
gb|KFK29401.1|  hypothetical protein AALP_AA7G128800                    130   6e-31   Arabis alpina [alpine rockcress]
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg             130   6e-31   Prunus persica
ref|XP_007035188.1|  Fatty alcohol oxidase 3 isoform 6                  130   7e-31   
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    130   8e-31   Elaeis guineensis
gb|EMS51759.1|  Long-chain-alcohol oxidase FAO2                         127   1e-30   Triticum urartu
emb|CDP03771.1|  unnamed protein product                                130   1e-30   Coffea canephora [robusta coffee]
ref|XP_010548742.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    129   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_009137800.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        129   2e-30   Brassica rapa
ref|XP_006406028.1|  hypothetical protein EUTSA_v10020141mg             129   2e-30   Eutrema salsugineum [saltwater cress]
gb|KJB38384.1|  hypothetical protein B456_006G252500                    129   2e-30   Gossypium raimondii
emb|CDX92884.1|  BnaC07g41420D                                          129   2e-30   
ref|XP_004982883.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    129   2e-30   Setaria italica
gb|KFK39637.1|  hypothetical protein AALP_AA3G269600                    129   2e-30   Arabis alpina [alpine rockcress]
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    129   3e-30   Setaria italica
emb|CDX92985.1|  BnaA03g37070D                                          128   3e-30   
gb|KDP26499.1|  hypothetical protein JCGZ_17657                         128   4e-30   Jatropha curcas
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1         128   4e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010526493.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    128   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_007050220.1|  Alcohol oxidase                                    128   4e-30   
ref|XP_010433200.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        128   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008382898.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    127   5e-30   
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    128   5e-30   
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906             128   6e-30   Arabidopsis lyrata subsp. lyrata
gb|ACN27562.1|  unknown                                                 128   6e-30   Zea mays [maize]
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    128   6e-30   Phoenix dactylifera
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                         127   6e-30   Gossypium arboreum [tree cotton]
ref|NP_001148058.1|  oxidoreductase                                     128   6e-30   
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg             127   7e-30   Capsella rubella
ref|XP_010532672.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    127   7e-30   Tarenaya hassleriana [spider flower]
ref|XP_002464496.1|  hypothetical protein SORBIDRAFT_01g019480          127   7e-30   
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    127   7e-30   Brassica rapa
ref|XP_012085273.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    127   7e-30   
emb|CDY51703.1|  BnaA03g58930D                                          127   8e-30   Brassica napus [oilseed rape]
ref|XP_011462285.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...    127   1e-29   Fragaria vesca subsp. vesca
ref|XP_004296386.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...    127   1e-29   Fragaria vesca subsp. vesca
dbj|BAK02336.1|  predicted protein                                      127   1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00483.1|  predicted protein                                      125   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY78905.1|  hypothetical protein OsI_34008                          125   2e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_002464495.1|  hypothetical protein SORBIDRAFT_01g019470          126   2e-29   Sorghum bicolor [broomcorn]
tpg|DAA49655.1|  TPA: hypothetical protein ZEAMMB73_468308              124   3e-29   
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    126   3e-29   Solanum tuberosum [potatoes]
gb|ACF88407.1|  unknown                                                 124   3e-29   Zea mays [maize]
ref|XP_003574052.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    126   3e-29   Brachypodium distachyon [annual false brome]
ref|XP_010447958.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    125   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    125   3e-29   Cicer arietinum [garbanzo]
gb|AAL31027.1|AC078948_11  putative alcohol oxidase                     125   4e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009119340.1|  PREDICTED: long-chain-alcohol oxidase FAO1         125   4e-29   Brassica rapa
ref|NP_001064839.2|  Os10g0474800                                       124   4e-29   
emb|CDX89850.1|  BnaA10g02320D                                          125   5e-29   
gb|ACR36076.1|  unknown                                                 123   5e-29   Zea mays [maize]
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    125   6e-29   Setaria italica
ref|NP_001176205.1|  Os10g0474966                                       124   8e-29   
tpg|DAA49654.1|  TPA: hypothetical protein ZEAMMB73_468308              123   8e-29   
gb|AAL31024.1|AC078948_8  putative alcohol oxidase                      124   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAP54248.2|  GMC oxidoreductase family protein, expressed            124   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1         124   1e-28   Zea mays [maize]
gb|AAK64154.1|  unknown protein                                         124   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                      124   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63097.1|  unknown                                                 124   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002464494.1|  hypothetical protein SORBIDRAFT_01g019460          122   1e-28   
ref|NP_001142399.1|  uncharacterized protein LOC100274574               123   2e-28   Zea mays [maize]
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...    123   2e-28   Zea mays [maize]
ref|XP_010438427.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    123   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010532673.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    123   3e-28   Tarenaya hassleriana [spider flower]
gb|EEC73620.1|  hypothetical protein OsI_08118                          122   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_002981110.1|  hypothetical protein SELMODRAFT_114089             122   5e-28   
dbj|BAJ86655.1|  predicted protein                                      122   5e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601              122   6e-28   
emb|CDY18199.1|  BnaC05g02220D                                          122   6e-28   
ref|NP_001047464.1|  Os02g0621800                                       122   6e-28   
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684              122   6e-28   
gb|EEE57396.1|  hypothetical protein OsJ_07570                          122   6e-28   
ref|XP_002994642.1|  hypothetical protein SELMODRAFT_138935             121   7e-28   
ref|XP_002982582.1|  hypothetical protein SELMODRAFT_116855             121   7e-28   
ref|XP_002889487.1|  hypothetical protein ARALYDRAFT_470376             121   1e-27   
ref|XP_002529832.1|  electron carrier, putative                         120   2e-27   
ref|XP_006306477.1|  hypothetical protein CARUB_v10012453mg             120   3e-27   
emb|CBI23676.3|  unnamed protein product                                119   3e-27   
ref|XP_009369441.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    119   7e-27   
ref|XP_009369442.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    119   7e-27   
ref|XP_006418179.1|  hypothetical protein EUTSA_v10006882mg             118   1e-26   
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1         118   1e-26   
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    118   2e-26   
gb|EEE51130.1|  hypothetical protein OsJ_31873                          117   2e-26   
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    117   2e-26   
gb|KFK42743.1|  hypothetical protein AALP_AA1G034000                    116   4e-26   
gb|AAD10696.1|  Unknown protein                                         117   4e-26   
ref|NP_171895.2|  long-chain-alcohol oxidase FAO1                       116   5e-26   
emb|CBI37146.3|  unnamed protein product                                115   7e-26   
ref|XP_010475034.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    115   1e-25   
emb|CEP11230.1|  hypothetical protein                                   115   3e-25   
dbj|GAN00881.1|  conserved hypothetical protein                         114   3e-25   
gb|EMT04470.1|  Putative GMC-type oxidoreductase                        114   4e-25   
gb|KHN10761.1|  Long-chain-alcohol oxidase FAO2                         112   7e-25   
gb|KFH71384.1|  hypothetical protein MVEG_01683                         113   7e-25   
gb|EPB87889.1|  hypothetical protein HMPREF1544_05296                   112   2e-24   
gb|AGC65582.1|  fatty alcohol oxidase                                   112   2e-24   
gb|EIE83566.1|  hypothetical protein RO3G_08271                         110   7e-24   
emb|CDX98614.1|  BnaA03g43990D                                          101   8e-24   
ref|XP_010523169.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    109   1e-23   
emb|CEP11610.1|  hypothetical protein                                   106   1e-22   
gb|EXX66452.1|  hypothetical protein RirG_123640                        106   2e-22   
ref|WP_029214956.1|  hypothetical protein                               105   2e-22   
ref|XP_004361070.1|  glucose-methanol-choline oxidoreductase            105   5e-22   
emb|CDS08066.1|  hypothetical protein LRAMOSA02015                      104   8e-22   
gb|EPB86823.1|  hypothetical protein HMPREF1544_06348                   103   2e-21   
ref|XP_009831227.1|  hypothetical protein, variant 5                    102   3e-21   
ref|XP_009831226.1|  hypothetical protein, variant 4                    102   3e-21   
ref|WP_040443572.1|  hypothetical protein                               102   4e-21   
ref|WP_043738716.1|  oxidoreductase                                     102   4e-21   
ref|XP_009831229.1|  hypothetical protein, variant 1                    102   4e-21   
ref|XP_009831225.1|  hypothetical protein H257_07411                    102   5e-21   
dbj|GAN06400.1|  long chain fatty acid oxidase                          102   5e-21   
gb|EFH90466.1|  glucose-methanol-choline oxidoreductase                 101   6e-21   
emb|CEJ01770.1|  hypothetical protein RMCBS344292_15791                 101   7e-21   
ref|WP_039798089.1|  oxidoreductase                                     101   8e-21   
ref|WP_025352553.1|  oxidoreductase                                     101   8e-21   
emb|CEG67601.1|  hypothetical protein RMATCC62417_04004                 101   1e-20   
emb|CEG74394.1|  hypothetical protein RMATCC62417_09621                 101   1e-20   
emb|CEI89775.1|  hypothetical protein RMCBS344292_04123                 101   1e-20   
ref|WP_036542894.1|  oxidoreductase                                     100   1e-20   
ref|XP_002543430.1|  conserved hypothetical protein                   99.8    1e-20   
gb|EFW14100.1|  long chain fatty alcohol oxidase                        100   2e-20   
ref|XP_003071927.1|  GMC oxidoreductase family protein                  100   2e-20   
ref|XP_001243546.1|  hypothetical protein CIMG_02987                    100   2e-20   
gb|ESA06032.1|  hypothetical protein GLOINDRAFT_82554                 99.8    3e-20   
ref|XP_008871235.1|  hypothetical protein H310_07607                  99.8    3e-20   
ref|WP_013474775.1|  oxidoreductase                                   99.8    3e-20   
gb|KDO33323.1|  hypothetical protein SPRG_02132                       99.8    3e-20   
ref|WP_020101185.1|  hypothetical protein                             99.4    4e-20   
gb|EEQ89581.1|  long chain fatty alcohol oxidase                      99.4    5e-20   
ref|XP_002622231.1|  long chain fatty alcohol oxidase                 99.4    5e-20   
gb|EKG12277.1|  Glucose-methanol-choline oxidoreductase               99.4    5e-20   
ref|WP_029120493.1|  GMC oxidoreductase                               98.6    7e-20   
ref|XP_629786.1|  glucose-methanol-choline oxidoreductase             98.6    9e-20   
ref|XP_003171263.1|  fatty alcohol oxidase                            98.6    9e-20   
ref|WP_021030799.1|  hypothetical protein                             98.2    9e-20   
ref|WP_007506841.1|  oxidoreductase                                   97.8    1e-19   
ref|WP_013285320.1|  oxidoreductase                                   97.8    1e-19   
ref|WP_030270415.1|  oxidoreductase                                   97.4    2e-19   
ref|XP_008615139.1|  hypothetical protein SDRG_10901                  97.8    2e-19   
emb|CCF63832.1|  putative oxidoreductase                              97.1    2e-19   
ref|WP_045276460.1|  oxidoreductase                                   97.1    2e-19   
gb|EMT02982.1|  Putative GMC-type oxidoreductase                      97.1    2e-19   
ref|XP_011124651.1|  hypothetical protein AOL_s00097g516              97.4    2e-19   
ref|XP_002841296.1|  hypothetical protein                             97.1    3e-19   
dbj|GAN00882.1|  long chain fatty acid oxidase                        96.7    3e-19   
ref|WP_027004897.1|  hypothetical protein                             96.7    4e-19   
ref|WP_024806286.1|  oxidoreductase                                   96.3    4e-19   
ref|WP_040833364.1|  oxidoreductase                                   96.3    4e-19   
ref|WP_040872144.1|  oxidoreductase                                   96.3    4e-19   
gb|EGD92018.2|  hypothetical protein TERG_08235                       92.8    5e-19   
ref|WP_043692605.1|  oxidoreductase                                   95.9    5e-19   
ref|WP_018162755.1|  hypothetical protein                             95.9    6e-19   
ref|XP_005650828.1|  FAD/NAD(P)-binding domain-containing protein     95.1    7e-19   
ref|WP_043397728.1|  hypothetical protein                             95.5    8e-19   
ref|XP_008026917.1|  hypothetical protein SETTUDRAFT_20639            95.5    8e-19   
ref|WP_039822949.1|  oxidoreductase                                   95.5    9e-19   
emb|CBJ27378.1|  oxidoreductase                                       95.9    9e-19   
ref|WP_030525445.1|  oxidoreductase                                   95.1    9e-19   
ref|XP_002479333.1|  long chain fatty alcohol oxidase, putative       95.9    1e-18   
ref|WP_026239882.1|  oxidoreductase                                   95.1    1e-18   
ref|XP_003018036.1|  hypothetical protein TRV_07960                   95.5    1e-18   
ref|WP_006541316.1|  oxidoreductase                                   94.7    1e-18   
ref|WP_040786198.1|  oxidoreductase                                   94.7    1e-18   
ref|WP_040721573.1|  oxidoreductase                                   94.7    1e-18   
ref|WP_045297845.1|  oxidoreductase                                   94.4    2e-18   
gb|KJL43589.1|  Paromamine 6'-oxidase                                 94.4    2e-18   
dbj|GAM91611.1|  hypothetical protein ANO11243_096630                 94.4    2e-18   
ref|XP_002788971.1|  long chain fatty acid oxidase                    94.4    2e-18   
gb|EEC67160.1|  hypothetical protein OsI_34014                        94.4    2e-18   
ref|XP_658227.1|  hypothetical protein AN0623.2                       94.4    2e-18   
gb|EGD99881.1|  long chain fatty alcohol oxidase                      94.0    3e-18   
gb|EZF29717.1|  hypothetical protein H101_06625                       94.0    3e-18   
dbj|GAM35263.1|  hypothetical protein TCE0_017r03459                  94.0    4e-18   
ref|WP_042261336.1|  oxidoreductase                                   93.2    5e-18   
ref|XP_005644346.1|  FAD/NAD(P)-binding domain-containing protein     92.4    5e-18   
gb|EEH19591.1|  hypothetical protein PABG_07795                       93.2    5e-18   
ref|XP_010762144.1|  hypothetical protein PADG_06552                  93.2    5e-18   
ref|XP_003011696.1|  hypothetical protein ARB_02250                   93.2    6e-18   
gb|KEY78297.1|  long chain fatty alcohol oxidase                      93.2    7e-18   
ref|XP_753079.1|  long chain fatty alcohol oxidase                    92.8    7e-18   
ref|XP_003231449.1|  long chain fatty alcohol oxidase                 92.4    7e-18   
ref|XP_006692351.1|  hypothetical protein CTHT_0018560                92.8    7e-18   
gb|EZF78359.1|  hypothetical protein H105_00612                       92.8    8e-18   
dbj|GAM23381.1|  hypothetical protein SAMD00019534_065560             92.8    9e-18   
gb|EZF27387.1|  hypothetical protein H100_00625                       92.8    9e-18   
ref|XP_001268562.1|  long chain fatty alcohol oxidase, putative       92.8    9e-18   
ref|WP_036504871.1|  oxidoreductase                                   92.4    1e-17   
ref|XP_007684042.1|  GMC oxidoreductase                               92.4    1e-17   
ref|XP_002147053.1|  long chain fatty alcohol oxidase, putative       92.0    1e-17   
ref|XP_009831231.1|  hypothetical protein H257_07412                  92.0    2e-17   
ref|WP_040863732.1|  oxidoreductase                                   91.7    2e-17   
ref|WP_039780531.1|  oxidoreductase                                   91.7    2e-17   
gb|KJJ35732.1|  GMC oxidoreductase                                    91.7    2e-17   
ref|XP_002842592.1|  long chain fatty acid oxidase                    91.7    2e-17   
ref|XP_001821106.1|  long chain fatty alcohol oxidase                 91.7    2e-17   
dbj|GAM49565.1|  oxidoreductase                                       91.7    2e-17   
ref|WP_033245952.1|  MULTISPECIES: oxidoreductase                     91.7    2e-17   
gb|EIT74840.1|  choline dehydrogenase                                 91.7    2e-17   
gb|KIX07916.1|  hypothetical protein Z518_02570                       91.7    2e-17   
gb|KFX48806.1|  Long-chain-alcohol oxidase FAO2                       91.7    2e-17   
gb|AGQ19884.1|  MedDCM-OCT-S43-C48-cds25                              90.9    2e-17   
ref|XP_001214264.1|  conserved hypothetical protein                   91.3    2e-17   
ref|XP_007697741.1|  hypothetical protein COCSADRAFT_295770           90.9    3e-17   
gb|EZG10707.1|  long chain fatty alcohol oxidase                      90.9    3e-17   
gb|KKA26714.1|  hypothetical protein TD95_005322                      90.5    3e-17   
ref|WP_040788581.1|  oxidoreductase                                   90.5    3e-17   
ref|WP_040749116.1|  oxidoreductase                                   90.5    4e-17   
ref|WP_040816569.1|  oxidoreductase                                   90.5    4e-17   
gb|EPB87888.1|  hypothetical protein HMPREF1544_05295                 90.5    4e-17   
gb|EMS48507.1|  Long-chain-alcohol oxidase FAO1                       90.1    4e-17   
ref|XP_001264046.1|  long chain fatty alcohol oxidase, putative       90.5    4e-17   
gb|AGQ19576.1|  MedDCM-OCT-S38-C2-cds46                               90.1    5e-17   
gb|EUN25552.1|  hypothetical protein COCVIDRAFT_39053                 90.5    5e-17   
ref|XP_001904377.1|  hypothetical protein                             90.5    5e-17   
ref|XP_006662436.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  89.7    5e-17   
dbj|GAA82032.1|  long chain fatty alcohol oxidase                     90.1    6e-17   
ref|WP_022566024.1|  MULTISPECIES: putative oxidoreductase            89.7    6e-17   
ref|XP_003298648.1|  hypothetical protein PTT_09421                   89.7    8e-17   
ref|WP_030514867.1|  oxidoreductase                                   89.7    8e-17   
gb|KFY48297.1|  hypothetical protein V495_01464                       89.4    9e-17   
ref|WP_028073982.1|  hypothetical protein                             89.4    1e-16   
ref|WP_033090122.1|  oxidoreductase                                   89.0    1e-16   
gb|KKA24666.1|  Uncharacterized protein T310_1298                     89.4    1e-16   
ref|XP_007706606.1|  hypothetical protein COCCADRAFT_81154            89.4    1e-16   
ref|WP_040863672.1|  oxidoreductase                                   89.0    1e-16   
ref|WP_034349962.1|  GMC oxidoreductase                               89.0    1e-16   
ref|XP_007837981.1|  hypothetical protein PFICI_11209                 89.0    1e-16   
ref|WP_043664884.1|  oxidoreductase                                   89.0    1e-16   
ref|XP_001940486.1|  long chain fatty alcohol oxidase                 89.0    1e-16   
gb|ERS99077.1|  hypothetical protein HMPREF1624_04272                 89.0    2e-16   
ref|XP_001389382.1|  long chain fatty alcohol oxidase                 89.0    2e-16   
gb|EHA26798.1|  long chain fatty alcohol oxidase                      88.6    2e-16   
ref|WP_039363498.1|  oxidoreductase                                   88.6    2e-16   
ref|WP_017869768.1|  MULTISPECIES: hypothetical protein               88.2    2e-16   
ref|XP_009038989.1|  hypothetical protein AURANDRAFT_9609             81.3    2e-16   
ref|WP_014985326.1|  oxidoreductase                                   88.2    2e-16   
ref|XP_002182547.1|  predicted protein                                88.2    3e-16   
ref|WP_029902619.1|  oxidoreductase                                   87.8    3e-16   
ref|WP_043523244.1|  hypothetical protein                             87.8    3e-16   
gb|EWC47090.1|  hypothetical protein DRE_03459                        87.8    3e-16   
gb|KFY79221.1|  hypothetical protein V499_01756                       88.2    3e-16   
ref|WP_039808649.1|  oxidoreductase                                   87.4    4e-16   
ref|XP_007804339.1|  hypothetical protein EPUS_03557                  87.8    4e-16   
gb|ELR10689.1|  hypothetical protein GMDG_04950                       87.4    4e-16   
ref|XP_003654573.1|  hypothetical protein THITE_2117674               87.4    4e-16   
gb|KFZ00641.1|  hypothetical protein V501_10589                       87.8    4e-16   
ref|WP_027460446.1|  GMC oxidoreductase                               87.0    5e-16   
gb|EMD94921.1|  hypothetical protein COCHEDRAFT_1201414               87.4    5e-16   
gb|KIH94120.1|  long-chain fatty alcohol dehydrogenase                87.0    6e-16   
ref|WP_029932851.1|  oxidoreductase                                   87.0    6e-16   
gb|KFZ24759.1|  hypothetical protein V502_00763                       86.3    6e-16   
ref|WP_040766272.1|  oxidoreductase                                   86.7    8e-16   
gb|EMS67203.1|  Long-chain-alcohol oxidase FAO2                       85.1    8e-16   
gb|EMS23820.1|  long chain fatty alcohol oxidase                      86.7    9e-16   
gb|EUA88017.1|  GMC oxidoreductase family protein                     86.3    9e-16   
emb|CDR40807.1|  RHTO0S05e07470g1_1                                   86.7    1e-15   
ref|WP_011741213.1|  oxidoreductase                                   86.3    1e-15   
ref|WP_019202088.1|  hypothetical protein                             86.3    1e-15   
dbj|BAD03162.1|  alcohol oxidase-like                                 81.6    1e-15   
dbj|GAA98883.1|  hypothetical protein E5Q_05571                       86.3    1e-15   
gb|KGO40669.1|  Alcohol dehydrogenase, long-chain fatty               86.3    1e-15   
ref|XP_003294587.1|  hypothetical protein DICPUDRAFT_159608           86.3    1e-15   
gb|EGU13115.1|  Long chain fatty alcohol oxidase                      85.9    1e-15   
ref|WP_020786429.1|  GMC oxidoreductase                               85.9    1e-15   
ref|WP_015355043.1|  oxidoreductase GMC-type                          85.9    1e-15   
ref|XP_007680563.1|  hypothetical protein BAUCODRAFT_274597           85.9    1e-15   
ref|WP_034404879.1|  GMC oxidoreductase                               85.9    1e-15   
ref|XP_003665019.1|  hypothetical protein MYCTH_103590                85.9    2e-15   
ref|XP_001227812.1|  hypothetical protein CHGG_09885                  85.9    2e-15   
gb|KFY64266.1|  hypothetical protein V496_03367                       85.9    2e-15   
ref|XP_003328562.1|  hypothetical protein PGTG_10521                  85.9    2e-15   
ref|WP_010889387.1|  GMC oxidoreductase                               85.9    2e-15   
gb|EHK24705.1|  hypothetical protein TRIVIDRAFT_54537                 85.5    2e-15   
gb|EMF15130.1|  long-chain fatty alcohol dehydrogenase                85.5    2e-15   
ref|WP_043657819.1|  oxidoreductase                                   85.1    2e-15   
ref|WP_020724566.1|  GMC oxidoreductase                               85.1    2e-15   
ref|XP_006648845.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  85.1    2e-15   
ref|WP_020728087.1|  GMC oxidoreductase                               85.1    2e-15   
gb|EYE98796.1|  putative long chain fatty alcohol oxidase             85.5    2e-15   
ref|WP_012393436.1|  oxidoreductase                                   85.1    2e-15   
gb|EWM21472.1|  glucose-methanol-choline oxidoreductase               85.5    3e-15   
gb|ACY13903.1|  glucose-methanol-choline oxidoreductase               85.1    3e-15   
gb|KFH44797.1|  Long-chain-alcohol oxidase-like protein               85.1    3e-15   
ref|WP_014994792.1|  glucose-methanol-choline oxidoreductase          84.3    3e-15   
ref|WP_045120049.1|  hypothetical protein                             84.7    3e-15   
ref|WP_025566542.1|  hypothetical protein                             84.3    3e-15   
ref|WP_040794704.1|  oxidoreductase                                   84.7    3e-15   



>ref|XP_012072678.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Jatropha curcas]
Length=725

 Score =   224 bits (572),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  SP SISY M+  D+ +L+ GLEKVLRILAAAGAEEIGT H  G+ L  K A
Sbjct  569  RDKGSGKVNSPNSISYQMEAPDEENLQKGLEKVLRILAAAGAEEIGTHHSKGRSLNVKKA  628

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E D+FV++ESSR L +LST I SAHQMGSCRMG+DPR+SVVN MGETWEVEGLF+AD
Sbjct  629  SYKEFDKFVKRESSRSLRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIAD  688

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  689  TSVFPTALGVNPMVTVQAIAYCTAQSVLQLLK  720



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  SP SISY M+  D+ +L+ GLEKVLRILAAAGAEEIGT H  G+ L  K A
Sbjct  604  RDKGSGKVNSPNSISYQMEAPDEENLQKGLEKVLRILAAAGAEEIGTHHSKGRSLNVKKA  663

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E D+FV++ESSR L +LST I SAHQMGSCRMG+DPR+SVVN MGETWEVEGLF+AD
Sbjct  664  SYKEFDKFVKRESSRSLRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIAD  723

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  724  TSVFPTALGVNPMVTVQAIAYCTAQSVLQLLK  755



>gb|KDP37817.1| hypothetical protein JCGZ_06719 [Jatropha curcas]
Length=608

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  SP SISY M+  D+ +L+ GLEK LRILAAAGAEEIGT H  G+ L  K A
Sbjct  452  RDKGSGKVNSPNSISYQMEAADEENLQKGLEKGLRILAAAGAEEIGTHHSKGRSLNVKKA  511

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E D+FV++ESSR L +LST I SAHQMGSCRMG+DPR+SVVN MGETWEVEGLF+AD
Sbjct  512  SYKEFDKFVKRESSRSLRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIAD  571

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFP ALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  572  TSVFPAALGVNPMVTVQAIAYCTAQSVLQLLK  603



>ref|XP_012072679.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Jatropha curcas]
Length=760

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  SP SISY M+  D+ +L+ GLEK LRILAAAGAEEIGT H  G+ L  K A
Sbjct  604  RDKGSGKVNSPNSISYQMEAADEENLQKGLEKGLRILAAAGAEEIGTHHSKGRSLNVKKA  663

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E D+FV++ESSR L +LST I SAHQMGSCRMG+DPR+SVVN MGETWEVEGLF+AD
Sbjct  664  SYKEFDKFVKRESSRSLRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIAD  723

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFP ALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  724  TSVFPAALGVNPMVTVQAIAYCTAQSVLQLLK  755



>gb|KDO72345.1| hypothetical protein CISIN_1g0039902mg, partial [Citrus sinensis]
Length=707

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP+SISY M+  D+ +LK G+EK+LRILAAAGAEEIGT H  GKI+  K A
Sbjct  551  RDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKA  610

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S +E + FV++ESSR L +LST + SAHQMGSCRMG+DP++SVVN MGETW VEGL+LAD
Sbjct  611  SSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLAD  670

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSVL  L+
Sbjct  671  TSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  702



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  SP+SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  G+  K K +
Sbjct  590  RDKGSGETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKES  649

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S DE + FV++ESSR L NLST I SAHQMGSCRMG+DP+ SVVNP GETWEVE LF+ D
Sbjct  650  SVDEFESFVKEESSRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGD  709

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK
Sbjct  710  TSVFPTALGVNPMLTVQAISYCTAQNVLQLLK  741



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP+SISY M+  D+ +LK G+EK+LR+LAAAGAEEIGT H  GK +  K A
Sbjct  632  RDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRMLAAAGAEEIGTHHCKGKTINVKKA  691

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S +E + FV++ESSR L +LST + SAHQMGSCRMG+DP++SVVN MGETW+VEGL+LAD
Sbjct  692  SSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWDVEGLYLAD  751

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSVL  L+
Sbjct  752  TSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  783



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  SP+SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  G+  K K +
Sbjct  590  RDKGSGETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKES  649

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S DE + FV++ESSR L NLST I SAHQMGSCRMG+DP+ SVVNP GETWEVE LF+ D
Sbjct  650  SVDEFESFVKEESSRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGD  709

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK
Sbjct  710  TSVFPTALGVNPMLTVQAISYCTAQNVLQLLK  741



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  SP+SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  G+  K K +
Sbjct  618  RDKGSGETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKES  677

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S DE + FV++ESSR L NLST I SAHQMGSCRMG+DP+ SVVNP GETWEVE LF+ D
Sbjct  678  SVDEFESFVKEESSRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGD  737

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK
Sbjct  738  TSVFPTALGVNPMLTVQAISYCTAQNVLQLLK  769



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  SP+SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  G+  K K +
Sbjct  590  RDKGSGETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKES  649

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S DE + FV++ESSR L +LST I SAHQMGSCRMG+DP+ SVVNP GETWEVE LF+ D
Sbjct  650  SVDEFESFVKEESSRGLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGD  709

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            +SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK  N
Sbjct  710  TSVFPTALGVNPMLTVQAISYCTAQNVLQLLKAKN  744



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP+SISY M+  D+ +LK G+EK+LRILAAAGAEEIGT H  GK +  K A
Sbjct  624  RDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKTINVKKA  683

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S +E + FV++ESSR L +LST + SAHQMGSCRMG+DP++SVVN MGETW VEGL+LAD
Sbjct  684  SSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLAD  743

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSVL  L+
Sbjct  744  TSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  775



>ref|XP_011072475.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Sesamum 
indicum]
Length=671

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  S  ++SY ++ +D+ +L  GLEKV+RI+AAAGAEEIGT H  G++LK K A
Sbjct  515  RDKGSGKITSETNVSYKLEYSDQENLSKGLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQA  574

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S +E + FV++ES R L  LS+ IGSAHQMGSCRMGVDP+SS VNP GETWEVEGLF+AD
Sbjct  575  SEEEFERFVKEESLRPLQKLSSPIGSAHQMGSCRMGVDPKSSAVNPKGETWEVEGLFVAD  634

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            SSVFPTALGVNPMVT+QAIAYCTAQSVL+ L
Sbjct  635  SSVFPTALGVNPMVTIQAIAYCTAQSVLEVL  665



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK  G   SP  ISY +   D+ +L+ G+E+VLRILAAAGAEEIGT HR G +LK KGA
Sbjct  607  RDKGRGTIASPSDISYKLDDLDRENLREGIERVLRILAAAGAEEIGTHHRDGGVLKVKGA  666

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            SR+E + FVE+ES R L NLST I SAHQMGSCRMGVD   S V+P GETWEVEGLF+AD
Sbjct  667  SREEFEGFVERESMRPLRNLSTPIASAHQMGSCRMGVDSGGSGVDPRGETWEVEGLFVAD  726

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            SSVFPTALGVNPMVTVQAIAYCTAQSVL+ L
Sbjct  727  SSVFPTALGVNPMVTVQAIAYCTAQSVLEIL  757



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+   P SI+YNM K D+ ++K GLEKVLRILA+AGAEEIGT H  G+ +  K  
Sbjct  640  RDKGSGKLLYPNSITYNMDKIDEENIKRGLEKVLRILASAGAEEIGTHHVKGRSINVKKV  699

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E D+FV++ESSR L +L+T I SAHQMGSCRMGVDP+ SV NP+GETWE+EGL+LAD
Sbjct  700  SYTEFDKFVKEESSRSLKDLATPICSAHQMGSCRMGVDPKISVANPIGETWEIEGLYLAD  759

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  760  SSVFPTALGVNPMVTVQAIAYCTAQSVLESLR  791



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGEA S  SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  GK LK K +
Sbjct  589  RDKGSGEAISSNSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGKTLKVKES  648

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S DE + FV++ESSR   NLST I SAHQMGSCRMG+DP+ SVVNP GETWEVE LF+ D
Sbjct  649  SVDEFESFVKEESSRGFKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGD  708

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAI+YCTAQ+VL+ LK
Sbjct  709  TSVFPTALGVNPMVTVQAISYCTAQNVLQVLK  740



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  S  ++SY ++ +D+ +L  GLEKV+RI+AAAGAEEIGT H  G++LK K A
Sbjct  605  RDKGSGKITSETNVSYKLEYSDQENLSKGLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQA  664

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S +E + FV++ES R L  LS+ IGSAHQMGSCRMGVDP+SS VNP GETWEVEGLF+AD
Sbjct  665  SEEEFERFVKEESLRPLQKLSSPIGSAHQMGSCRMGVDPKSSAVNPKGETWEVEGLFVAD  724

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            SSVFPTALGVNPMVT+QAIAYCTAQSVL+ L
Sbjct  725  SSVFPTALGVNPMVTIQAIAYCTAQSVLEVL  755



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  SP+SISY + + D+ ++K G+EK+LRILAAAGAEEIGT H  G+  K K +
Sbjct  590  RDKGSGETVSPYSISYKLDQIDEQNIKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKES  649

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S DE + FV++ESSR L +LST I SAHQMGSCRMG+DP+ SVVNP GETWEVE LF+ D
Sbjct  650  SVDEFESFVKEESSRGLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGD  709

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK
Sbjct  710  TSVFPTALGVNPMLTVQAISYCTAQNVLQLLK  741



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score =   215 bits (547),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  691   RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
             RDK SG+  SP SI Y M+ TD+ +LK GL+K+LRILAAAGAEEIGT H  GK +  K A
Sbjct  983   RDKGSGDVYSPDSIGYKMEATDEENLKKGLDKILRILAAAGAEEIGTHHCKGKSINVKQA  1042

Query  511   SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
             S  E + FV++ESSR L +L+T I SAHQMGSCRMG+DP+ SVVN MGETWEVEGLF+AD
Sbjct  1043  SSHEFERFVKEESSRPLRDLNTQICSAHQMGSCRMGIDPKQSVVNQMGETWEVEGLFVAD  1102

Query  331   SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
             SSVFPTALGVNPMVT+QAIAYCTAQSVL  LK
Sbjct  1103  SSVFPTALGVNPMVTIQAIAYCTAQSVLDVLK  1134



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   212 bits (539),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   S  SISY M  TD+ +L+ GLEKVLRILAAAGAEEIGT H  GK LK K  
Sbjct  647  RDKGSGTIASSTSISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIGTHHNEGKTLKVKQV  706

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ES+R +   ST I SAHQMGSCRMG +PRSSVVNPMGETWEVEGL++AD
Sbjct  707  SYHEFERFVKEESARPIKGQSTPICSAHQMGSCRMGPNPRSSVVNPMGETWEVEGLYVAD  766

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  767  TSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  798



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGEA SP+S++Y M + D+ +LK GLEK+LRILAAAGAEEIGT H  G+ LK K A
Sbjct  617  RDKGSGEAFSPYSVTYKMDQIDEENLKLGLEKMLRILAAAGAEEIGTQHGKGRSLKVKDA  676

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ESS ++GN S  I SAHQMGSCRMGVDP +SVVN  GE WEVEGLFL D
Sbjct  677  SLKEFERFVKEESSIEIGNHSVPICSAHQMGSCRMGVDPTTSVVNSKGELWEVEGLFLGD  736

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            SSVFPTA+GVNPMVT+QAI+YCTAQSV++ LK  
Sbjct  737  SSVFPTAIGVNPMVTIQAISYCTAQSVVQLLKNQ  770



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   S  SISY M   D+ +L+ GLEKVLRILAAAGAEEIG+ H  GK LK K  
Sbjct  657  RDKGSGTITSSTSISYKMDDADEQNLQKGLEKVLRILAAAGAEEIGSHHGEGKTLKVKQV  716

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ES+R +  LST I SAHQMGSCRMG DPRSS VNPMGETWEVEGL++AD
Sbjct  717  SYHEFEQFVKEESARSIKGLSTPICSAHQMGSCRMGPDPRSSAVNPMGETWEVEGLYVAD  776

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  777  TSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  808



>ref|XP_006368110.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like, partial [Solanum 
tuberosum]
Length=389

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGEA SP+SISY + +TD+ +LK GLEK LRILAAAGAEEIGT    G+ LK   A
Sbjct  242  RDKGSGEALSPYSISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEA  301

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ESS ++G  S  I SAHQMGSCRMGVDP++SVVN  GETWEVEGLFL D
Sbjct  302  SLKEFERFVKEESSIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFLGD  361

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVL  248
            SSV PTA+GVNPMVT+QAI+YCTAQSVL
Sbjct  362  SSVCPTAIGVNPMVTIQAISYCTAQSVL  389



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  SP SISY M   D+  LK GLEK+LRILAAAGAEEIGT H  G+ +  K  
Sbjct  645  RDKGSGQVNSPSSISYRMDAMDEEHLKQGLEKILRILAAAGAEEIGTSHCLGRKVNVKKV  704

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S +E + FV+KES R L +L T I SAHQMGSCRMGVDP+SSVVN  GETWEVEGLFLAD
Sbjct  705  SSNEFERFVKKESRRALRDLRTPIPSAHQMGSCRMGVDPKSSVVNHRGETWEVEGLFLAD  764

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVT+Q+IAYCTAQSVL+ L+
Sbjct  765  SSVFPTALGVNPMVTIQSIAYCTAQSVLEVLR  796



>ref|XP_006359948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=707

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGEA SP+SISY + +TD+ +LK GLEK LRILAAAGAEEIGT    G+ LK   A
Sbjct  551  RDKGSGEALSPYSISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEA  610

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ESS ++G  S  I SAHQMGSCRMGVDP++SVVN  GETWEVEGLFL D
Sbjct  611  SLKEFERFVKEESSIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFLGD  670

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            SSV PTA+GVNPMVT+QAI+YCTAQSVL+ LK  
Sbjct  671  SSVCPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  704



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  688  DKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGAS  509
            DK SG   S  SISY M  TD+ +L+ GLEKVLRILAAAGAEEIGT H  GK LK K  S
Sbjct  592  DKGSGTIASSTSISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIGTHHNEGKTLKVKQVS  651

Query  508  RDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADS  329
              E + FV++ES+R +   ST I SAHQMGSCRMG +PRSSVVNPMGETWEVEGL++AD+
Sbjct  652  YHEFERFVKEESARPIKGQSTPICSAHQMGSCRMGPNPRSSVVNPMGETWEVEGLYVADT  711

Query  328  SVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  712  SVFPTALGVNPMVTVQAIAYCTAQSVLEALR  742



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGEA SP+SISY + +TD+ +LK GLEK LRILAAAGAEEIGT    G+ LK   A
Sbjct  546  RDKGSGEALSPYSISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEA  605

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ESS ++G  S  I SAHQMGSCRMGVDP++SVVN  GETWEVEGLFL D
Sbjct  606  SLKEFERFVKEESSIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFLGD  665

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            SSV PTA+GVNPMVT+QAI+YCTAQSVL+ LK  
Sbjct  666  SSVCPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  699



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  688  DKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGAS  509
            DK SG   S  SISY M   D+ +L+ GLEKVLRILAAAGAEEIG+ H  GK LK K  S
Sbjct  602  DKGSGTITSSTSISYKMDDADEQNLQKGLEKVLRILAAAGAEEIGSHHGEGKTLKVKQVS  661

Query  508  RDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADS  329
              E ++FV++ES+R +  LST I SAHQMGSCRMG DPRSS VNPMGETWEVEGL++AD+
Sbjct  662  YHEFEQFVKEESARSIKGLSTPICSAHQMGSCRMGPDPRSSAVNPMGETWEVEGLYVADT  721

Query  328  SVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  722  SVFPTALGVNPMVTVQAIAYCTAQSVLEALR  752



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = -2

Query  691  RDKTSGE-APSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  515
            RD  SG  + SPF ISY M   D+ +LK G+EK+LRILAAAGAEEIGT H +G+ +  K 
Sbjct  660  RDVGSGIISTSPFDISYMMDPIDEANLKKGVEKMLRILAAAGAEEIGTHHNSGESINVKK  719

Query  514  ASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLA  335
            A+  E ++FV++ESS+++  LST + SAHQMGSC+MGVDPR+SVVN MGE+W+VEGL++A
Sbjct  720  ATYHEFEKFVKRESSKEIQGLSTPVASAHQMGSCKMGVDPRTSVVNQMGESWDVEGLYIA  779

Query  334  DSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            DSSVFPTALGVNPMVTVQAI+YCTAQSVL++LK
Sbjct  780  DSSVFPTALGVNPMVTVQAISYCTAQSVLEYLK  812



>ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gb|EEF42542.1| electron carrier, putative [Ricinus communis]
Length=710

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   SP SI+Y M+  D+ +L+NG+EK+LRILAAAGAEEIGT H  G+ L  K A
Sbjct  555  RDKGSGTVNSPSSITYQMKAADEKNLQNGIEKILRILAAAGAEEIGTHHCIGRRLNVKTA  614

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++E +R + +LS  I SAHQMGSCRMGV+P+ SVVN  GETWE+EGL+LAD
Sbjct  615  SYHEFEKFVKEERARPMRDLSNQICSAHQMGSCRMGVNPKHSVVNQTGETWEIEGLYLAD  674

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  675  ASVFPTALGVNPMVTVQAIAYCTAQSVLEVLR  706



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGEA SP+S+SY + +TD+ +LK GLEK LRILAAAGAEEIGT    G+ LK   A
Sbjct  620  RDKGSGEAFSPYSVSYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEA  679

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV +ESS ++G  S  I SAHQMGSCRMG DP++SVVN  GETWEVEGLFL D
Sbjct  680  STKEFERFVREESSIEIGKHSVPICSAHQMGSCRMGTDPKTSVVNSKGETWEVEGLFLGD  739

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            SSV PTA+GVNPMVT+QAI+YCTAQSVL+ LK  
Sbjct  740  SSVCPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  773



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   S   ISY ++  D+ +L  GLEK +RILAAAGAEEIGT H  G++LK K A
Sbjct  599  RDKGSGVITSETDISYKLEDFDQENLSKGLEKCMRILAAAGAEEIGTHHSTGRVLKVKQA  658

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ES R L  LS  I SAHQMGSCRMGVDP+ SVVNP GETWEVEGLF+AD
Sbjct  659  SEKEFERFVKEESLRPLQKLSAPIASAHQMGSCRMGVDPKGSVVNPKGETWEVEGLFVAD  718

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVTVQA AYC AQSVL+ L+
Sbjct  719  SSVFPTALGVNPMVTVQATAYCIAQSVLQILE  750



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGEA SP+S++Y M + D+ +LK GLEK+LRILAAAGAE IGT H  G+ L  K  
Sbjct  616  RDMGSGEAFSPYSVTYKMDRIDEENLKLGLEKMLRILAAAGAEAIGTQHGKGRSLNVKDE  675

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ESS  +GN S  I SAHQMGSCRMG DP +SVVN  GETWEVEGLFL D
Sbjct  676  SLKEFERFVKEESSIKIGNHSVPICSAHQMGSCRMGEDPTTSVVNSKGETWEVEGLFLGD  735

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            SSVFPTA+GVNPMVT+QAI+YCTAQSVL+ LK  
Sbjct  736  SSVFPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  769



>gb|KHN11789.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=622

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   +P  ISY     D+ +LK G+EKVLRILAAAGAEEIGT H  G+ L  K  
Sbjct  466  RDQGSGTVKAPDRISYKPADVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQV  525

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESSR L +L+T + SAHQMGSCRMG +P+ SVVNP GETWEVEGL++AD
Sbjct  526  SYHEFEKFVKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSVVNPTGETWEVEGLYVAD  585

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSV++ LK
Sbjct  586  ASVFPTALGVNPMVTVQAIAYCTAQSVVEVLK  617



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP SI+Y M   D+ +L+ GLEK LRILAAAGAEEIGT H  GKIL  K  
Sbjct  649  RDRGSGTVNSPSSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEIGTHHSTGKILNVKKV  708

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ES+R L +L+  I SAHQMGSCRMGV+P+ S VN MGE WEVEGLF+AD
Sbjct  709  SYREFERFVKEESARPLRDLTGQICSAHQMGSCRMGVNPKESAVNQMGEAWEVEGLFVAD  768

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFL---KTH  230
            +SVFPTALGVNPMVTVQAIAYCTAQSV++ L   +TH
Sbjct  769  TSVFPTALGVNPMVTVQAIAYCTAQSVVQLLSRKRTH  805



>ref|XP_010274420.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Nelumbo 
nucifera]
Length=728

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  S  S+SY +   D+ +L  G+EK+LRILAAAGAEEIGT H  G+ L  K A
Sbjct  566  RDKGSGQVNSESSLSYRLDAIDEENLSKGVEKMLRILAAAGAEEIGTHHCEGRKLNVKRA  625

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S+DE ++FV++ES R LG LST + SAHQMGSCRMGVD   SVV P GETWEVEGLF+AD
Sbjct  626  SKDEFEKFVKEESGRKLGGLSTPVASAHQMGSCRMGVDRDKSVVCPRGETWEVEGLFVAD  685

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            +SVFPTALGVNPMVTVQAI+YCTA SV++FL+ ++
Sbjct  686  TSVFPTALGVNPMVTVQAISYCTAHSVIEFLERND  720



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  S  S+SY +   D+ +L  G+EK+LRILAAAGAEEIGT H  G+ L  K A
Sbjct  613  RDKGSGQVNSESSLSYRLDAIDEENLSKGVEKMLRILAAAGAEEIGTHHCEGRKLNVKRA  672

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S+DE ++FV++ES R LG LST + SAHQMGSCRMGVD   SVV P GETWEVEGLF+AD
Sbjct  673  SKDEFEKFVKEESGRKLGGLSTPVASAHQMGSCRMGVDRDKSVVCPRGETWEVEGLFVAD  732

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            +SVFPTALGVNPMVTVQAI+YCTA SV++FL+ ++
Sbjct  733  TSVFPTALGVNPMVTVQAISYCTAHSVIEFLERND  767



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 124/154 (81%), Gaps = 3/154 (2%)
 Frame = -2

Query  691  RDKTSG--EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPK  518
            RDK SG   AP P+SISY M+  D+ +LK GLEK LRILAAAGAE+IGT H  GK L  K
Sbjct  648  RDKGSGTVNAP-PYSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKGKGLHVK  706

Query  517  GASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFL  338
             ++ DE + FV++ESSR L  LS+ I SAHQMGSCRMGVD + SV+N MGETWEVEGLF+
Sbjct  707  KSNLDEFERFVKEESSRPLRELSSAICSAHQMGSCRMGVDSKQSVLNQMGETWEVEGLFV  766

Query  337  ADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            AD+SVFPTALGVNPMVTVQAIAYCT+QS+L+ L+
Sbjct  767  ADTSVFPTALGVNPMVTVQAIAYCTSQSILQVLR  800



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = -2

Query  691  RDKTSGE-APSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  515
            RD  SG  + SPF I Y M   D+ +L+ G+EK+LRILAAAGAEEIGT H +G  +  K 
Sbjct  651  RDMGSGVISTSPFDIKYKMHPIDEANLQKGIEKMLRILAAAGAEEIGTHHYSGSSINVKK  710

Query  514  ASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLA  335
            AS  E ++FV+KESS+ +  LS  I SAHQMGSCRMG++PR+SVVN  GE+WEVEGL+LA
Sbjct  711  ASFHEFEKFVKKESSKAIQGLSMPIASAHQMGSCRMGINPRTSVVNQRGESWEVEGLYLA  770

Query  334  DSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            DSSVFPTALGVNPMVTVQAI+YCT QSVL+FL+
Sbjct  771  DSSVFPTALGVNPMVTVQAISYCTTQSVLEFLR  803



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   +P  ISY     D+ +LK G+EKVLRILAAAGAEEIGT H  G+ L  K  
Sbjct  651  RDQGSGTVKAPDRISYKPADVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQV  710

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESSR L +L+T + SAHQMGSCRMG +P+ SVVNP GETWEVEGL++AD
Sbjct  711  SYHEFEKFVKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSVVNPTGETWEVEGLYVAD  770

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSV++ LK
Sbjct  771  ASVFPTALGVNPMVTVQAIAYCTAQSVVEVLK  802



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   SP +ISY M +TD+ +LK G+EK+LRILAAAGAEEIGT +  G+ +  K  
Sbjct  494  RDKGSGTISSPSTISYQMDETDEENLKRGMEKLLRILAAAGAEEIGTHNCNGRSINVKKV  553

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S    ++FV++ESSR L +LST + SAHQMGSCRMGVDPRSS VN MGETWEVEGL++AD
Sbjct  554  SSHAFEKFVKEESSRALRDLSTPVCSAHQMGSCRMGVDPRSSAVNQMGETWEVEGLYVAD  613

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            +SVFPTALGVNPMVTVQAIAY TA+SV++ L
Sbjct  614  TSVFPTALGVNPMVTVQAIAYSTAKSVVEML  644



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 123/154 (80%), Gaps = 3/154 (2%)
 Frame = -2

Query  691  RDKTSG--EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPK  518
            RDK SG   AP P SISY M+  D+ +LK GLEK LRILAAAGAE+IGT H  GK L  K
Sbjct  592  RDKGSGTVNAP-PDSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKGKGLHVK  650

Query  517  GASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFL  338
             A+ DE + FV++ESSR L  +S+ I SAHQMGSCRMGVD + SVVN MGETWEVEGLF+
Sbjct  651  KANLDEFERFVKEESSRPLREISSAICSAHQMGSCRMGVDSKQSVVNQMGETWEVEGLFV  710

Query  337  ADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            AD+SVFPTALGVNPMVTVQAIAYCT+QS+L+ L+
Sbjct  711  ADTSVFPTALGVNPMVTVQAIAYCTSQSILQVLR  744



>gb|KHN27504.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=638

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  ISY ++  DK +LK GLEKVLRILAAAGAEEIGT +  G+ +  K  
Sbjct  483  RDQGSGTVNSPSCISYQLKDIDKENLKVGLEKVLRILAAAGAEEIGTHNNKGRRINVKQV  542

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESS  L ++ST + SAHQMGSC+MG +PR SVVN MGETWEVEGL+LAD
Sbjct  543  SYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYLAD  602

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVTVQAI+YCTAQ VL+ L+
Sbjct  603  SSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  634



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP SI+Y M   D+ +L+ GLEK LRILAAAGAEEIGT H  GK L  K  
Sbjct  591  RDRGSGTVNSPSSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEIGTHHSTGKSLNVKKV  650

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV++ES+R L +L+  I SAHQMGSCRMGV+P+ S VN MGE WEVEGLF+AD
Sbjct  651  SYREFERFVKEESARPLRDLTGQICSAHQMGSCRMGVNPKESAVNQMGEAWEVEGLFVAD  710

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFL---KTH  230
            +SVFPTALGVNPMVTVQAIAYCTAQSV++ L   +TH
Sbjct  711  TSVFPTALGVNPMVTVQAIAYCTAQSVVQLLSRKRTH  747



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  ISY M+  DK +L  G+EKVLRILAAAGAEEIGT +  G+ L  K  
Sbjct  656  RDQGSGTVDSPTRISYQMKNVDKENLHKGIEKVLRILAAAGAEEIGTHNNKGRSLNVKEV  715

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESS  L +LST + SAHQMGSCRMG +P+ SVVN  GETWEVEGL+LAD
Sbjct  716  SYHEFEKFVKEESSMPLTDLSTPVCSAHQMGSCRMGTNPKESVVNQTGETWEVEGLYLAD  775

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQ VL+ LK
Sbjct  776  TSVFPTALGVNPMVTVQAIAYCTAQHVLEVLK  807



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  ISY M+  D+ +L+ G++KVLRILAAAGAEEIGT H  G  L  K A
Sbjct  697  RDQGSGNVHSPSRISYEMEDVDEENLQKGIDKVLRILAAAGAEEIGTHHNKGNTLNVKNA  756

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV+KESSR L +LST + SAHQMGSCRMG +P+ SVV   GETWEVE LF+AD
Sbjct  757  SYHEFEQFVKKESSRSLTDLSTPLCSAHQMGSCRMGSNPKESVVKETGETWEVEDLFVAD  816

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALG+NPM+TVQ+IAYCTAQSVL+ LK
Sbjct  817  ASVFPTALGMNPMITVQSIAYCTAQSVLQVLK  848



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  ISY M+  D+ +L+ G++KVLRILAAAGAEEIGT H  G  L  K A
Sbjct  675  RDQGSGNVHSPSRISYEMEDVDEENLQKGIDKVLRILAAAGAEEIGTHHNKGNTLNVKNA  734

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV+KESSR L +LST + SAHQMGSCRMG +P+ SVV   GETWEVE LF+AD
Sbjct  735  SYHEFEQFVKKESSRSLTDLSTPLCSAHQMGSCRMGSNPKESVVKETGETWEVEDLFVAD  794

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALG+NPM+TVQ+IAYCTAQSVL+ LK
Sbjct  795  ASVFPTALGMNPMITVQSIAYCTAQSVLQVLK  826



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   SP +ISY M +TD+ +LK G+EK+LRILAAAGAEEIGT +  G+ +  K  
Sbjct  633  RDKGSGTISSPSTISYQMDETDEENLKRGMEKLLRILAAAGAEEIGTHNCNGRSINVKKV  692

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S    ++FV++ESSR L +LST + SAHQMGSCRMGVDPRSS VN MGETWEVEGL++AD
Sbjct  693  SSHAFEKFVKEESSRALRDLSTPVCSAHQMGSCRMGVDPRSSAVNQMGETWEVEGLYVAD  752

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAY TA+SV++ L+
Sbjct  753  TSVFPTALGVNPMVTVQAIAYSTAKSVVEVLR  784



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  ISY+M+  DK +LK G+EKVLRILAAAGAEEIGT +  G  L  K  
Sbjct  670  RDQGSGTVDSPSCISYHMKDADKENLKKGIEKVLRILAAAGAEEIGTHNNKGNRLNVKKV  729

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESS +L +LST I SAHQMGSCRMG +P+ SVVN MGETWEVE L++AD
Sbjct  730  SYHEFEKFVKEESSMELTDLSTPICSAHQMGSCRMGNNPKDSVVNQMGETWEVEDLYIAD  789

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVT+QAIAYCTAQ VL+ L+
Sbjct  790  ASVFPTALGVNPMVTIQAIAYCTAQHVLEVLR  821



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  ISY ++  DK +LK GLEKVLRILAAAGAEEIGT +  G+ +  K  
Sbjct  670  RDQGSGTVNSPSCISYQLKDIDKENLKVGLEKVLRILAAAGAEEIGTHNNKGRRINVKQV  729

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESS  L ++ST + SAHQMGSC+MG +PR SVVN MGETWEVEGL+LAD
Sbjct  730  SYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYLAD  789

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVTVQAI+YCTAQ VL+ L+
Sbjct  790  SSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  821



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  ISY ++  DK +LK GLEKVLRILAAAGAEEIGT +  G+ +  K  
Sbjct  673  RDQGSGTVNSPSHISYQLKDVDKENLKIGLEKVLRILAAAGAEEIGTHNNKGRSINVKQV  732

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESS  L ++ST + SAHQMGSC+MG +PR SVVN MGETWEVEGL+LAD
Sbjct  733  SYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYLAD  792

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAI+YCTAQ VL+ L+
Sbjct  793  TSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  824



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   197 bits (502),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   SP  ISY +   D+ +L+ G+EKVLRILAAAGAEEIGT H  G+ L  K  
Sbjct  652  RDKGSGTVESPKHISYRLAGVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQV  711

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESSR L +LST + SAHQMGSCRMG +P+ SVVN  GETWE+EGL+LAD
Sbjct  712  SYHEFEKFVKEESSRPLADLSTPLCSAHQMGSCRMGSNPKQSVVNQTGETWEMEGLYLAD  771

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQA AYC AQSV++ L+
Sbjct  772  TSVFPTALGVNPMVTVQATAYCIAQSVVEVLR  803



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  SP  I+Y M+  D+ +L+ G+EKVLRILAAAGAEEIGT H  G+ L  K A
Sbjct  660  RDKGSGKVDSPNRINYQMEDVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQA  719

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S+ E+++FV++ESSR L  LST + SAHQMGSCRMG +P+ S V   GETWEVE L++AD
Sbjct  720  SKLELEKFVKEESSRPLTKLSTPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDLYVAD  779

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALG+NPM+T+Q+IAYCTAQSVL  LK
Sbjct  780  SSVFPTALGLNPMITIQSIAYCTAQSVLHALK  811



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG+  SP  I+Y M+  D+ +L+ G+EKVLRILAAAGAEEIGT H  G+ L  K A
Sbjct  678  RDKGSGKVDSPNRINYQMEDVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQA  737

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S+ E+++FV++ESSR L  LST + SAHQMGSCRMG +P+ S V   GETWEVE L++AD
Sbjct  738  SKLELEKFVKEESSRPLTKLSTPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDLYVAD  797

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALG+NPM+T+Q+IAYCTAQSVL  LK
Sbjct  798  SSVFPTALGLNPMITIQSIAYCTAQSVLHALK  829



>ref|XP_004150760.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Cucumis sativus]
Length=617

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   SP S+SY M   D+ +L+ GLEK L+ILAAAGA EIGT H  G+ +  K  
Sbjct  462  RDKGSGIVKSPSSLSYKMDDVDEHNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKV  521

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESSR L +L T I SAHQMGSCRMG+  + SVVN  GETWEVEGLF+AD
Sbjct  522  SFREYEKFVKEESSRPLKDLLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIAD  581

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  582  SSVFPTALGVNPMVTVQAIAYCTAQSVLETLK  613



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   SP S+SY M   D+ +L+ GLEK L+ILAAAGA EIGT H  G+ +  K  
Sbjct  576  RDKGSGTVKSPSSLSYKMDNVDEQNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKV  635

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESSR L +L T I SAHQMGSCRMG   + SVVN  GETWEVEGLF+AD
Sbjct  636  SYREYEKFVKEESSRPLKDLLTPICSAHQMGSCRMGSGAKDSVVNQRGETWEVEGLFIAD  695

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  696  SSVFPTALGVNPMVTVQAIAYCTAQSVLETLK  727



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   SP S+SY M   D+ +L+ GLEK L+ILAAAGA EIGT H  G+ +  K  
Sbjct  666  RDKGSGTVKSPSSLSYKMDNVDEQNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKV  725

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESSR L +L T I SAHQMGSCRMG   + SVVN  GETWEVEGLF+AD
Sbjct  726  SYREYEKFVKEESSRPLKDLLTPICSAHQMGSCRMGSGAKDSVVNQRGETWEVEGLFIAD  785

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  786  SSVFPTALGVNPMVTVQAIAYCTAQSVLETLK  817



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  +GE  SP  ISY +   D+ +L+ G+E VLRILAAAGAEEIGT H+ G++L  K A
Sbjct  583  RDLGTGEVNSPTDISYRVDDRDEENLRRGMEMVLRILAAAGAEEIGTQHKQGRVLNVKRA  642

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            + +E+++FV++ES R   NLS+ + SAHQMGSCRMG  P  S V P GE+WEVEGL++AD
Sbjct  643  TEEELEKFVKEESERGFRNLSSPMCSAHQMGSCRMGASPAESAVAPDGESWEVEGLYVAD  702

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            SSVFPTALGVNPMVT+QAIAYCTAQS+L  L+
Sbjct  703  SSVFPTALGVNPMVTIQAIAYCTAQSILTRLR  734



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   +P  ISY     D+ +LK G+EKVLRILAAAGAEEIGT H  G+ L  K  
Sbjct  653  RDQGSGTVKAPDRISYKPAGVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQV  712

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
               E ++FV++ESSR L +L+T + SAHQMGSCRMG +P+ S VN  GETWEVEGL++AD
Sbjct  713  RYHEFEKFVKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSAVNQTGETWEVEGLYVAD  772

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSV++ L+
Sbjct  773  TSVFPTALGVNPMVTVQAIAYCTAQSVVEVLR  804



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   +P  ISY     D+ +LK G+EKVLRILAAAGAEEIGT H  G+ L  K  
Sbjct  653  RDQGSGTVKAPDRISYKPAGVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQV  712

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
               E ++FV++ESSR L +L+T + SAHQMGSCRMG +P+ S VN  GETWEVEGL++AD
Sbjct  713  RYHEFEKFVKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSAVNQTGETWEVEGLYVAD  772

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQSV++ L+
Sbjct  773  TSVFPTALGVNPMVTVQAIAYCTAQSVVEVLR  804



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  ISY ++  DK +L+ G+EKVLRILAAAGAEEIGT +  G+ +  K  
Sbjct  659  RDQGSGTVNSPSLISYELKDVDKENLETGIEKVLRILAAAGAEEIGTHNNKGRSINVKQV  718

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E ++FV++ESS  L +L+T + SAHQMGSC+MG +P  SVVN MGETWEVEGL+LAD
Sbjct  719  SYHEFEKFVKEESSMSLTDLTTPLCSAHQMGSCKMGTNPSDSVVNQMGETWEVEGLYLAD  778

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTAQ V + L+
Sbjct  779  TSVFPTALGVNPMVTVQAIAYCTAQYVAEVLR  810



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 118/161 (73%), Gaps = 0/161 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   S   I Y+++  D+  L+ G+EKVLRILAAAGAEEIGT H  GK +  K A
Sbjct  678  RDQGSGTVNSDSEIRYSVEARDEEKLRAGVEKVLRILAAAGAEEIGTHHGKGKSINVKSA  737

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E++ FV++ES R++  L   I SAHQMGSCRMGV   +S VNPMGETWEVEGLF+AD
Sbjct  738  SYHELERFVKEESGREMRGLRWPICSAHQMGSCRMGVAAATSAVNPMGETWEVEGLFVAD  797

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQGYI  209
            +SVFPTALGVNPMVTVQAIAYCTA SVL+ LK       YI
Sbjct  798  TSVFPTALGVNPMVTVQAIAYCTALSVLQLLKRKKIKTTYI  838



>gb|KGN53996.1| hypothetical protein Csa_4G246910 [Cucumis sativus]
Length=139

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -2

Query  640  MQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDL  461
            M   D+ +L+ GLEK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++ESSR L
Sbjct  1    MDDVDEHNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESSRPL  60

Query  460  GNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQ  281
             +L T I SAHQMGSCRMG+  + SVVN  GETWEVEGLF+ADSSVFPTALGVNPMVTVQ
Sbjct  61   KDLLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQ  120

Query  280  AIAYCTAQSVLKFLK  236
            AIAYCTAQSVL+ LK
Sbjct  121  AIAYCTAQSVLETLK  135



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   SP  + Y M   D+ +L+ G+E+VLR+LAAAGAEEIGT HR G++LK K A
Sbjct  583  RDRGSGFVASPDHVGYKMDGADRENLRKGIERVLRVLAAAGAEEIGTHHRNGRVLKVKEA  642

Query  511  SRDEIDEFVEKESSRDLG-NLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLA  335
              +E++ FV +ESSR L  NLS  I SAHQMGSCRMGV PR S V P GE+WEV  LF+A
Sbjct  643  GEEELERFVVEESSRVLEENLSWPISSAHQMGSCRMGVGPRGSAVGPTGESWEVGALFVA  702

Query  334  DSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            D+SVFPTALGVNPMVTVQAIAYC AQ V++ L
Sbjct  703  DASVFPTALGVNPMVTVQAIAYCVAQCVVQSL  734



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG      +ISY M+K D+ SLKNG+EK+LRI+AAAGAEE+GT H  G+  + K A
Sbjct  623  RDRGSGTVDGEGNISYRMEKGDEESLKNGVEKMLRIMAAAGAEEVGTQHCKGERFEVKRA  682

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E D FV++ S R +G+L+T + SAHQMGSCRMGV+  +S V+  GETWEVEGLF+AD
Sbjct  683  SAREWDSFVKEASRRGVGSLTTPVCSAHQMGSCRMGVEASTSAVDEGGETWEVEGLFVAD  742

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTA+S+++ L+
Sbjct  743  TSVFPTALGVNPMVTVQAIAYCTARSIVQVLR  774



>emb|CAA18625.1| putative protein [Arabidopsis thaliana]
 emb|CAB78940.1| putative protein [Arabidopsis thaliana]
Length=678

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLKNGLE+VL+ILAAAGAEEIGT H  G+ L  + A
Sbjct  524  RDKGTGTIDSKTYIDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTA  583

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVE LF+AD
Sbjct  584  SSLEIERFVREESSKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVAD  643

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  644  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  675



>emb|CDY66156.1| BnaA01g34950D [Brassica napus]
Length=508

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S  SI YN+   D+ SLK GLE+VL IL AAGAEEIGT +  GK L  K A
Sbjct  354  RDKGTGTINSKSSIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVKTA  413

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG  P  S V P GETWEVEGLF+AD
Sbjct  414  SAVEIERFVREESSKSLKDLSGQICSAHQMGSCRMGTSPEVSAVKPTGETWEVEGLFVAD  473

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVT+Q+IAYC   +V+  LK
Sbjct  474  TSVFPTALGVNPMVTIQSIAYCIGLNVVDALK  505



>ref|XP_008382148.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A 
[Malus domestica]
Length=768

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 121/154 (79%), Gaps = 3/154 (2%)
 Frame = -2

Query  691  RDKTSG--EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPK  518
            RDK SG   AP P S+SY M+  D+ +L  GLEK LRILAAAGAEEIGT H  GK L  K
Sbjct  609  RDKGSGTVNAP-PNSVSYEMEAIDEHNLNTGLEKSLRILAAAGAEEIGTHHFKGKSLAVK  667

Query  517  GASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFL  338
             AS DE + FV++ESSR L +LS+ I  A+QMGSCRMGVD + SVVN MGETWEVE LFL
Sbjct  668  KASLDEFERFVKEESSRSLRDLSSAICLAYQMGSCRMGVDAKGSVVNQMGETWEVERLFL  727

Query  337  ADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            AD+SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  728  ADTSVFPTALGVNPMVTVQAIAYCTAQSVLEVLR  761



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLKNGLE+VL+ILAAAGAEEIGT H  G+ L  + A
Sbjct  572  RDKGTGTIDSKTYIDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTA  631

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVE LF+AD
Sbjct  632  SSLEIERFVREESSKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVAD  691

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  692  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  723



>ref|XP_006283178.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16076.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=598

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLK GLE+VL+I+AAAGAEEIGT +  GK L  + A
Sbjct  444  RDKGTGTINSKSYIDYNLNDEDEESLKKGLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRA  503

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV +ESS+ L NLS  I SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD
Sbjct  504  SAVEFERFVREESSKPLKNLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVAD  563

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK +N
Sbjct  564  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLKRNN  598



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLK+GL++VL+ILAAAGAEEIGT H  G+ L  + A
Sbjct  571  RDKGTGTINSKSYIDYNLNDEDEESLKSGLDRVLKILAAAGAEEIGTHHSEGRSLNVRTA  630

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD
Sbjct  631  STLEIERFVREESSKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVAD  690

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  691  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  722



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  S  SI+Y +  TD+ +LK G+E++LRIL AAGAEEIGT +  GK L  K A
Sbjct  629  RDKGSGEIRSLNSITYTLNGTDEENLKKGIERILRILTAAGAEEIGTHNLEGKSLNVKAA  688

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S +E + FV +ESS+ L  LS  I SAHQMGSCRMGV    S V P GETWEVEGLF+AD
Sbjct  689  SSEEYERFVREESSKPLKGLSGQICSAHQMGSCRMGVAAEKSAVRPTGETWEVEGLFVAD  748

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYC    V+  LK
Sbjct  749  TSVFPTALGVNPMVTVQAIAYCVGSYVIDVLK  780



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLK GLE+VL+I+AAAGAEEIGT +  GK L  + A
Sbjct  607  RDKGTGTINSKSYIDYNLNDEDEESLKKGLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRA  666

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV +ESS+ L NLS  I SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD
Sbjct  667  SAVEFERFVREESSKPLKNLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVAD  726

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK +N
Sbjct  727  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLKRNN  761



>emb|CDX99382.1| BnaC01g11700D [Brassica napus]
Length=508

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S  SI YN+   D+ SLK GLE+VL IL AAGAEEIGT +  GK L  + A
Sbjct  354  RDKGTGTINSKSSIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVRTA  413

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG  P  S V P GETWEVEGLF+AD
Sbjct  414  SAVEIERFVREESSKGLKDLSGQICSAHQMGSCRMGTRPEVSAVKPTGETWEVEGLFVAD  473

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMV+VQ+IAYC   +V+  LK
Sbjct  474  TSVFPTALGVNPMVSVQSIAYCIGLNVVDALK  505



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLK GLE VL IL AAGAEEIGT +  GK L  + A
Sbjct  617  RDKGTGTINSKSYIDYNLNDEDEESLKKGLESVLNILIAAGAEEIGTHNSKGKSLNVRTA  676

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V PMGETWEVEGLF+AD
Sbjct  677  SAVEIERFVREESSKSLKDLSGQICSAHQMGSCRMGIRPEESAVRPMGETWEVEGLFVAD  736

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  737  TSVFPTALGVNPMVTVQSIAYCIGLNVVGALK  768



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S  SI YN+   D+ SLK GLE+VL IL AAGAEEIGT +  GK L  K  
Sbjct  617  RDKGTGTINSKSSIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVKTT  676

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG  P  S V P GETWEVEGLF+AD
Sbjct  677  SAVEIERFVREESSKSLKDLSGQICSAHQMGSCRMGTSPEVSAVKPTGETWEVEGLFVAD  736

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  737  TSVFPTALGVNPMVTVQSIAYCIGLNVVDALK  768



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLK GLE+VL+ILAA+GAEEIGT +  GK L  + A
Sbjct  618  RDKGTGTVNSTSCIDYNLNDEDEESLKKGLERVLKILAASGAEEIGTHNLEGKSLNLRTA  677

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  + SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD
Sbjct  678  SAVEIERFVREESSKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVAD  737

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  738  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  769



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SL+ GLE+VL+ILAA+GAEEIGT +  GK L  + A
Sbjct  618  RDKGTGTVNSTSCIDYNLNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKSLNLRTA  677

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  + SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD
Sbjct  678  SAVEIERFVREESSKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVAD  737

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  738  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  769



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG   +   I Y M   D+ +L+ GLEK+LRI+AAAGAEEIGT H  G  L  + A
Sbjct  625  RDRGSGTVDASGCIRYRMGAADEKNLQRGLEKILRIMAAAGAEEIGTQHCHGDRLNVRSA  684

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  + + FV+  S + L +L T + SAHQMGSCRMG+ PR+S VN  GETWEVEGLF+AD
Sbjct  685  SSHQFERFVKATSGKGLMDLLTPVYSAHQMGSCRMGIHPRTSAVNSRGETWEVEGLFVAD  744

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SV PTALGVNPMVTVQAIAYCTA SVL+ L+
Sbjct  745  ASVLPTALGVNPMVTVQAIAYCTAHSVLEELR  776



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SL+ GLE+VL+ILAA+GAEEIGT +  GK L  + A
Sbjct  615  RDKGTGTVNSTSCIDYNLNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKSLNLRTA  674

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +LS  + SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD
Sbjct  675  SAVEIERFVREESSKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVAD  734

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  735  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  766



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G   S   I YN+Q  D+ SLK GLE+VL IL AAGAEEIGT +  GK L    A
Sbjct  598  RDRGTGTISSKSCIDYNLQDEDEESLKKGLERVLEILIAAGAEEIGTHNSEGKSLNITTA  657

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            +  +I  FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD
Sbjct  658  NALQIARFVREESSKGLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVAD  717

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +VL+ LK
Sbjct  718  TSVFPTALGVNPMVTVQSIAYCIGLNVLEVLK  749



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 119/162 (73%), Gaps = 6/162 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG   S  +ISY +   D+ +L +GLE+VLR+LAAAGAEEIGT HR G+ LK K  
Sbjct  563  RDAGSGTVTSESNISYRLDDADRENLGSGLEEVLRVLAAAGAEEIGTHHRDGRSLKVKKK  622

Query  511  SRDE----IDEFVEKESSRDLG--NLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
             RD+    ++ F+++ES + L   +LS+ I SAHQMGSCRMG DP  S V+P GETWEV 
Sbjct  623  DRDDQAALLERFIKEESRKPLEKESLSSPICSAHQMGSCRMGTDPLRSAVDPNGETWEVG  682

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNH  224
            GLF+AD+SVFPTALGVNPM+TVQAI+YC ++SVL  LK + +
Sbjct  683  GLFVADTSVFPTALGVNPMLTVQAISYCISKSVLNHLKCNKY  724



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLK GLE+VL IL AAGAEEIGT +  GK L  + A
Sbjct  574  RDKGTGTVNSKSCIDYNLNDEDEESLKKGLERVLNILIAAGAEEIGTHNSEGKSLNVRTA  633

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI+ FV +ESS+ L +L+  I SAHQMGSCRMG+ P  S V P GETWEV GL++AD
Sbjct  634  SEAEIERFVREESSKGLKDLAGQICSAHQMGSCRMGIRPEESAVRPTGETWEVGGLYVAD  693

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  L+
Sbjct  694  TSVFPTALGVNPMVTVQSIAYCIGLNVVDVLR  725



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG      +ISY M++ D+ SLK G+EK+L I+A AGAEE+GT H  G+  + K A
Sbjct  627  RDRGSGTVDGEGNISYRMERGDEESLKKGVEKMLWIMAGAGAEEVGTQHCKGERFEVKRA  686

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  E + FV K S R +G L+T + SAHQMGSCRMGV+  +S V+  GETWEVEGLF+AD
Sbjct  687  SAREWERFVIKASRRVVGWLTTPVCSAHQMGSCRMGVEDTTSAVDERGETWEVEGLFVAD  746

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQAIAYCTA S+++ L+
Sbjct  747  ASVFPTALGVNPMVTVQAIAYCTAHSIVQVLR  778



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 107/152 (70%), Gaps = 0/152 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +G   S   I YN+   D+ SLK GL  VL IL AAGAEEIGT +  GK L  + A
Sbjct  617  RDKGTGTINSKSYIDYNLNDEDEESLKKGLGSVLNILIAAGAEEIGTHNSEGKSLNVRTA  676

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S  EI  FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD
Sbjct  677  SAVEIKRFVREESSKSLKDLSGQICSAHQMGSCRMGIRPEESAVKPTGETWEVEGLFVAD  736

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  737  TSVFPTALGVNPMVTVQSIAYCIGLNVVGALK  768



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG    P S++Y M   D+  LK G+E ++RILAAAGAEE+GT H  G+  + +  
Sbjct  612  RDKGSGTTDYPHSLTYGMDAEDEEKLKKGVEAMVRILAAAGAEEVGTLHCKGE--RVRVG  669

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
                ++  V++   R L +  T + +AHQMGSCRMG D R+  V+P GE WEVEGLF+AD
Sbjct  670  EEGGVEWLVKEVRRRGLRDGGTPVSTAHQMGSCRMGTDARAGAVSPTGEVWEVEGLFVAD  729

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            +SVFPTALGVNPMVT QAIAYCTAQS+L+FL+
Sbjct  730  TSVFPTALGVNPMVTAQAIAYCTAQSILEFLE  761



>ref|XP_006878629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   SP  +SY M  +DK ++ N +EK+LRILAAAGAEEIGT    G+ +  K A
Sbjct  653  RDKGSGVVSSPPYLSYKMSHSDKETMSNCMEKMLRILAAAGAEEIGTHGSNGERINVKVA  712

Query  511  SRDEIDEFVEKESSRDLGNLST----LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  E + FV + S + L   S      I SAHQMG+CRMG  P  SVV+  GE WEVEGL
Sbjct  713  SSHEFERFVREVSRKPLQRFSNGYWRPICSAHQMGTCRMGAHPNDSVVDQKGECWEVEGL  772

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  248
            ++ADSSVFPTALGVNPM+TVQAIAYCTA + L
Sbjct  773  YIADSSVFPTALGVNPMLTVQAIAYCTAHAAL  804



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  S  SI+Y +  TD+ +LK G+E++LRIL AAGAEEIGT +  GK L  K A
Sbjct  629  RDKGSGEIRSLNSITYTLNGTDEENLKKGIERILRILTAAGAEEIGTHNLEGKSLNVKAA  688

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            S +E + FV +ESS+ L  LS  I SAHQMGSCRMGV    S V P GETWEVEGLF+AD
Sbjct  689  SSEEYERFVREESSKPLKGLSGQICSAHQMGSCRMGVAAEKSAVRPTGETWEVEGLFVAD  748

Query  331  SSVFPTALGVNPMVT  287
            +SVFPTALGVNPMVT
Sbjct  749  TSVFPTALGVNPMVT  763



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG A  P S+ Y M + D+  LK  LE  +RILAAAGAEE+GT H  G+ +K  G 
Sbjct  586  RDKGSGTADYPESVVYRMDEEDEEKLKRSLEAAVRILAAAGAEEVGTHHGKGERVKVGGR  645

Query  511  SRDEIDE-FVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLA  335
               E  E  V +   R L +  T I +AHQMGSCRM  D +   V+P GETWEVEGL++A
Sbjct  646  GGGEGVEELVTEVVRRGLRDGKTPISTAHQMGSCRMAADAKEGAVSPRGETWEVEGLYVA  705

Query  334  DSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNH  224
            D+SVFPTALGVNPMVTVQAIAYCTAQS+L+ L+  N+
Sbjct  706  DTSVFPTALGVNPMVTVQAIAYCTAQSILQVLQGSNN  742



>ref|XP_001763007.1| predicted protein [Physcomitrella patens]
 gb|EDQ72212.1| predicted protein [Physcomitrella patens]
Length=775

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 105/158 (66%), Gaps = 4/158 (3%)
 Frame = -2

Query  691  RDKTSG----EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILK  524
            RD ++G    EA     I Y +   D+ ++  G+EK LR+L AAGA EIGT  + G+   
Sbjct  610  RDTSNGQVSVEADGKPKIDYTLNAVDEETILEGIEKGLRVLIAAGATEIGTHQQDGERFC  669

Query  523  PKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             KGA+  +I+ ++++  SR +     +IGS H MGSC+MG DPR S V+  GETWEVEGL
Sbjct  670  VKGANSRDIEAYIKRVRSRGVKKNKIIIGSGHHMGSCKMGSDPRRSAVDGEGETWEVEGL  729

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            +++D SV P+A+GVNPMVT+Q++AYC A SVL+ L + 
Sbjct  730  YVSDGSVLPSAIGVNPMVTIQSVAYCIAHSVLQSLDSQ  767



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 103/155 (66%), Gaps = 1/155 (1%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       + Y   ++DK +LK GL + ++IL AAGA E+GT    G+ L  KGA
Sbjct  582  RDRGSGSVGGEKDLDYRFAESDKDNLKEGLRRCVQILIAAGATEVGTHRSDGERLAVKGA  641

Query  511  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  332
            + DEI+EF+  +     G   T   SAHQMGSCRMG D  S  V+  GE+WEVEGLF+ D
Sbjct  642  TDDEIEEFLNNKGKGRRGVWPTFF-SAHQMGSCRMGKDEESGGVDWKGESWEVEGLFVCD  700

Query  331  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
             S+ PT++GVNPM+T+Q++A+C A  +L+FL+T++
Sbjct  701  GSLLPTSVGVNPMITIQSLAFCVANYILQFLRTNS  735



>ref|XP_011628129.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Amborella trichopoda]
Length=787

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (64%), Gaps = 10/159 (6%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      I+YN+ +TD+   K GL   LRIL AAGA E+GT    G+ +K KG 
Sbjct  610  RDTGSGEVMKERKITYNLHRTDREKFKKGLRTALRILVAAGAVEVGTHRSDGQRIKTKGM  669

Query  511  SRDEIDEFVE-------KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  353
              ++ +EF++         S  +  NL T   SAHQMGSCRMG D   S V+  GE+WE 
Sbjct  670  RDEDFEEFLDGIEVFGGAYSGEEKWNLYT---SAHQMGSCRMGADEEKSAVDERGESWEA  726

Query  352  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            EGLF+ D S+ PTALGVNPM+TVQ+IA+C + ++++FL+
Sbjct  727  EGLFVCDGSLMPTALGVNPMITVQSIAHCISDNMVEFLR  765



>ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
Length=747

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = -2

Query  652  ISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES  473
            ++Y +   D+ +LK G EK +R+L AAGA E+GT H  G  L  +G+    +++F+    
Sbjct  605  VTYTISAEDEKTLKAGAEKAIRVLIAAGAVEVGTQHPDGDSLVVEGSDEKALEKFLRVID  664

Query  472  SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPM  293
            S+ L + +    SAHQMGSCRMG DP SS V+P GE WE  GLF+AD+SVFPTALGVNPM
Sbjct  665  SKQLTHAAMATASAHQMGSCRMGNDPASSAVDPRGEAWESTGLFVADTSVFPTALGVNPM  724

Query  292  VTVQAIAYCTAQSVLKFLK  236
            VT Q++A C A+SV +FL+
Sbjct  725  VTAQSVALCIAKSVHRFLE  743



>ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
Length=747

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = -2

Query  652  ISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES  473
            ++Y +   D+ +LK G EK +R+L AAGA E+GT H  G  L  +G+    +++F+    
Sbjct  605  VTYTISAEDEKTLKAGAEKAIRVLIAAGAVEVGTQHPDGDSLVVEGSDEKALEKFLRVIG  664

Query  472  SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPM  293
            S+ L + +    SAHQMGSCRMG DP SS V+P GE WE  GLF+AD+SVFPTALGVNPM
Sbjct  665  SKQLTHAAMATASAHQMGSCRMGNDPASSAVDPRGEAWESTGLFVADTSVFPTALGVNPM  724

Query  292  VTVQAIAYCTAQSVLKFLK  236
            VT Q++A C A+SV +FL+
Sbjct  725  VTAQSVALCIAKSVHRFLE  743



>gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (64%), Gaps = 10/159 (6%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      I+YN+ +TD+   K GL   LRIL AAGA E+GT    G+ +K KG 
Sbjct  621  RDTGSGEVMKERKITYNLHRTDREKFKKGLRTALRILVAAGAVEVGTHRSDGQRIKTKGM  680

Query  511  SRDEIDEFVE-------KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  353
              ++ +EF++         S  +  NL T   SAHQMGSCRMG D   S V+  GE+WE 
Sbjct  681  RDEDFEEFLDGIEVFGGAYSGEEKWNLYT---SAHQMGSCRMGADEEKSAVDERGESWEA  737

Query  352  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            EGLF+ D S+ PTALGVNPM+TVQ+IA+C + ++++FL+
Sbjct  738  EGLFVCDGSLMPTALGVNPMITVQSIAHCISDNMVEFLR  776



>emb|CDX77516.1| BnaA07g06540D [Brassica napus]
Length=180

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + KTDK +L+ GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  19   RDRGSGEVKTEGRISYVVDKTDKENLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGV  78

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++    +E  + +     +  SAHQMGSCR+G D +   ++  GE+WE E L
Sbjct  79   DEKSIEEFLDSVSAEEGPKAMTEKWGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERL  138

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D SV P+A+GVNPM+T+ + AYC +  ++K + T
Sbjct  139  FVCDGSVLPSAVGVNPMITIMSTAYCISTRIVKSMTT  175



>ref|XP_007132926.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
 gb|ESW04920.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
Length=755

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 100/155 (65%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD   G+  S   I Y + + D+ +++ G+++ LRIL AAGA E+GT    G+ L+  G 
Sbjct  592  RDMACGQVTSEGRIIYKLNEIDRENMRAGMQQALRILIAAGAVEVGTHRSDGQRLRCSGV  651

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S D++ EF++     E +   G+   L  SAHQMGSCRMGV+ +   V+  GETWE EGL
Sbjct  652  SEDKVQEFLDSVCPMEGALSPGDKWNLYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGL  711

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+ D+SV PTA+GVNPM+T+Q+ AYC +  ++ +L
Sbjct  712  FVCDASVLPTAVGVNPMITIQSTAYCISNRIVDYL  746



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD   G+  +   ISY + + DK ++K GL++ LRIL AAGA E+GT    G+ LK  G 
Sbjct  592  RDMACGQVTTEGRISYKLNEVDKENMKAGLKQALRILIAAGAVEVGTHRSDGQRLKCDGI  651

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E+ EF++     E +   G    +  SAHQMGSCRMGV  +   V+  GETWE EGL
Sbjct  652  GENEVQEFLDSVCPMEGALSPGEKWNIYSSAHQMGSCRMGVSEKEGAVDENGETWEAEGL  711

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+TVQ+ AYC +  ++ +L+
Sbjct  712  FVCDASVLPSAVGVNPMITVQSTAYCISNRIVDYLR  747



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y + ++DK +L+ GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  594  RDRGAGTIEGEGRLKYRLDRSDKENLREGLRRALRILVAAGAAEVGTHRSDGQTIKCKGM  653

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E++EF++   S    R   ++ TL  SAHQMGSCRMG       V+  GE+WE  GL
Sbjct  654  KEEELEEFLDGIDSVGGPRSRSDVWTLHCSAHQMGSCRMGASEEEGGVDERGESWEAGGL  713

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D SV PTA+GVNPM+T+QAIAYC ++ + ++LK
Sbjct  714  FVCDGSVVPTAVGVNPMITIQAIAYCLSEGIAEYLK  749



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD   G+  +   ISY + + DK ++K GL++ LRIL AAGA E+GT    G+ LK  G 
Sbjct  592  RDMACGQVTTEGRISYKLNEVDKENMKAGLKQALRILIAAGAVEVGTHRSDGQRLKCDGI  651

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E+ EF++     E +   G    +  SAHQMGSCRMGV  +   V+  GETWE EGL
Sbjct  652  GENEVQEFLDSVCPMEGALSPGEKWNIYSSAHQMGSCRMGVSEKEGAVDENGETWEAEGL  711

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+TVQ+ AYC +  ++ +L+
Sbjct  712  FVCDASVLPSAVGVNPMITVQSTAYCISNRIVDYLR  747



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD   G+  +   ISY + + DK ++K GL++ L+IL AAGA E+GT    G+ LK  G 
Sbjct  594  RDMACGQVSTEGRISYKLNEIDKENMKAGLKQALKILIAAGAVEVGTHRSDGQRLKCDGI  653

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E+ EF++     E +   G    +  SAHQMGSCRMGV+ +   V+  GETWE EGL
Sbjct  654  GENEVQEFLDSVCPMEGALSPGEYWNIYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGL  713

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+TVQ+ AYC +  +  +L+
Sbjct  714  FVCDASVLPSAVGVNPMITVQSTAYCISNRIADYLR  749



>ref|XP_010102592.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
 gb|EXB93709.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
Length=742

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 103/155 (66%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      +S+ +  TDK ++  GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  583  RDRGSGEVKKEGRVSFELDDTDKENMTAGLRQALRILVAAGAVEVGTHRSDGQRIKCKGI  642

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +++E+DEF++       + ++    T  GSAHQ+GSCRMGV+ +   V+  GE+WE EGL
Sbjct  643  NKNELDEFLDSVYAVGGAMEMSECWTNYGSAHQLGSCRMGVNEKEGAVDENGESWEAEGL  702

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L
Sbjct  703  FVCDASVLPSAVGVNPMITIQSTAYCLSKKIAESL  737



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 104/164 (63%), Gaps = 6/164 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  S   I+Y   K+DK +LK GL++ LRIL AAGA E+GT    G+ +K KG 
Sbjct  600  RDQGSGEVKSRGMITYEFSKSDKENLKAGLQQALRILIAAGAVEVGTHRNDGQRIKCKGI  659

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++EF+E  ++   G LS     TL  SAHQMGSCRM    +   V+  GE+WE EG
Sbjct  660  KEEDLEEFLETVTTAG-GFLSGEENWTLYSSAHQMGSCRMSSTEKEGAVDENGESWEAEG  718

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQG  215
            L++ D SV P A+GVNPM+T+Q+IAYC ++ + K L      +G
Sbjct  719  LYVCDGSVLPNAVGVNPMITIQSIAYCLSKKIAKSLNKGKFSEG  762



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D  SGE  S   ISY    TDK SLK GL++ LRIL AAGA+E+GT    G+ +K KG 
Sbjct  581  KDVGSGEVRSDGRISYTFNATDKESLKQGLKQALRILIAAGADEVGTQRSDGQRMKCKGK  640

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  EI+ F+      E  + L    T   SAHQMGSCRMG+  +   V+  GE+WE  GL
Sbjct  641  SEKEIEAFLNTVTAAEGPKSLVKNFTTYSSAHQMGSCRMGMSEKDGAVDENGESWEANGL  700

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  701  FVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMIK  736



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 104/164 (63%), Gaps = 6/164 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  S   I+Y   K+DK +LK GL++ LRIL AAGA E+GT    G+ +K KG 
Sbjct  594  RDQGSGEVKSRGMITYEFSKSDKENLKAGLQQALRILIAAGAVEVGTHRNDGQRIKCKGI  653

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++EF+E  ++   G LS     TL  SAHQMGSCRM    +   V+  GE+WE EG
Sbjct  654  KEEDLEEFLETVTTAG-GFLSGEENWTLYSSAHQMGSCRMSSTEKEGAVDENGESWEAEG  712

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQG  215
            L++ D SV P A+GVNPM+T+Q+IAYC ++ + K L      +G
Sbjct  713  LYVCDGSVLPNAVGVNPMITIQSIAYCLSKKIAKSLNKGKFSEG  756



>ref|XP_004493801.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cicer arietinum]
Length=738

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  +   +SY + K DK +L+ GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  581  RDKGSGEIKTEGRVSYRLDKIDKENLRVGLRQSLRILVAAGAVEVGTYRSDGQRIKCRGI  640

Query  511  SRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
               +++EF++  +     R  G + T+  SAHQMGSCRMG +     V+  GE+WE +GL
Sbjct  641  KDKDLEEFLDNVAVVGGPRSRGEVWTVFSSAHQMGSCRMGANEEEGAVDENGESWEAKGL  700

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D SV P+A+GVNPM+T+Q+ AYC A  + + LK
Sbjct  701  FVCDGSVLPSAVGVNPMITIQSTAYCIASKIAESLK  736



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAG--KILKPK  518
            RDK  G+  +   ISY +   DK +++ G+++ LRIL AAGA E+GT HR+G  +I   +
Sbjct  593  RDKAGGQVTTERRISYKLNSIDKENMRAGIQQALRILIAAGAVEVGT-HRSGGQRIKCNE  651

Query  517  GASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              S  EI+EF++     E +   G    L  SAHQMGSCRMGV+ +   V+  GE+WE E
Sbjct  652  NTSEKEIEEFIDSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAE  711

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D+SV PTA+GVNPM+T+Q+ A+C +  ++ FL+
Sbjct  712  GLFVCDASVLPTAVGVNPMITIQSTAFCISNRIVDFLR  749



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG   S   +SYN+ + D+ +LK GL + LRIL AAGA E+GT    G+ L+ KG 
Sbjct  581  RDSGSGAVRSEGRVSYNLSEEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGI  640

Query  511  SRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             ++E++EF++  S+      L     +  SAHQMGSC++GV  +   V+  GE+WE EGL
Sbjct  641  GKEELEEFLDNVSAEGGLLSLSRNWNVYTSAHQMGSCKIGVSEKEGAVDENGESWEAEGL  700

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV PTA+GVNPM+T+Q+ AYC +  +   L+
Sbjct  701  FVCDASVLPTAVGVNPMITIQSTAYCISNRIAALLR  736



>ref|XP_002528823.1| disulfide oxidoreductase, putative [Ricinus communis]
 gb|EEF33557.1| disulfide oxidoreductase, putative [Ricinus communis]
Length=747

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 103/158 (65%), Gaps = 6/158 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  S   I+YN    D  +LK GL + LRIL AAGA E+GT    G+ LK +G 
Sbjct  588  RDRGSGEVKSEGRIAYNFDALDIENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLKCQGI  647

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            ++ +++EF++  S    G LS         SAHQ+GSCRMG+  +   V+  GE+WE EG
Sbjct  648  TKKQLEEFLDTVSP-PRGPLSPGKDWVAYTSAHQLGSCRMGISEKEGAVDENGESWEAEG  706

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            LF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + K+L+T
Sbjct  707  LFVCDASVLPSAIGVNPMITIQSTAYCLSERISKYLRT  744



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 102/156 (65%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG+  +   ISYN+   DK +LK GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  586  RDSGSGKVTTEGRISYNLDAMDKENLKAGLRQALRILVAAGAVEVGTHRSDGQRIKCRGI  645

Query  511  SRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             +++++EF++   +      L     L  SAHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  646  KKEDLEEFLDTVYATAGPLSLAEDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEGL  705

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  706  FICDASVLPSAVGVNPMITIQSTAYCLSKKIAESLR  741



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 108/169 (64%), Gaps = 12/169 (7%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG-  515
            RD+  GE      I+Y M   DK +++ GL + LRIL AAGA+E+GT    G  +K +G 
Sbjct  600  RDRGHGEVTREGIINYKMDSVDKENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGG  659

Query  514  -ASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  353
             AS  +++EF+++ S+ D G L+     T   SAHQMGSCRMG++ +   V+  GE+WE 
Sbjct  660  TASEYQVEEFLDRVSAED-GPLAMDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEA  718

Query  352  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQGYIK  206
            EGLF+ D+SV PTA+GVNPM+T+++ AYC A  + ++L      QG +K
Sbjct  719  EGLFVCDASVLPTAVGVNPMITIESTAYCIANRIAEYLSK----QGLLK  763



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 108/169 (64%), Gaps = 12/169 (7%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG-  515
            RD+  GE      I+Y M   DK +++ GL + LRIL AAGA+E+GT    G  +K +G 
Sbjct  600  RDRGHGEVTREGIINYKMDSVDKENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGG  659

Query  514  -ASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  353
             AS  +++EF+++ S+ D G L+     T   SAHQMGSCRMG++ +   V+  GE+WE 
Sbjct  660  TASEYQVEEFLDRVSAED-GPLAMDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEA  718

Query  352  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQGYIK  206
            EGLF+ D+SV PTA+GVNPM+T+++ AYC A  + ++L      QG +K
Sbjct  719  EGLFVCDASVLPTAVGVNPMITIESTAYCIANRIAEYLSK----QGLLK  763



>ref|XP_006354464.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Solanum 
tuberosum]
Length=667

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D  SGE  S   I+Y    TDK SLK GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  506  KDVGSGEVRSEGRINYTFNGTDKESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCKGQ  565

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S   ++ F++     E  + L    T   SAHQMGSCRMG++ + S V+  GE+WE EGL
Sbjct  566  SEKALESFLDTVTAAEGPKSLVKDFTTYCSAHQMGSCRMGMNEKDSAVDENGESWEAEGL  625

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  626  FVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMIK  661



>ref|XP_010512451.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Camelina sativa]
Length=749

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + KTDK ++K GL + LRIL AAGAEE+GT    G+ILK KG 
Sbjct  589  RDRGSGEVKTEGRISYVVDKTDKENIKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGV  648

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++  SS +    +     +  SAHQMGSCR+G + +   ++  GE+WE E L
Sbjct  649  DEKSIEEFLDSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKL  708

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  709  FVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  745



>ref|XP_010488398.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=750

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + KTDK ++K GL + LRIL AAGAEE+GT    G+ILK KG 
Sbjct  590  RDRGSGEVKTEGRISYVVDKTDKENIKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGV  649

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++  SS +    +     +  SAHQMGSCR+G + +   ++  GE+WE E L
Sbjct  650  DEKSIEEFLDSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKL  709

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  710  FVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  746



>gb|KGN56837.1| hypothetical protein Csa_3G134850 [Cucumis sativus]
Length=669

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG   S   +SYN+ + D+ +LK GL + LRIL AAGA E+GT    G+ L+ KG 
Sbjct  513  RDSGSGAVRSEGRVSYNLSEEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGI  572

Query  511  SRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             ++E++EF++  S+      L     +  SAHQMGSC++GV      ++  GE+WE EGL
Sbjct  573  GKEELEEFLDSVSAEGGLLSLSKDWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGL  632

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV PTA+GVNPM+T+Q+ AYC +  +   L+
Sbjct  633  FVCDASVLPTAVGVNPMITIQSTAYCISNRIAALLR  668



>ref|XP_003607676.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=606

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 5/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILK-PKG  515
            RDK SG+  +   ISY +   D+ +++ GL++ LRIL AAGA E+GT    G+ +K  + 
Sbjct  445  RDKASGQVKTEGRISYKLNSIDRENMRAGLQQGLRILIAAGAVEVGTHRSDGQRIKCNEN  504

Query  514  ASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
                EI+EF++     E +   G    L  SAHQMGSCRMGV+ +   V+  GE+WE EG
Sbjct  505  TGEKEIEEFIDSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEG  564

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+SV PTA+GVNPM+T+Q+ A+C +  ++ FL+
Sbjct  565  LFVCDASVLPTAVGVNPMITIQSTAFCISNRIVDFLR  601



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D  SGE  S   I+Y    TDK SLK GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  580  KDVGSGEVRSEGRINYTFNGTDKESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCKGQ  639

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S   ++ F++     E  + L    T   SAHQMGSCRMG++ + S V+  GE+WE EGL
Sbjct  640  SEKALESFLDTVTAAEGPKSLVKDFTTYCSAHQMGSCRMGMNEKDSAVDENGESWEAEGL  699

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  700  FVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMIK  735



>emb|CDO99261.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  S   IS+    TDK +L  GL + LRIL AAGA E+GT    G+  K KG 
Sbjct  588  RDRGSGEVRSEGRISHTFDATDKENLTAGLRQALRILVAAGAVEVGTLQSDGQKFKCKGT  647

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  E++EF+++ ++    + L    T   SAHQMGSCRMG   +   V+  GE+WE EGL
Sbjct  648  SEGELEEFLDEVTAAGGPKSLVQNWTTYFSAHQMGSCRMGKSEKVGAVDENGESWEAEGL  707

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+Q+ AYC +  + + LK
Sbjct  708  FVCDASVLPGAVGVNPMITIQSTAYCLSNKIAEILK  743



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (60%), Gaps = 4/159 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK+SGE      + Y +   DK +LK GL + LRIL AAGA E+GT    G+ L  KG 
Sbjct  588  RDKSSGEVKKEGRVRYRLNNHDKENLKMGLRQCLRILVAAGAVEVGTYRSDGQRLNCKGV  647

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E++EF++       +R      T+ G AHQM SCRMG       V+  GETWE +GL
Sbjct  648  KEEEMEEFLDSVIAPGGARSRTEHWTMYGCAHQMSSCRMGASKEDGAVDENGETWEAKGL  707

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            ++ D SV PTALGVNPM+T++++AYC +  +   L+  N
Sbjct  708  YVCDGSVLPTALGVNPMITIESVAYCISTRIASVLEEEN  746



>ref|XP_001761391.1| predicted protein [Physcomitrella patens]
 gb|EDQ73780.1| predicted protein [Physcomitrella patens]
Length=685

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (66%), Gaps = 0/138 (0%)
 Frame = -2

Query  652  ISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES  473
            ISY M K D+ +   G+ + LR+L AAGA E+G+     +    KGAS  +I+ ++ +  
Sbjct  543  ISYKMSKYDQETTVAGMVQSLRVLVAAGAVEVGSQQLGAERFNAKGASPSDIEAYLNRVE  602

Query  472  SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPM  293
             R     +  I SAHQ+GSCRMG  P +S  +P GE WEVEGLF+ D SV PTA GVNPM
Sbjct  603  RRGASETTAQIISAHQLGSCRMGTSPSTSAADPRGEIWEVEGLFVGDGSVLPTAPGVNPM  662

Query  292  VTVQAIAYCTAQSVLKFL  239
            VT+Q++A+CTA+ ++++L
Sbjct  663  VTIQSVAFCTAEHIVQYL  680



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 103/156 (66%), Gaps = 6/156 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG+  +   ISYN+   DK +LK GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  586  RDSGSGKVTTEGRISYNLDAMDKENLKAGLRQALRILVAAGAVEVGTHRSDGQRIKCRGI  645

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
             +++++EF++   +   G LS      L  SAHQMGSCRMG++ +   V+  GE+WE EG
Sbjct  646  KKEDLEEFLDTVYA-TAGPLSPVEDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEG  704

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            LF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L
Sbjct  705  LFVCDASVLPSAVGVNPMITIQSTAYCLSKKIAESL  740



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis sativus]
Length=738

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG   S   +SYN+ + D+ +LK GL + LRIL AAGA E+GT    G+ L+ KG 
Sbjct  582  RDSGSGAVRSEGRVSYNLSEEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGI  641

Query  511  SRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             ++E++EF++  S+      L     +  SAHQMGSC++GV      ++  GE+WE EGL
Sbjct  642  GKEELEEFLDSVSAEGGLLSLSKDWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGL  701

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV PTA+GVNPM+T+Q+ AYC +  +   L+
Sbjct  702  FVCDASVLPTAVGVNPMITIQSTAYCISNRIAALLR  737



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 97/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D  SGE  S   ISY     DK SLK GL + LRIL AAGA E+GT    G+ +K  G 
Sbjct  580  KDVGSGEVRSEGRISYTFNGMDKESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCTGQ  639

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S   ++ F+E     E  + L    T   SAHQMGSCRMG++ + S V+  GE+WE EGL
Sbjct  640  SEKALESFLETVTAAEGPKSLVKDFTTYSSAHQMGSCRMGMNEKDSAVDENGESWEAEGL  699

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  700  FVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMIK  735



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I+Y + + DK +LK GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  587  RDQGSGEVKIQGRITYRLSELDKENLKAGLRRALRILIAAGAVEVGTHRSDGQRIKCRGI  646

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++EF++  S+ + G +S     T+  SAHQMGSCRM    +   V+  GE+WE EG
Sbjct  647  KEEDLEEFLDTVSAVE-GPMSREEHWTIYASAHQMGSCRMSAKEKDGAVDENGESWEAEG  705

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            L++ D SVFP ALGVNPM+T+Q+IAYC ++ + + L+
Sbjct  706  LYVCDGSVFPNALGVNPMITIQSIAYCLSKKIAESLE  742



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      IS+ + + DK +LK GL + LRIL AAGA E+GT    G+ LK +G 
Sbjct  585  RDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRILLAAGAVEVGTHRSDGQRLKCEGI  644

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +  E+++F++     E  +       + G+AHQMGSCRMGV+ +   V+  G++WE EGL
Sbjct  645  TEKEVEQFLDTVYAAEGPKSSVENWMVYGTAHQMGSCRMGVNDKEGAVDENGQSWEAEGL  704

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D+SVFP+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  705  YVCDASVFPSAVGVNPMITIQSTAYCLSKRIAESLR  740



>sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Lotus japonicus]
 emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
Length=749

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK  G+  +   +SY +   DK ++K GL++ LRIL AAGA E+GT    G+ +K    
Sbjct  590  RDKACGQVTTEGRVSYKLSAFDKENMKCGLQQALRILKAAGAVEVGTHRSDGQRVKCGEV  649

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S +E+ EF++     E +   G    +  SAHQMGSCRMG++ +   V+  GE+WE +GL
Sbjct  650  SENEMAEFIDSVCPMEGALSPGENWNIYTSAHQMGSCRMGMNEKEGAVDENGESWEAQGL  709

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+S+ PTA+GVNPM+T+Q+ AYC +  V+ +LK
Sbjct  710  FVCDASLLPTAVGVNPMITIQSTAYCISNRVVDYLK  745



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 97/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D  SG+  S   ISY     DK SLK GL + LRIL AAGA+E+GT    G+ +K KG 
Sbjct  581  KDVGSGKVRSDGRISYKFNAMDKESLKQGLRQALRILIAAGADEVGTQRSDGQRMKCKGK  640

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  EI+ F++     E  + L    T   SAHQMGSCRMG+  +   V+  GE+WE  GL
Sbjct  641  SEKEIEAFLDTVTAAEGPKSLVKNFTTYSSAHQMGSCRMGMSKKDGAVDENGESWEANGL  700

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  701  FVCDASVLPGAVGVNPMITIQSTAYCLSKKIAETIK  736



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      IS+ + + DK +LK GL + LRIL AAGA E+GT    G+ LK +G 
Sbjct  585  RDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQQLKCEGI  644

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +  E+++F++     E  +       + G+AHQMGSCRMGV+ +   V+  G++WE EGL
Sbjct  645  TEKEVEQFLDTVYAAEGPKSPVENWMVYGTAHQMGSCRMGVNEKEGAVDENGQSWEAEGL  704

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D+SVFP+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  705  YVCDASVFPSAVGVNPMITIQSTAYCLSKRIAESLR  740



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      IS+ + + DK +LK GL + LRIL AAGA E+GT    G+ LK +G 
Sbjct  585  RDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRILLAAGAVEVGTHRSDGQRLKCEGI  644

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +  E+++F++     E  +       + G+AHQMGSCRMGV+ +   V+  G++WE EGL
Sbjct  645  TEKEVEQFLDTVYAAEGPKSSVENWMVYGTAHQMGSCRMGVNDKEGAVDENGQSWEAEGL  704

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D+SVFP+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  705  YVCDASVFPSAVGVNPMITIQSTAYCLSKRIAESLR  740



>gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Erythranthe guttata]
Length=744

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 95/156 (61%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+  GE      + Y + K D+ ++K GL + LRIL AAGAEE+GT    G+ +K +G 
Sbjct  583  RDQGLGEVKRQGHVKYRLSKIDRENIKTGLRRALRILIAAGAEEVGTFRSDGQRIKCRGI  642

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E+DEF++   +    R      T+  SAHQMGSCRMG       V+  GE WE +GL
Sbjct  643  KDEELDEFLDNVGAVGGPRSRSEYWTIYCSAHQMGSCRMGESDEDGAVDENGECWEAKGL  702

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D SV P+ALGVNPMVT+Q+ AYC ++ +   LK
Sbjct  703  FVCDGSVLPSALGVNPMVTIQSTAYCISKRLAASLK  738



>ref|XP_006489751.1| PREDICTED: long-chain-alcohol oxidase FAO3-like, partial [Citrus 
sinensis]
Length=580

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      IS+ + + DK +LK GL + LRIL AAGA E+GT    G+ LK +G 
Sbjct  421  RDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQRLKCEGI  480

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            ++ E+++F++     E  +       + G+AHQMGSCRMGV+ +   V+  G++WE EGL
Sbjct  481  TKKEVEQFLDTVYAAEGPKSPVENWMVYGTAHQMGSCRMGVNEKEGAVDENGQSWEAEGL  540

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  541  YVCDASVLPSAVGVNPMITIQSTAYCLSKRIAESLR  576



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 5/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILK-PKG  515
            RDK SG+  +   ISY +   D+ +++ GL++ LRIL AAGA E+GT    G+ +K  + 
Sbjct  602  RDKASGQVKTEGRISYKLNSIDRENMRAGLQQGLRILIAAGAVEVGTHRSDGQRIKCNEN  661

Query  514  ASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
                EI+EF++     E +   G    L  SAHQMGSCRMGV+ +   V+  GE+WE EG
Sbjct  662  TGEKEIEEFIDSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEG  721

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+SV PTA+GVNPM+T+Q+ A+C +  ++ FL+
Sbjct  722  LFVCDASVLPTAVGVNPMITIQSTAFCISNRIVDFLR  758



>ref|XP_006379996.1| hypothetical protein POPTR_0008s18750g, partial [Populus trichocarpa]
 gb|ERP57793.1| hypothetical protein POPTR_0008s18750g, partial [Populus trichocarpa]
Length=388

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG+  +   ISY +  +D+ +LK GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  231  RDSGSGKVTTEGRISYYLNASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGI  290

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++EF++   +   G LS         SAHQMGSCRMG++ +   V+  GE+WE EG
Sbjct  291  KIEDLEEFLDTVYATG-GALSLEEDWMFYSSAHQMGSCRMGINEKEGAVDENGESWEAEG  349

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  350  LFVCDASVLPSAVGVNPMITIQSTAYCLSKKIAESLR  386



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G+      ISYN+   DK +L+ G+ + LRIL AAGA E+GT    G+ LK KG 
Sbjct  581  RDEGTGKVKVEGRISYNLSAIDKENLRAGVRQGLRILIAAGAVEVGTYRSDGQRLKSKGI  640

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +  E++EF++     E  +   +  T+ G+AHQMGSCRMG   +   V+  GE+WE  GL
Sbjct  641  NEKELEEFLDSVSAVEGPQSFVDKWTITGTAHQMGSCRMGQSEKEGAVDENGESWEAAGL  700

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            F+ D SV PTA+GVNPM+T+Q+ AYC ++ +
Sbjct  701  FVCDGSVLPTAVGVNPMITIQSTAYCLSKKI  731



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D+ SGE      I+Y + + DK ++K GL + LRIL AAGA E+GT    G+ +  KG 
Sbjct  568  KDQGSGEVKKAGRIAYRLDEIDKENIKAGLRRALRILVAAGAVEVGTYQSDGQKISCKGI  627

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E++EF++   +       G   T+ GSAHQMGSCRMG +     V+  GE WE +GL
Sbjct  628  KNEELEEFLDTVRATGGPNSKGEQWTIYGSAHQMGSCRMGANEEDGAVDENGECWEAKGL  687

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            ++ D SV PTA+GVNPM+T+Q+ AYC A+ + + +  HN
Sbjct  688  YVCDGSVLPTAVGVNPMITIQSTAYCIAKRIAESM--HN  724



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G+      ISYN+   DK +L+ G+ + LRIL AAGA E+GT    G+ LK KG 
Sbjct  581  RDEGTGKVKVEGRISYNLSAIDKENLRAGVRQGLRILIAAGAVEVGTYRSDGQRLKSKGI  640

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +  E++EF++     E  +   +  T+ G+AHQMGSCRMG   +   V+  GE+WE  GL
Sbjct  641  NEKELEEFLDSVSAAEGPQSFVDKWTITGTAHQMGSCRMGKSEKEGAVDENGESWEAAGL  700

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            F+ D SV PTA+GVNPM+T+Q+ AYC ++ +
Sbjct  701  FVCDGSVLPTAVGVNPMITIQSTAYCLSKKI  731



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 97/155 (63%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ++Y + K DK SL+ GL K LRIL AAGA E+GT    G+ +K KG 
Sbjct  562  RDQGSGEVKAEGRVTYRLDKEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGM  621

Query  511  SRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              ++++EF++  +     R    + T+  +AHQM SCRMG       ++  GETWE EGL
Sbjct  622  KEEDLEEFLDTVTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGL  681

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            ++ D SV P+A+GVNPMVT+Q+ +YC A  + + L
Sbjct  682  YVCDGSVLPSAVGVNPMVTIQSTSYCIASKIAESL  716



>ref|XP_011080082.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Sesamum indicum]
Length=742

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      I Y +   DK +LK GL + LRIL  AGA E+GT    G+ ++ KG 
Sbjct  582  RDYGSGEVRKQGHIKYRLSAVDKENLKTGLRRALRILVGAGAAEVGTFRSDGQRIRCKGT  641

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              ++++EF++  ++    R      TL  SAHQMGSCRMG +     V+  GE WE +GL
Sbjct  642  KNEDLEEFLDAVTAVGGPRTRSEYWTLYCSAHQMGSCRMGANEEDGAVDENGECWEAKGL  701

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D SV PTA+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  702  FVCDGSVLPTAVGVNPMITIQSTAYCISKRLADSLK  737



>gb|KJB10007.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=665

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 99/158 (63%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I Y + + DK +LK GL +VLR+L AAGA E+GT    G+ +K KG 
Sbjct  508  RDQGSGEVMEEGKIKYRLSEVDKENLKIGLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGL  567

Query  511  SRDEIDEFVEKE------SSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
            + + + EF++        SS+D     TL  +AHQ+GSCRMG       V+  G++WE E
Sbjct  568  TEESLQEFLDNVPVVGGLSSKD--EYWTLYLTAHQIGSCRMGATEEEGAVDENGQSWEAE  625

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D+SV PTA+GVNPM+T+Q+ +YC +  + + LK
Sbjct  626  GLFVCDASVLPTAIGVNPMITIQSTSYCISNKIAQLLK  663



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 97/155 (63%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ++Y + K DK SL+ GL K LRIL AAGA E+GT    G+ +K KG 
Sbjct  583  RDQGSGEVKAEGRVTYRLDKEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGM  642

Query  511  SRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              ++++EF++  +     R    + T+  +AHQM SCRMG       ++  GETWE EGL
Sbjct  643  KEEDLEEFLDTVTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGL  702

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            ++ D SV P+A+GVNPMVT+Q+ +YC A  + + L
Sbjct  703  YVCDGSVLPSAVGVNPMVTIQSTSYCIASKIAESL  737



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 97/155 (63%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ++Y + K DK SL+ GL K LRIL AAGA E+GT    G+ +K KG 
Sbjct  583  RDQGSGEVKAEGRVTYRLDKEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGM  642

Query  511  SRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              ++++EF++  +     R    + T+  +AHQM SCRMG       ++  GETWE EGL
Sbjct  643  KEEDLEEFLDTVTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGL  702

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            ++ D SV P+A+GVNPMVT+Q+ +YC A  + + L
Sbjct  703  YVCDGSVLPSAVGVNPMVTIQSTSYCIASKIAESL  737



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   I Y + KTDK ++  GL + LRIL AAGAEE+GT    GKILK KG 
Sbjct  586  RDRGSGEVKTEGRIRYVVDKTDKGNIIAGLRQSLRILIAAGAEEVGTHRSDGKILKCKGV  645

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              + I+EF++  SS +    +     +  SAHQMGSCR+G + +   ++  GE+WE E L
Sbjct  646  DENSIEEFLDSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEKEGAIDLNGESWEAERL  705

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  706  FVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  742



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=743

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  +   I Y + ++DK +++ GL + +RIL AAGA E+GT    G+ +  KG 
Sbjct  582  RDKGSGEVRAENKIEYRLDRSDKENIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGT  641

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             +++++EF++        R  G   T+  +AHQMGSC+MG   +   V+  GE+WE EGL
Sbjct  642  KKEDLEEFLDSVIAVGGPRTRGEYWTMYSTAHQMGSCKMGATEKEGGVDENGESWEAEGL  701

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D S+ PTA+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  702  FVCDGSLLPTAIGVNPMITIQSTAYCVSKKIADSLK  737



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 103/158 (65%), Gaps = 4/158 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG+  +   ++Y  ++ D+ +L+ GL + LRIL AAGA E+GT    G+ ++ KG 
Sbjct  588  RDQGSGKVHAGGRVTYKFEEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRIRCKGI  647

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S +E+DEF++      S    G    +  +AHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  648  SNEELDEFLDSVSMLTSPLCTGENWVVHTTAHQMGSCRMGINEKEGAVDENGESWEAEGL  707

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            F+ D+S+ P+A+GVNPM+TVQ+ AYC ++ + + L+  
Sbjct  708  FVCDASILPSAVGVNPMITVQSTAYCLSKKIAESLRQQ  745



>gb|AES61079.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=538

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 100/157 (64%), Gaps = 5/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNM-QKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  515
            +DK  GE  S   I+Y + ++ DK ++K+GL++ LRIL AAGA E+GT    G+ +   G
Sbjct  380  QDKGCGEVKSEGRINYELDEEFDKENMKHGLQRALRILIAAGAVEVGTHRSDGQRIVCSG  439

Query  514  ASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
             +  E+++FVE     E          +  SAHQMGSCR+G+  +   V+  G+ WE EG
Sbjct  440  TNEMELNKFVESVYAAEGPMSHQETWNMYASAHQMGSCRIGITDKEGTVDENGQNWEAEG  499

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+S+FPTA+G+NPM+T+Q+IAYC A+ +   L+
Sbjct  500  LFVCDASLFPTAIGINPMITIQSIAYCVAKRIALILR  536



>sp|B5WWZ9.1|FAO2_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO2; AltName: Full=Long-chain 
fatty alcohol oxidase 2 [Lotus japonicus]
 emb|CAP15763.1| long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
Length=750

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 99/161 (61%), Gaps = 8/161 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE  +   ISY + K D+ SL+ GL K LRIL AAGA E+GT    G+ +K +G 
Sbjct  592  RDHGSGEVKAEGRISYKLDKIDRESLQTGLRKALRILVAAGAVEVGTYRSDGQRIKCRGI  651

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
               +++EF++        SSR+   + T+  SAHQM SCRM        V+  GE+WE +
Sbjct  652  KESDLEEFLDSVRVVGGPSSRN--EVWTVFTSAHQMTSCRMSATEEEGAVDENGESWEAK  709

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            GL++ D SV P+A+GVNPM+T+Q+ AYC A ++ + LK  N
Sbjct  710  GLYVCDGSVLPSAVGVNPMITIQSTAYCIASNIAESLKKQN  750



>ref|XP_011080081.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Sesamum indicum]
Length=742

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      I Y +   DK +LK GL + LRIL  AGA E+GT    G+ ++ KG 
Sbjct  582  RDHGSGEVRKQGHIKYRLSAVDKENLKTGLRRALRILVGAGAAEVGTFRSDGQRIRCKGT  641

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              ++++EF++  ++    R      TL  SAHQMGSCRMG +     V+  GE WE +GL
Sbjct  642  KNEDLEEFLDTVTAVGGPRSRSEYWTLYCSAHQMGSCRMGANEEDGAVDENGECWEAKGL  701

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D SV P+A+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  702  FVCDGSVLPSAVGVNPMITIQSTAYCISKRLADSLK  737



>gb|KJB10008.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=749

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 99/158 (63%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I Y + + DK +LK GL +VLR+L AAGA E+GT    G+ +K KG 
Sbjct  592  RDQGSGEVMEEGKIKYRLSEVDKENLKIGLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGL  651

Query  511  SRDEIDEFVEKE------SSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
            + + + EF++        SS+D     TL  +AHQ+GSCRMG       V+  G++WE E
Sbjct  652  TEESLQEFLDNVPVVGGLSSKD--EYWTLYLTAHQIGSCRMGATEEEGAVDENGQSWEAE  709

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D+SV PTA+GVNPM+T+Q+ +YC +  + + LK
Sbjct  710  GLFVCDASVLPTAIGVNPMITIQSTSYCISNKIAQLLK  747



>gb|KJB10006.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=742

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 99/158 (63%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I Y + + DK +LK GL +VLR+L AAGA E+GT    G+ +K KG 
Sbjct  585  RDQGSGEVMEEGKIKYRLSEVDKENLKIGLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGL  644

Query  511  SRDEIDEFVEKE------SSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
            + + + EF++        SS+D     TL  +AHQ+GSCRMG       V+  G++WE E
Sbjct  645  TEESLQEFLDNVPVVGGLSSKD--EYWTLYLTAHQIGSCRMGATEEEGAVDENGQSWEAE  702

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D+SV PTA+GVNPM+T+Q+ +YC +  + + LK
Sbjct  703  GLFVCDASVLPTAIGVNPMITIQSTSYCISNKIAQLLK  740



>ref|XP_009376994.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Pyrus x bretschneideri]
Length=749

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG       +SY     DK ++K GL + LRIL AAGA E+GT    G  LK KG 
Sbjct  592  RDKGSGVVTKGGRVSYEFSALDKENIKGGLRQALRILIAAGAIEVGTHRSDGLRLKCKGI  651

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             ++E++EF++     E  + L    T   SAHQMGSCRMG++ +   V+  GE+WE E L
Sbjct  652  DKEELEEFLDMVIANEGPQSLVENWTTYSSAHQMGSCRMGINAKEGAVDENGESWEAESL  711

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D SV P+A+GVNPM+T+Q+ AYC ++ +   L+
Sbjct  712  FVCDGSVLPSAVGVNPMITIQSTAYCLSKRIADSLR  747



>ref|XP_003590828.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=576

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 104/158 (66%), Gaps = 7/158 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNM-QKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  515
            +DK  GE  S   I+Y + ++ DK ++K+GL++ LRIL AAGA E+GT    G+ +   G
Sbjct  418  QDKGCGEVKSEGRINYELDEEFDKENMKHGLQRALRILIAAGAVEVGTHRSDGQRIVCSG  477

Query  514  ASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
             +  E+++FVE   + + G +S      +  SAHQMGSCR+G+  +   V+  G+ WE E
Sbjct  478  TNEMELNKFVESVYAAE-GPMSHQETWNMYASAHQMGSCRIGITDKEGTVDENGQNWEAE  536

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D+S+FPTA+G+NPM+T+Q+IAYC A+ +   L+
Sbjct  537  GLFVCDASLFPTAIGINPMITIQSIAYCVAKRIALILR  574



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 97/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D  SG   S   I Y +  +DK ++K GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  587  KDNGSGSVLSEGRIDYKLDSSDKENMKIGLVRALRILIAAGAVEVGTHQSDGQRVKCEGG  646

Query  511  SRDEIDEF----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              + ++EF    V  E  + +    +   SAHQMGSCRMGVD R   V+  GE+WE EGL
Sbjct  647  DDEGVEEFLKGVVAPEGPKSMVEKWSTYCSAHQMGSCRMGVDERCGAVDTWGESWEAEGL  706

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+QA AYC ++ + + LK
Sbjct  707  FVCDASVLPGAVGVNPMITIQATAYCISKKIAEKLK  742



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY    TDK ++  GL + L IL AAGA E+GT    G+  K KG 
Sbjct  588  RDRGSGEVRAEGRISYTFDATDKENITAGLRQALMILVAAGAVEVGTLQSNGQKFKCKGT  647

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  E++EF+++    E  + L    T   SAHQMGSCRMG   + S V+  GE+WE E L
Sbjct  648  SERELEEFLDEVTAAEGPKSLVQNWTTYFSAHQMGSCRMGKSEKVSAVDENGESWEAEDL  707

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+Q+ A+C +  + + LK
Sbjct  708  FVCDASVLPGAVGVNPMITIQSTAFCLSNKIAEILK  743



>emb|CDX85097.1| BnaC07g08090D [Brassica napus]
Length=743

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + KTDK +L+ GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  582  RDRGSGEVKTEGRISYVVDKTDKENLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGV  641

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++    +E  + +     +  SAHQMGSCR+G D +   ++  GE+WE E L
Sbjct  642  DEKSIEEFLDSVSAEEGPKAMTEKWGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERL  701

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D SV P+A+GVNPM+T+ + AYC +  ++K + T
Sbjct  702  FVCDGSVLPSAVGVNPMITIMSTAYCISTRIVKSMTT  738



>ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera]
Length=749

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 97/163 (60%), Gaps = 8/163 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK +GE      I Y +   DK +L+ GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  587  RDKGAGEVKVERRIKYRLHPADKENLRVGLRQALRILIAAGAVEVGTYRSDGQSIKCKGV  646

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              + ++EF++         SR  G+  TL  SAHQMGSCRMG       V+  GETWE +
Sbjct  647  KEEAVEEFLDGVVAGGGPCSR--GDHWTLYCSAHQMGSCRMGATEEEGAVDENGETWEAK  704

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  221
            GLF+ D SV P+A+G+NPM+T+Q  AYC ++ + + LK    +
Sbjct  705  GLFVCDGSVLPSAVGINPMITIQTTAYCISKRIAESLKKQEFL  747



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + KTDK +L+ GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  584  RDRGSGEVKTEGRISYVVDKTDKENLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGV  643

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++    +E  + +     +  SAHQMGSCR+G D +   ++  GE+WE E L
Sbjct  644  DEKSIEEFLDSVSAEEGPKAMTEKWGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERL  703

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D SV P+A+GVNPM+T+ + AYC +  ++K + T
Sbjct  704  FVCDGSVLPSAVGVNPMITIMSTAYCISTRIVKSMTT  740



>ref|XP_006589282.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Glycine 
max]
Length=649

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD   GE  S   + Y + ++DK ++++G+++ LRIL AAGA E+GT    G  ++  G 
Sbjct  492  RDMGCGEVRSEGRVHYELDESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGK  551

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            +  E++ FVE   + + G +S     ++  SAHQMGSCRMG+  +   V+  G +WE EG
Sbjct  552  NEKELERFVESVYATE-GLMSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEG  610

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+S+ PTA+GVNPM+T+Q+ AYC A+ +  FLK
Sbjct  611  LFVCDASLLPTAIGVNPMITIQSTAYCVAKRIAAFLK  647



>gb|KHN30591.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=649

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD   GE  S   + Y + ++DK ++++G+++ LRIL AAGA E+GT    G  ++  G 
Sbjct  492  RDMGCGEVRSEGRVHYELDESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGK  551

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            +  E++ FVE   + + G +S     ++  SAHQMGSCRMG+  +   V+  G +WE EG
Sbjct  552  NEKELERFVESVYATE-GLMSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEG  610

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+S+ PTA+GVNPM+T+Q+ AYC A+ +  FLK
Sbjct  611  LFVCDASLLPTAIGVNPMITIQSTAYCVAKRIAAFLK  647



>emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]
Length=678

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   I+Y + KTD+ +LK GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  518  RDRGSGEVKTEGRINYTVDKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKGV  577

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            + + I EF++    +E ++ +     +  SAHQMGSCR+G + +   ++  GE+WE E L
Sbjct  578  NENSIQEFLDSVSTEEGAKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKL  637

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  638  FVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  674



>gb|AAL31021.1|AC078948_5 putative alcohol oxidase [Oryza sativa Japonica Group]
Length=590

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 92/152 (61%), Gaps = 5/152 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y   + D   L+ GL + LRIL AAGA E+GT    G  L+ KGA
Sbjct  428  RDRGAGSVDGEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLRCKGA  487

Query  511  SRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
               +++ F     VEK       +  +++ SAHQMGSCRMG  PR   V+  GE+WE EG
Sbjct  488  RDADVEAFLDEVTVEKGPMHSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESWEAEG  547

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            L++ D S+ PTA+GVNPM+T+Q+IAYC A+ +
Sbjct  548  LYVCDGSLLPTAVGVNPMITIQSIAYCVAKGI  579



>gb|AAL31049.1|AC078893_12 putative oxidase [Oryza sativa Japonica Group]
 gb|ABB47786.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=595

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 92/152 (61%), Gaps = 5/152 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y   + D   L+ GL + LRIL AAGA E+GT    G  L+ KGA
Sbjct  433  RDRGAGSVDGEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLRCKGA  492

Query  511  SRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
               +++ F     VEK       +  +++ SAHQMGSCRMG  PR   V+  GE+WE EG
Sbjct  493  RDADVEAFLDEVTVEKGPMHSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESWEAEG  552

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            L++ D S+ PTA+GVNPM+T+Q+IAYC A+ +
Sbjct  553  LYVCDGSLLPTAVGVNPMITIQSIAYCVAKGI  584



>ref|XP_002454188.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
 gb|EES07164.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
Length=773

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 97/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       ++Y++  TD  +++ GL + LRILAAAGA EIGT    G+    +GA
Sbjct  609  RDRGSGSVLGERRVAYHLDATDAENMREGLRRALRILAAAGAAEIGTHRSDGQRFACRGA  668

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +   ++EF++        +      +L  +AHQMGSCRMGV  R   V+  GE+WEVE L
Sbjct  669  TEAALEEFLDGVDVVRGPQSKAEAWSLCCTAHQMGSCRMGVTARDGAVDARGESWEVESL  728

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P+A+GVNPMVT+Q++AYC A  + + L+
Sbjct  729  YVCDGSVLPSAVGVNPMVTIQSVAYCLATGIAESLR  764



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG+  +   ISY +  +D+ +LK GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  587  RDSGSGKVTTEGRISYKLDASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGI  646

Query  511  SRDEIDEFVEKESSRDLGNLST-----LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
             +++++EF++   +   G LS         SAHQMGSCRMG+  +   V+  GE+WE EG
Sbjct  647  KKEDLEEFLDTVYATG-GALSMEEDWMFYSSAHQMGSCRMGIKEKEGAVDENGESWEAEG  705

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  706  LFVCDASVLPSAVGVNPMITIQSTAYCLSKKIAESLR  742



>gb|KEH23951.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=567

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE  S   ISY + + D+ +L+ GL K LRIL AAGA E+GT    G+ +K +G 
Sbjct  410  RDIGSGEVRSEGKISYRLDQMDRENLRIGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGI  469

Query  511  SRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E++EF++  S     R    L T+  SAHQMGSCRMG +     V+  GE+WE +GL
Sbjct  470  KEEELEEFLDTVSVVGGPRSRSELWTMFSSAHQMGSCRMGKNEEEGAVDENGESWEAKGL  529

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P+A+GVNPMVT+Q+ AYC A  + + LK
Sbjct  530  YVCDGSVLPSAVGVNPMVTIQSTAYCIASKIAESLK  565



>gb|EEE51131.1| hypothetical protein OsJ_31875 [Oryza sativa Japonica Group]
Length=611

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 92/152 (61%), Gaps = 5/152 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y   + D   L+ GL + LRIL AAGA E+GT    G  L+ KGA
Sbjct  449  RDRGAGSVDGEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLRCKGA  508

Query  511  SRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
               +++ F     VEK       +  +++ SAHQMGSCRMG  PR   V+  GE+WE EG
Sbjct  509  RDADVEAFLDEVTVEKGPMHSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESWEAEG  568

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            L++ D S+ PTA+GVNPM+T+Q+IAYC A+ +
Sbjct  569  LYVCDGSLLPTAVGVNPMITIQSIAYCVAKGI  600



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + K D+ ++  GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  584  RDRGSGEVRTEGRISYVVDKVDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGV  643

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                IDEF++    +E  + +    ++  SAHQMGSCR+GVD     ++  GE+WE + L
Sbjct  644  DEKSIDEFLDSVSAEEGPKAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLNGESWEADKL  703

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D SV P+A+GVNPM+T+ + AYC A  ++K + T
Sbjct  704  FVCDGSVLPSAVGVNPMITIMSTAYCIATRIVKSMTT  740



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 97/158 (61%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I Y + K DK +LK GL + LRIL AAGAEE+GT    G  ++ KG 
Sbjct  585  RDQGSGEVKVEGKIKYRLSKNDKENLKTGLRQALRILVAAGAEEVGTYRSDGHRIRCKGI  644

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              ++++EF+         +SR  G   ++  SAHQMGSCRMG       V+  GE+WE E
Sbjct  645  KEEDLEEFIGSIEVVGGMASR--GEHWSVYFSAHQMGSCRMGATEEDGAVDENGESWEAE  702

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D SV P+A+G+NPM+T+++ +YC ++ +   LK
Sbjct  703  GLFVCDGSVLPSAIGINPMITIESTSYCISKKIADSLK  740



>ref|XP_006296686.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
 gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
Length=744

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + KTD+ ++K GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  584  RDRGSGEVKTEGRISYVVDKTDRDNIKAGLRQSLRILIAAGAEEVGTHRSDGQRLICKGV  643

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              D I EF++    +E  + +     +  SAHQMGSCR+G + +   ++  GE+WE E L
Sbjct  644  DEDSIQEFLDAVSTEEGPKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKL  703

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  704  FVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  740



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 102/157 (65%), Gaps = 5/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNM-QKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  515
            +DK+ GE  S   I Y + ++ DK ++K+GL++ LRIL AAGA E+GT    G+ +   G
Sbjct  587  QDKSCGEVKSEGRIKYELDEEFDKENIKDGLQQALRILIAAGAVEVGTHRSDGQRIACSG  646

Query  514  ASRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            ++  E+++FVE   +       G   ++  SAHQMGSCR+GV  +   V+  G++WE EG
Sbjct  647  SNEKELNKFVESVYATGGPMSHGENWSIYASAHQMGSCRVGVTEKEGAVDENGQSWEAEG  706

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ DSS+ PTA+GVNPM+T+Q++AYC A  +   L+
Sbjct  707  LFVCDSSLLPTAIGVNPMITIQSVAYCIANRIAVILR  743



>ref|XP_006412937.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54390.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=600

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 100/164 (61%), Gaps = 8/164 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      + Y   K DK +L+ G+ + LR+L AAGA EIGT    G+ +K +G 
Sbjct  437  RDNGSGEVMKESEVRYRTSKKDKENLRVGIRQALRVLVAAGAVEIGTYRSDGQRMKCEGV  496

Query  511  SRDEIDEFVEKESSRDLGNLST------LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
            +R+ ++EF+++  +   G +ST         SAHQMGSCRMG       V+  GE+WE E
Sbjct  497  TREAVEEFLDRVDAD--GGVSTNREYWTTYFSAHQMGSCRMGHTEEEGAVDENGESWEAE  554

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQ  218
            GLF+ D SV P+A+GVNPM+T+Q+ AYC ++ ++  L+   + +
Sbjct  555  GLFVCDGSVLPSAVGVNPMITIQSAAYCISKRIVDSLQRQKNKE  598



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       +SY  + +DK +L+ GL + LRIL AAGA E+GT    G  +K KG 
Sbjct  588  RDRGSGIVMKGGRVSYEFEASDKENLEAGLRQALRILIAAGAVEVGTHRSDGLRIKCKGI  647

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             +++++EF++  S+    + L    T   SAHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  648  EKEKLEEFLDMVSAEKGPQSLVENWTTYSSAHQMGSCRMGINEKEGAVDENGESWEAEGL  707

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  708  FVCDASVLPSAVGVNPMITIQSTAYCLSKRIAGSLK  743



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 5/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSI-SYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  515
            RD+ SG       I  Y     D+ +++ GL + LRIL AAGA E+GT    G+ +K KG
Sbjct  598  RDRGSGTVEGKEGIVRYRFDGLDRENMREGLRRALRILVAAGAVEVGTHRSDGQRIKCKG  657

Query  514  ASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
               ++++EF++  ++    R    L T+ GSAHQMGSCRMGV      V+  GE+WE +G
Sbjct  658  IKEEDLEEFLDGITAVGGPRSRSELWTIYGSAHQMGSCRMGVSEEEGGVDERGESWEAQG  717

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            LF+ D SV PTALG+NPM+T+Q++AYC ++ + + L
Sbjct  718  LFVCDGSVLPTALGINPMITIQSVAYCLSKGIAESL  753



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       +SY  + +DK +L+ GL + LRIL AAGA E+GT    G  +K KG 
Sbjct  562  RDRGSGIVMKGGRVSYEFEASDKENLEAGLRQALRILIAAGAVEVGTHRSDGLRIKCKGI  621

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             +++++EF++  S+    + L    T   SAHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  622  EKEKLEEFLDMVSAEKGPQSLVENWTTYSSAHQMGSCRMGINEKEGAVDENGESWEAEGL  681

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  682  FVCDASVLPSAVGVNPMITIQSTAYCLSKRIAGSLK  717



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 97/158 (61%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I Y + K DK +LK GL + LRIL AAGAEE+GT    G  ++ KG 
Sbjct  585  RDQGSGEVKVEGKIKYRLSKNDKENLKTGLRQALRILIAAGAEEVGTYRSDGHRIRCKGI  644

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              ++++EF+         +SR  G   ++  SAHQMGSCRMG       V+  GE+WE E
Sbjct  645  KEEDLEEFIGSIEVVGGMASR--GEHWSVYFSAHQMGSCRMGATEEDGAVDENGESWEAE  702

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D SV P+A+G+NPM+T+++ +YC ++ +   LK
Sbjct  703  GLFVCDGSVLPSAIGINPMITIESTSYCISKKIADSLK  740



>ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName: Full=Long-chain 
fatty alcohol oxidase 3 [Arabidopsis thaliana]
 gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
Length=746

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   I+Y + KTD+ +LK GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  586  RDRGSGEVKTEGRINYTVDKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKGV  645

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            + + I EF++    +E ++ +     +  SAHQMGSCR+G + +   ++  GE+WE E L
Sbjct  646  NENSIQEFLDSVSTEEGAKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKL  705

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  706  FVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  742



>ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine 
max]
Length=740

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD   GE  S   + Y + ++DK ++++G+++ LRIL AAGA E+GT    G  ++  G 
Sbjct  583  RDMGCGEVRSEGRVHYELDESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGK  642

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            +  E++ FVE   + + G +S     ++  SAHQMGSCRMG+  +   V+  G +WE EG
Sbjct  643  NEKELERFVESVYATE-GLMSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEG  701

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+S+ PTA+GVNPM+T+Q+ AYC A+ +  FLK
Sbjct  702  LFVCDASLLPTAIGVNPMITIQSTAYCVAKRIAAFLK  738



>gb|KJB72415.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=654

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG+  +   ++Y  ++ D+ +L+ GL + LRIL AAGA E+GT    G+  + KG 
Sbjct  496  RDQGSGKVHAGGRVTYKFEEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRKRCKGI  555

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S +E++EF++      S    G    +  SAHQMGSCRMG++     V+  GE+WE EGL
Sbjct  556  SNEELEEFLDSVSMLTSPLCTGENWVVHTSAHQMGSCRMGINEEEGAVDENGESWEAEGL  615

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+TVQ+ AYC ++ + + L+
Sbjct  616  FVCDASVLPSAVGVNPMITVQSTAYCLSKKIAESLR  651



>gb|KJB72416.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=677

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG+  +   ++Y  ++ D+ +L+ GL + LRIL AAGA E+GT    G+  + KG 
Sbjct  519  RDQGSGKVHAGGRVTYKFEEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRKRCKGI  578

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S +E++EF++  S        G    +  SAHQMGSCRMG++     V+  GE+WE EGL
Sbjct  579  SNEELEEFLDSVSMLTSPLCTGENWVVHTSAHQMGSCRMGINEEEGAVDENGESWEAEGL  638

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+TVQ+ AYC ++ + + L+
Sbjct  639  FVCDASVLPSAVGVNPMITVQSTAYCLSKKIAESLR  674



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 100/158 (63%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ S +      ++Y   ++D+ +L+ GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  597  RDRGSAKVEREGRVNYRFDRSDRENLRVGLRRALRILVAAGAVEVGTHRSDGQRIKCKGM  656

Query  511  SRDEIDEFVEKESSRDLG------NLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              +E++EF++    R +G       L T+  SAHQMGSCRMGV      V+  GE+WE +
Sbjct  657  KEEELEEFLD--GIRTVGGPMSKSELWTMYASAHQMGSCRMGVSEEEGGVDEKGESWEAQ  714

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D SV PTA+G+NP++T+Q+ AYC ++ + + LK
Sbjct  715  GLFVCDGSVLPTAVGINPLITIQSTAYCLSKGIAESLK  752



>ref|XP_011459707.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=546

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 101/158 (64%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  +   I Y + ++DK +++ GL + +RIL AAGA E+GT    G+ +  KG 
Sbjct  385  RDKGSGEVRAENKIEYRLDRSDKENIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGT  444

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
             +++++EF++        S+R  G   T+  SAHQMGSC+MG   +   V+  GE+WE +
Sbjct  445  KKEDLEEFLDSVIAVGGPSTR--GEHWTMYSSAHQMGSCKMGATEKEGGVDENGESWEAK  502

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            GLF+ D S+ PTA+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  503  GLFVCDGSLLPTAVGVNPMITIQSTAYCLSKKIADSLK  540



>ref|XP_001753124.1| predicted protein [Physcomitrella patens]
 gb|EDQ82165.1| predicted protein [Physcomitrella patens]
Length=699

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 94/155 (61%), Gaps = 18/155 (12%)
 Frame = -2

Query  649  SYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK------------------ILK  524
            SY +   D+ +L  G+ + LRIL AAGA EIGT    G+                  I+ 
Sbjct  538  SYKISPYDEQTLIAGMIQSLRILVAAGAVEIGTQQLDGERFKHCNSNWPIRTDSSNCIVV  597

Query  523  PKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              GA+  +I+E++++   R     S  I SAHQ+GSCRMG  PR+S V+  GETWE EG+
Sbjct  598  TAGATPAQIEEYLDRVKRRRARQSSIQIASAHQLGSCRMGTSPRTSAVDARGETWEAEGV  657

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+AD SV PT+ GVNPMVT+Q+IAYCTA SV  FL
Sbjct  658  FVADGSVLPTSSGVNPMVTIQSIAYCTADSVAHFL  692



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +GE     ++ Y + +TDK +L+ GL + LRIL AAGA E+GT    G+ ++ +G 
Sbjct  583  RDQGAGEIKVKANVKYRLNQTDKENLRIGLRQALRILIAAGATEVGTYRSDGQRIRCQGT  642

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            +++E++EF++   +   G LS     T+  SAHQM SCRMG       V+  GE+WE EG
Sbjct  643  NKEELEEFLDSVEAVG-GPLSRQKYWTMYCSAHQMSSCRMGSTKEEGAVDENGESWEAEG  701

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            LF+ D SV PTA+GVNPM+T+Q+ AYC ++ + + L
Sbjct  702  LFVCDGSVLPTAVGVNPMITIQSTAYCISKKIAESL  737



>gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Erythranthe guttata]
Length=747

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 96/155 (62%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      +SY + K D+ +LK GL + LRI+ AAGA E+GT    G+ L+ +G 
Sbjct  587  RDVGSGEVREEGRVSYKLNKFDEENLKAGLRQCLRIMIAAGAAEVGTFQNNGQRLECEGV  646

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +++++F+EK  +       G       SAHQM SCRMG D R   V+  GE+WE +GL
Sbjct  647  GGEDVEKFLEKVMAAGGPSSGGQYWNTYASAHQMSSCRMGADERDGAVDGNGESWEGKGL  706

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+ D SV PTA+GVNPM+T+++ AYC ++ +  +L
Sbjct  707  FVCDGSVLPTAVGVNPMITIESTAYCISKRIADYL  741



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 95/155 (61%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG+  +   ++Y + + DK +L+ GL K LRIL AAGA E+GT    G+  K +G 
Sbjct  566  RDHGSGKVKAEGRVTYRLDQVDKENLRIGLRKALRILVAAGAVEVGTYRSDGQRFKCRGV  625

Query  511  SRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              ++++EF++        R    L T++ SAHQM SCRMG       V+  GE+WE +GL
Sbjct  626  KEEDLEEFLDTVKIVGGPRSRNELWTVLTSAHQMTSCRMGATEEEGAVDETGESWEAKGL  685

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            ++ D SV PTA+GVNPMVT+Q+ AYC A  + + L
Sbjct  686  YVCDGSVLPTAVGVNPMVTIQSTAYCIASKIAESL  720



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I+Y + K DK ++K GL + LRIL AAGA E+GT    G+ LK KG 
Sbjct  586  RDRGSGEVMLEGRINYKLDKYDKENMKVGLRRALRILIAAGAVEVGTHQSDGQKLKCKGI  645

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +  E+++F++    ++  + +    T   SAHQMGSCRM    +   V+  GE+WE EGL
Sbjct  646  TEKEVEKFLDNVIAEDGPKSMVEKWTTYSSAHQMGSCRMAKSEKDGAVDENGESWEAEGL  705

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+T+Q  +YC ++ + + LK
Sbjct  706  FVCDASVLPGAVGVNPMITIQTTSYCLSKKIAEKLK  741



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 98/159 (62%), Gaps = 8/159 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE      I YN+ + DK  +K GL + LRIL AAGAEE+GT    G+ +K +G 
Sbjct  587  RDKGSGEVREEGKIVYNLSEFDKEHMKIGLRQALRILIAAGAEEVGTHRSDGQRMKCQGT  646

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              ++I+EF+         +SR+   L  L   AH MGSCR+G   R   V+  GE+WE +
Sbjct  647  KEEDIEEFLNDIVISGGPTSRE--ELWNLYCCAHPMGSCRIGASERDGAVDESGESWEAK  704

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            GLF+ D S+ PTA+GVNPM+T+++ AYC A+ + + L +
Sbjct  705  GLFVCDGSLMPTAIGVNPMITIESTAYCIAKKIAESLSS  743



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG+  +   ISY +  +D+ +LK GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  587  RDSGSGKVTTEGRISYYLNASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGI  646

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++EF++   +   G LS         SAHQMGSCRMG++ +   V+  GE+WE EG
Sbjct  647  KIEDLEEFLDTVYATG-GALSLEEDWMFYSSAHQMGSCRMGINEKEGAVDENGESWEAEG  705

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  706  LFVCDASVLPSAVGVNPMITIQSTAYCLSKKIAESLR  742



>gb|KJB72414.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=746

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG+  +   ++Y  ++ D+ +L+ GL + LRIL AAGA E+GT    G+  + KG 
Sbjct  588  RDQGSGKVHAGGRVTYKFEEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRKRCKGI  647

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S +E++EF++      S    G    +  SAHQMGSCRMG++     V+  GE+WE EGL
Sbjct  648  SNEELEEFLDSVSMLTSPLCTGENWVVHTSAHQMGSCRMGINEEEGAVDENGESWEAEGL  707

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+GVNPM+TVQ+ AYC ++ + + L+
Sbjct  708  FVCDASVLPSAVGVNPMITVQSTAYCLSKKIAESLR  743



>ref|XP_002454190.1| hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
 gb|EES07166.1| hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
Length=776

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 97/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       ++Y++  TD+ +++ GL + LR+LAAAGA EIGT    G+    +GA
Sbjct  616  RDRGSGTVHGERRVAYHLDATDRENMREGLRRALRVLAAAGAAEIGTHRSDGQRFVCRGA  675

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +   ++EF++        +      +L  +AHQMGSCRMG   R   V+  GE+WEVE L
Sbjct  676  TEAALEEFLDGVDVVRGPQSKAEAWSLCCTAHQMGSCRMGATARDGAVDARGESWEVESL  735

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P+A+GVNPMVT+Q++AYC A  + + L+
Sbjct  736  YVCDGSVLPSAVGVNPMVTIQSVAYCLATGIAESLR  771



>gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlisea aurea]
Length=724

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 93/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I Y + + DK +LK G+ + LRIL AAGA E GT    G+ +  KG 
Sbjct  568  RDEGSGEVKKLKQIQYKLSEVDKENLKTGMRRALRILIAAGATEAGTFRSDGQRIWCKGT  627

Query  511  SRDEIDEF----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            + D ++EF    V  +  R       + GSAHQMGSCRMG +     V+  GE+WE +GL
Sbjct  628  NDDAVEEFLDTVVAADGPRTKSMFWNIYGSAHQMGSCRMGRNEDEGAVDERGESWEAKGL  687

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D S+ PTA+GVNPMV++ A AYC A  + + +K
Sbjct  688  FVCDGSLLPTAVGVNPMVSILATAYCVANRIAESMK  723



>ref|XP_009594479.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana tomentosiformis]
Length=745

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D+ SGE      I Y + + DK ++K G+ + LRIL AAGA E+GT    G+ +  KG 
Sbjct  580  KDQGSGEVKKAGKIKYRLDEIDKENIKAGVRRALRILVAAGAAEVGTYRSDGQKISCKGI  639

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            + +E++EF++   +       G    + GSAHQMGSCRMG +     V+  GE WE +GL
Sbjct  640  TNEELEEFLDTVGATGGPSSKGEQWAIYGSAHQMGSCRMGANEEDGAVDENGECWEAKGL  699

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            ++ D SV PTA+GVNPM+T+Q+ AYC A  +
Sbjct  700  YVCDGSVLPTAVGVNPMITIQSTAYCIANRI  730



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 97/153 (63%), Gaps = 8/153 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +GE     ++ Y + +TDK +LK GL + LRIL AAGA EIGT    G+ ++ +G 
Sbjct  583  RDQGAGEIKVKANVKYRLNQTDKENLKIGLRQALRILIAAGATEIGTYRSDGQRIRCQGT  642

Query  511  SRDEIDEFVEKESSRDLG------NLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
             +++++EF++  S   +G         T+  SAHQM SCRMG       V+  GE+WE E
Sbjct  643  KKEDLEEFLD--SVEAVGGPWSRQKYWTMYCSAHQMSSCRMGSTKEEGAVDENGESWEAE  700

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            GLF+ D SV PTA+GVNPM+T+Q+ AYC ++ +
Sbjct  701  GLFVCDGSVLPTAVGVNPMITIQSTAYCISKKI  733



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 98/161 (61%), Gaps = 4/161 (2%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      + Y + + DK +L+ GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  581  RDQGSGEVKEEGMVKYRLTQLDKENLQCGLRQALRILVAAGAVEVGTYRSDGQRIKCKGL  640

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
               + +EF++  ++       G   T+  SAHQMGSCRMG +     V+  GE+WE E L
Sbjct  641  KEKDFEEFLDTVTAVGGPGTRGEHWTIYCSAHQMGSCRMGANEEEGAVDENGESWEAESL  700

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  221
            F+ D SV PTA GVNPM+++++ A+C +  ++K LK  +H+
Sbjct  701  FVCDGSVLPTAAGVNPMISIESTAFCISTRIVKSLKRQSHV  741



>ref|XP_006412936.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54389.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=756

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 99/163 (61%), Gaps = 6/163 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      + Y   K DK +L+ G+ + LR+L AAGA EIGT    G+ +K +G 
Sbjct  593  RDNGSGEVMKESEVRYRTSKKDKENLRVGIRQALRVLVAAGAVEIGTYRSDGQRMKCEGV  652

Query  511  SRDEIDEFVEKESSRDLG-----NLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            +R+ ++EF+++  + D G        T   SAHQMGSCRMG       V+  GE+WE EG
Sbjct  653  TREAVEEFLDRVDA-DGGVSTNREYWTTYFSAHQMGSCRMGHTEEEGAVDENGESWEAEG  711

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQ  218
            LF+ D SV P+A+GVNPM+T+Q+ AYC ++ ++  L+   + +
Sbjct  712  LFVCDGSVLPSAVGVNPMITIQSAAYCISKRIVDSLQRQKNKE  754



>ref|XP_010532671.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=741

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 96/157 (61%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   I Y + KTDK ++  GL + LRIL +AGA E+GT    G+ LK KG 
Sbjct  584  RDRGSGEIKAEGRIKYALDKTDKENIVAGLRQSLRILISAGAVEVGTHRSDGQSLKCKGI  643

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++  ++ D          + G+  QMGSCR+GV+     ++P GE+WE E L
Sbjct  644  DEKAIEEFLDTVTAEDGPGSFTEKWMVYGTTQQMGSCRIGVNEEEGALDPNGESWEAEKL  703

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D SV P+A+GVNPM+TV A AYC +  + K ++T
Sbjct  704  FVCDGSVLPSAIGVNPMITVMATAYCISTGIAKSIRT  740



>gb|KEH23950.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=737

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE  S   ISY + + D+ +L+ GL K LRIL AAGA E+GT    G+ +K +G 
Sbjct  580  RDIGSGEVRSEGKISYRLDQMDRENLRIGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGI  639

Query  511  SRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              +E++EF++  S     R    L T+  SAHQMGSCRMG +     V+  GE+WE +GL
Sbjct  640  KEEELEEFLDTVSVVGGPRSRSELWTMFSSAHQMGSCRMGKNEEEGAVDENGESWEAKGL  699

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P+A+GVNPMVT+Q+ AYC A  + + LK
Sbjct  700  YVCDGSVLPSAVGVNPMVTIQSTAYCIASKIAESLK  735



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 100/163 (61%), Gaps = 8/163 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG       I Y + + DK +L+ GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  593  RDKGSGVVKREGRIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRNDGQRIKCKGT  652

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              ++++EF++        SSR+   L T+  SAHQMGSCRM        V+  GE+WE +
Sbjct  653  KHEDLEEFLDTVVAPAGPSSRE--ELWTIYSSAHQMGSCRMSASEEEGGVDENGESWEAK  710

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  221
            GLF+ D S+ PTA+GVNPM+T+Q+ AYC ++ + + L+   ++
Sbjct  711  GLFVCDGSLLPTAIGVNPMITIQSTAYCISKKIAESLEKEKYI  753



>ref|XP_007035186.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 ref|XP_007035187.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06112.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06113.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
Length=657

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG+  +   ++Y     D+ ++++GL + LRIL AAGA E+GT    G+ ++ KG 
Sbjct  500  RDQGSGKVHAGGRVTYKFDALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGI  559

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  E++EF+E  S  +             SAHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  560  SNKELEEFLESVSPVEGPMFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGL  619

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+TVQ+ AYC ++ + + L+
Sbjct  620  FVCDASVLPGAIGVNPMITVQSTAYCLSKRIAESLR  655



>gb|ACF87929.1| unknown [Zea mays]
Length=468

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       ++Y++  TD+ ++++G+ + LR+LAAAGA EIGT    G+     GA
Sbjct  305  RDRGSGTVHGERRVAYHLDATDRENMRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGA  364

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +   ++EF++        +      TL  +AHQMGSCRMG   R   V+  GE+WE   L
Sbjct  365  TEAALEEFLDGVDVVRGPQSKAEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSL  424

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P A+GVNPMVT+Q++AYC A  + + L+
Sbjct  425  YVCDGSVLPGAVGVNPMVTIQSVAYCLATGIAESLR  460



>ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum]
Length=731

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 99/160 (62%), Gaps = 8/160 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D+  GE      I Y++ + DK ++K GL + LRIL AAGA E+GT    G+ +K K  
Sbjct  571  KDQGRGEVKKAGRIKYSLDRIDKENIKAGLRRALRILIAAGAVEVGTYRSDGQKIKCKDI  630

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              +E++EFV+   + + G +S     T+  SAHQMGSCRMG       V+  GE WE +G
Sbjct  631  KNEELEEFVDTVEAPE-GPMSKEENWTVYASAHQMGSCRMGSSKEDGAVDENGECWEAKG  689

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            L++ D SV PTA+GVNPM+T+Q+ AYC A+ + + L  HN
Sbjct  690  LYVCDGSVLPTAVGVNPMITIQSTAYCIAKRIAESL--HN  727



>ref|XP_009336115.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=750

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 100/163 (61%), Gaps = 8/163 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD +SG       I Y + + DK ++  GL + LRIL AAGA E+GT    G+ LK KG 
Sbjct  588  RDHSSGVVKREGRIHYTLDQLDKENILAGLRQALRILIAAGAVEVGTYRNDGQRLKCKGV  647

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              ++++EF++        S+R+   L T+  SAHQMGSCRMG       V+  GE+WE +
Sbjct  648  KEEDLEEFLDTVVTSAGPSARE--ELWTIYSSAHQMGSCRMGATEEEGGVDENGESWEAK  705

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  221
            GLF+ D+S+ PTA+GVNPM+TV++ AYC A+ + + L    ++
Sbjct  706  GLFVCDASLLPTAVGVNPMITVESTAYCIAKKIAQSLDKQKYI  748



>ref|XP_010069617.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW58025.1| hypothetical protein EUGRSUZ_H00753 [Eucalyptus grandis]
Length=746

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       I+Y + + DK +LK GL + LRIL AAGA E+GT    G+ +K +GA
Sbjct  583  RDQGSGVVKEEGVITYRLSQEDKENLKLGLRQALRILIAAGAVEVGTYRSDGQRIKCRGA  642

Query  511  SRDEIDEFVEKESSRD-LGNLS---TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             +++I+EF++  ++   LG+     T+  SAHQMGSCRMG +  +  V+  GE+WE +GL
Sbjct  643  KQEDIEEFLDSITTPGGLGSRQEHWTMYCSAHQMGSCRMGANEGAGAVDENGESWEAKGL  702

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D S+ P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  703  FVCDGSMLPSAVGVNPMITIQSTAYCISKRIAESLR  738



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 94/156 (60%), Gaps = 5/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + +   + D   L+NGL +VLRIL AAGA E+GT    G  L+ KG 
Sbjct  625  RDRGAGFVDCEGRLRFTPSRDDTDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGV  684

Query  511  SRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++ F     +EK       +   L  SAHQMGSCRMG  PR   V+  GE+WE EG
Sbjct  685  RDEDLEAFLDEVTIEKGPMHSTTDKWALFSSAHQMGSCRMGSSPREGAVDGSGESWEAEG  744

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            L++ D S+ PTA+GVNPM+T+Q++AYC ++ + + L
Sbjct  745  LYVCDGSLLPTAVGVNPMITIQSVAYCLSKDIAQAL  780



>ref|XP_003575383.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=766

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       I+Y+M   D+ + + GL + LR+L AAGA EIGT    G+ +K KGA
Sbjct  603  RDRGSGTVHGERRIAYHMDPADRENQREGLRRALRVLVAAGATEIGTHRSDGQRMKCKGA  662

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            + +E++EF++        +      +L  +AHQMGSCRM        V+  GE+WE E L
Sbjct  663  TEEEVEEFLDGVTVLRGPQSKSENWSLCCTAHQMGSCRMAATALDGAVDARGESWEAERL  722

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D+SV P+A+GVNPM+T+QA+AYC A  + + LK
Sbjct  723  YVCDASVLPSAVGVNPMITIQAVAYCLANGIAEQLK  758



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      IS+ + + DK +LK GL + LRIL AAGA E+GT    G+ LK +G 
Sbjct  585  RDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQRLKCEGI  644

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +  E+++F++     E  +       +  +AHQMGSCRMGV+ +   V+  G++WE EGL
Sbjct  645  TEKEVEQFLDTVYAAEGPKSPVENWMVYATAHQMGSCRMGVNEKEGGVDENGQSWEAEGL  704

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  705  YVCDASVLPSAVGVNPMITIQSTAYCLSKRIAESLR  740



>ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
Length=743

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 98/153 (64%), Gaps = 4/153 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + KTD+ +LK GL + L+IL AAGAEE+GT    G+ L  KG+
Sbjct  583  RDRGSGEVKTEGRISYAVDKTDRDNLKAGLRQSLKILIAAGAEEVGTHRSDGQRLICKGS  642

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              + I+EF++    +E  + +     +  SAHQMGSCR+G + +   ++  GE+WE E L
Sbjct  643  DENSIEEFLDSVSTEEGPKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKL  702

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  245
            F+ D+S  P+A+GVNPM+TV + AYC +  + K
Sbjct  703  FVCDASALPSAVGVNPMITVMSTAYCISTRIAK  735



>ref|XP_012069873.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Jatropha curcas]
 gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G+  +   ISYN+   D  +LK GL + LRIL AAGA E+GT    G+ L+ +G 
Sbjct  583  RDRGAGKVKTEGRISYNLDPFDMENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLQCQGI  642

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            ++ +++EF++       G LS      +  SAHQMGSC+MG++ +   V+  GE+WE EG
Sbjct  643  TKKDLEEFLDTVFPCR-GILSPVKDWMIYSSAHQMGSCKMGINEKEGAVDENGESWEAEG  701

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            LF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + LK
Sbjct  702  LFVCDASVLPSAVGVNPMITIQSTAYCLSKGIAESLK  738



>gb|EPS58840.1| hypothetical protein M569_15969, partial [Genlisea aurea]
Length=668

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D+  GE      ISY++ + DK ++ +GL   LRIL +AGA E+GT    G+ LK +G 
Sbjct  510  KDEAGGEVIREGRISYHLNQIDKENITSGLRTALRILISAGAVEVGTHRSDGQRLKCRGI  569

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  EI+EF++     E  + +    ++  SAHQMGSCRMG +     V+  GE+WE EGL
Sbjct  570  SEKEIEEFLDGVTAPEGPKSMVRDWSVYCSAHQMGSCRMGRNEEEGGVDENGESWEAEGL  629

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ DSS+ P A+GVNPM+T+QA +YC + ++   LK
Sbjct  630  FVCDSSLLPGAIGVNPMITIQATSYCISLNIADNLK  665



>ref|XP_007035183.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035184.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035185.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
Length=750

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG+  +   ++Y     D+ ++++GL + LRIL AAGA E+GT    G+ ++ KG 
Sbjct  590  RDQGSGKVHAGGRVTYKFDALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGI  649

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  E++EF+E  S  +             SAHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  650  SNKELEEFLESVSPVEGPMFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGL  709

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P A+GVNPM+TVQ+ AYC ++ + + L+
Sbjct  710  FVCDASVLPGAIGVNPMITVQSTAYCLSKRIAESLR  745



>ref|XP_007144044.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
 gb|ESW16038.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
Length=741

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK  G   S   + Y++ ++DK ++++G+++ LRIL AAGA E+GT    G+ ++  G 
Sbjct  584  RDKGCGVVRSEGRVHYDLDESDKENIRDGVKQALRILIAAGAVEVGTHRSDGQRIECNGN  643

Query  511  SRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
            +  E++ FVE   +   G++S     ++  SAHQMGSC+MG+  +   V+  G +WE EG
Sbjct  644  NEKELERFVESIYATG-GSMSQEEKWSIYSSAHQMGSCKMGMSEKEGAVDENGMSWEAEG  702

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            LF+ D+S+ PTA+GVNPM+T+Q+ AYC A+ +  FL
Sbjct  703  LFVCDASLLPTAIGVNPMITIQSTAYCVAKRIAAFL  738



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 94/156 (60%), Gaps = 5/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + +   + D   L+NGL +VLRIL AAGA E+GT    G  L+ KG 
Sbjct  600  RDRGAGFVDGEGRVRFTPSREDVEELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGL  659

Query  511  SRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++ F     +EK       +   L  SAHQMGSCRMG  PR   V+  GE+WE EG
Sbjct  660  RDEDLEAFLDEVTIEKGPMHSTADKWALHCSAHQMGSCRMGSSPRDGAVDGRGESWEAEG  719

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            L++ D S+ PTA+GVNPM+T+Q+IAYC ++ + + L
Sbjct  720  LYVCDGSLLPTAVGVNPMITIQSIAYCLSKGIAETL  755



>gb|KFK29401.1| hypothetical protein AALP_AA7G128800 [Arabis alpina]
Length=745

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 96/159 (60%), Gaps = 4/159 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      ++Y   K D+ +L+ GL + LR+L AAGA E+GT    G+ +K +G 
Sbjct  580  RDSGSGEVMKESEVTYRTTKKDRENLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGI  639

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S++ ++EF++   +       G   T   SAHQMGSCRMG       ++  GE+WE EGL
Sbjct  640  SKEAMEEFLDGVDAVGGVSTKGEYWTSYFSAHQMGSCRMGHSTEEGALDDNGESWEAEGL  699

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  227
            F+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L+T  
Sbjct  700  FVCDGSVLPSAVGVNPMITIQSTAYCISTRIVHLLQTRQ  738



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 99/163 (61%), Gaps = 8/163 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG       I Y + + DK +L+ GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  593  RDKGSGVVKREGRIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRNDGQRIKCKGT  652

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              ++++EF++        SSR+   L T   SAHQMGSCRM        V+  GE+WE +
Sbjct  653  KHEDLEEFLDSVVAAAGPSSRE--ELWTTYSSAHQMGSCRMSASEEEGGVDENGESWEAK  710

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  221
            GLF+ D S+ PTA+GVNPM+T+Q+ AYC ++ + + L+   ++
Sbjct  711  GLFVCDGSLLPTAIGVNPMITIQSTAYCISKKIAESLEKEKYI  753



>ref|XP_007035188.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
 gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
Length=655

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 98/155 (63%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG+  +   ++Y     D+ ++++GL + LRIL AAGA E+GT    G+ ++ KG 
Sbjct  501  RDQGSGKVHAGGRVTYKFDALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGI  560

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S  E++EF+E  S  +             SAHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  561  SNKELEEFLESVSPVEGPMFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGL  620

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+ D+SV P A+GVNPM+TVQ+ AYC ++ + + L
Sbjct  621  FVCDASVLPGAIGVNPMITVQSTAYCLSKRIAESL  655



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y     D+ +++ GL + LRIL AAGA E+GT    G+ ++ KG 
Sbjct  596  RDRGTGTVEGEGMVRYRFDALDRENMREGLRRALRILVAAGAVEVGTHRSDGQRIQCKGI  655

Query  511  SRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
               E++EF++  +     R    L T    AHQMGSCRMGV      V+  GE+WE +GL
Sbjct  656  KEAELEEFLDGITMVGGPRSRNELWTFYCCAHQMGSCRMGVSEEEGGVDETGESWEAQGL  715

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D SV P+A+G+NPM+T+Q+IAYC ++ + K L+
Sbjct  716  FVCDGSVLPSAVGINPMITIQSIAYCLSKGIAKSLR  751



>gb|EMS51759.1| Long-chain-alcohol oxidase FAO2 [Triticum urartu]
Length=515

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 91/152 (60%), Gaps = 5/152 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       + +   + D   L+NGL  VLRIL AAGA E GT    G  L+ KG 
Sbjct  353  RDRGSGFVDCEGRLRFTPSRDDARELRNGLRHVLRILVAAGAAEGGTHRSDGLRLRCKGV  412

Query  511  SRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++ F     +EK       +   +  SAHQMGSCRMG  P+ S V+  GE+WE EG
Sbjct  413  RDEDLEAFLDEVTIEKGPMHSTADKWAVFSSAHQMGSCRMGSSPKDSAVDGSGESWEAEG  472

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            L++ D S+ PTA+GVNPM+T+Q++AYC ++ +
Sbjct  473  LYVCDGSLLPTAVGVNPMITIQSVAYCLSKGI  504



>emb|CDP03771.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      ++Y++ + DK  LK GL + LRIL AAGA E+GT    G+ L+  G 
Sbjct  596  RDEGSGEVREEGRVTYHLNEMDKEHLKLGLRQCLRILIAAGAVEVGTYRSDGQRLRCDGI  655

Query  511  SRDEIDEF----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             +++++EF    V     +      T+  SAHQ+ SCRMG       V+  GE+WE EGL
Sbjct  656  KKEDVEEFLDTIVADPGPKSAAEYWTIYCSAHQLSSCRMGSTEEDGAVDENGESWEAEGL  715

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            FL D SV P+A+GVNPM+T+Q+ A+C ++ + + LK
Sbjct  716  FLCDGSVIPSAIGVNPMITIQSTAFCISKKIAESLK  751



>ref|XP_010548742.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=729

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      + Y + + DK SL+ GL + LRIL AAGA E+GT    G+ +K +G 
Sbjct  571  RDNGSGEVVKEGDVKYRLSQKDKESLRVGLRQALRILIAAGAAEVGTYRSDGQRMKCEGL  630

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            + + ++EF++   +    R  G   T   SAHQMGSCRMG       V+  G++WE EGL
Sbjct  631  TAEAMEEFLDSVDAVGGVRTRGEHWTTYFSAHQMGSCRMGASAGEGAVDENGQSWEAEGL  690

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            F+ D SV P+A+G+NPM+T+Q+ AYC ++ +
Sbjct  691  FVCDGSVLPSAIGINPMITIQSTAYCISRRI  721



>ref|XP_009137800.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Brassica rapa]
Length=744

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 94/155 (61%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      ++Y   K D+ +L+ GL + LR+L AAGA E+GT    G+ +K +G 
Sbjct  585  RDYGSGEVLKENEVTYRTSKKDRENLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGM  644

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +R+ ++EF++   +       G   T   SAHQMGSCRMG       V+  GE+WE EGL
Sbjct  645  TREAMEEFLDGVDAVGGVSTKGEYWTTYFSAHQMGSCRMGRTAEEGAVDEKGESWEAEGL  704

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L
Sbjct  705  FVCDGSVLPSAVGVNPMITIQSTAYCISTRIVASL  739



>ref|XP_006406028.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
 gb|ESQ47481.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
Length=746

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 95/157 (61%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   +SY + KTDK +L  GL + LRIL  AGAEE+GT    G+ L  KG 
Sbjct  586  RDRGSGEVKTEGRVSYVVDKTDKENLNAGLRQSLRILIQAGAEEVGTHRSDGQKLVCKGV  645

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++    +E  + +    ++  SAHQMGSC++G D     ++  GE+WE E L
Sbjct  646  DEKSIEEFLDSVNAEEGPKAMTEKWSVYSSAHQMGSCKIGEDEEEGAIDLNGESWEAEKL  705

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D S  P+A+GVNPM+T+ A AYC +  + K + T
Sbjct  706  FVCDGSALPSAVGVNPMITIMATAYCISTRIAKSMTT  742



>gb|KJB38384.1| hypothetical protein B456_006G252500 [Gossypium raimondii]
Length=748

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 98/151 (65%), Gaps = 4/151 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D+ SGE      ++Y    TD+ +L+ GL + LR+L AAGA E+GT    G+ LK KG 
Sbjct  591  KDRGSGEVHMGGRVTYKFDATDRENLRAGLRRSLRVLVAAGAVEVGTHRSDGQKLKCKGV  650

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S++E++EF++   S       G+   +  +AHQMGSC+MG + +   V+  GE+WE EGL
Sbjct  651  SKEELEEFLDTVFSVGGPLFWGDKWMVHTTAHQMGSCKMGRNEKDGGVDENGESWEAEGL  710

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            ++ D+SV PTA+GVNPM+TV + AYC ++ +
Sbjct  711  YVCDASVLPTAIGVNPMITVMSTAYCLSKRI  741



>emb|CDX92884.1| BnaC07g41420D [Brassica napus]
Length=742

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 94/155 (61%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      ++Y   K D+ +L+ GL + LR+L AAGA E+GT    G+ +K +G 
Sbjct  583  RDYGSGEVLKENEVTYRTSKKDRENLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGI  642

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +R+ ++EF++   +       G   T   SAHQMGSCRMG       V+  GE+WE EGL
Sbjct  643  TREAMEEFLDSVDAVGGVSTKGEYWTTYFSAHQMGSCRMGRTAEEGAVDEKGESWEAEGL  702

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L
Sbjct  703  FVCDGSVLPSAVGVNPMITIQSTAYCISTRIVASL  737



>ref|XP_004982883.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=685

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y+  + D   L+NGL + LRIL AAGA E+GT    G  L+  G 
Sbjct  523  RDRGAGTVDGEGRVCYSPARDDVDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGG  582

Query  511  SRD-EIDEFVEKESSRDLGNL------STLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  353
             RD E+D F++ E +   G +        L+ SAHQMGSCRMG  PR   V+  GE+WE 
Sbjct  583  VRDDELDAFLD-EVTVATGPMLPGSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEA  641

Query  352  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            EGL++ D S+ PTA+GVNPM+T+Q+ AYC ++ + + L
Sbjct  642  EGLYVCDGSLLPTAVGVNPMITIQSTAYCLSEGIAESL  679



>gb|KFK39637.1| hypothetical protein AALP_AA3G269600 [Arabis alpina]
Length=744

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE  +   I Y + KTD+ +LK GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  584  RDCGSGEVKTEGRIRYTVDKTDRENLKAGLRQSLRILIAAGAEEVGTNTSDGQRLICKGV  643

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++    +E  + +     +  SAHQMGSCR+G D +   ++  GE+WE E L
Sbjct  644  DEKSIEEFLDSVNAEEGPKSMTENWNVYSSAHQMGSCRIGEDEKEGALDLNGESWEAEKL  703

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            F+ D SV P+A+GVNPM+T+ + AYC +  +
Sbjct  704  FVCDGSVLPSAIGVNPMITIMSTAYCISTRI  734



>ref|XP_004982882.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=762

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 8/158 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y+  + D   L+NGL + LRIL AAGA E+GT    G  L+  G 
Sbjct  600  RDRGAGTVDGEGRVCYSPARDDVDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGG  659

Query  511  SRD-EIDEFVEKESSRDLGNL------STLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  353
             RD E+D F++ E +   G +        L+ SAHQMGSCRMG  PR   V+  GE+WE 
Sbjct  660  VRDDELDAFLD-EVTVATGPMLPGSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEA  718

Query  352  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            EGL++ D S+ PTA+GVNPM+T+Q+ AYC ++ + + L
Sbjct  719  EGLYVCDGSLLPTAVGVNPMITIQSTAYCLSEGIAESL  756



>emb|CDX92985.1| BnaA03g37070D [Brassica napus]
Length=721

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + K D+ ++  GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  564  RDRGSGEVRTEGRISYVVDKIDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGV  623

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++    +E  + +    ++  SAHQMGSCR+GVD     ++  GE+WE + L
Sbjct  624  DEKSIEEFLDSVSAEEGPKAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLDGESWEADKL  683

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  245
            F+ D SV P+A+GVNPM+T+ + AYC +  ++K
Sbjct  684  FVCDGSVLPSAVGVNPMITIMSTAYCISTRIVK  716



>gb|KDP26499.1| hypothetical protein JCGZ_17657 [Jatropha curcas]
Length=659

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   I +   + DK +LK GL + LRIL  AGA E+GT    G+ +  KG 
Sbjct  504  RDQGSGEVKAEGRIKHWQNQFDKENLKIGLRQALRILVGAGAVEVGTYRSDGQKIACKGI  563

Query  511  SRDEIDEFVEKESSRDLGNLS---TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLF  341
               ++++F++  +   L +     TL+ SAHQMGSCRMG   +   V+  GE+WE + LF
Sbjct  564  QDKDLEDFLDTVTVSGLTSKEEHWTLLFSAHQMGSCRMGATEKEGAVDENGESWEAKDLF  623

Query  340  LADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            + D SV PTA+GVNPM+T+Q+ AYC ++ +++ LK
Sbjct  624  VCDGSVLPTAIGVNPMITIQSTAYCISRKIVESLK  658



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 100/170 (59%), Gaps = 12/170 (7%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SGE  S   ISY + + D+ ++  GL + L+IL AAGA E+GT    G+ ++  G 
Sbjct  588  RDKGSGEVKSERRISYELTQEDRENMTAGLRRALKILIAAGAVEVGTYRSDGQRIECIGK  647

Query  511  SRDEIDEFVEKESSRD---LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLF  341
            + +EI+EF+   S+           +  +AHQMGSCRM        V+  GE+WE EGLF
Sbjct  648  NEEEIEEFLGSVSATKGPMAACFWAVYCTAHQMGSCRMSKRENEGAVDENGESWEAEGLF  707

Query  340  LADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQGYIKGDSNF  191
            + D SV P+A+GVNPM+T+Q+ AYC A+ + + LK         KG+ NF
Sbjct  708  VCDGSVLPSAVGVNPMITIQSTAYCIAKKLAESLK---------KGEFNF  748



>ref|XP_010526493.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=761

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      ++Y + + DK  L  GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  602  RDNGSGEVVKEGDVTYRLSQLDKERLSVGLRQALRILIAAGAVEVGTYRSDGQRMKCKGL  661

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            ++  ++EF++   +    R  G   T   SAHQMGSCRMG       V+  GE+WE +GL
Sbjct  662  TKQAMEEFLDSVDAVGGVRTRGEHWTTYFSAHQMGSCRMGASAGEGAVDENGESWETQGL  721

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D SV P+A+G+NPM+T+Q+ +YC +  + + L+
Sbjct  722  FVCDGSVLPSAVGINPMITIQSTSYCISTRIAESLQ  757



>ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao]
 gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
Length=740

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE      I Y   + DK +LK GL +VLRI+ AAGA E+GT    G+ +K KG 
Sbjct  583  RDQGSGEVMEEGKIRYRFSEMDKENLKIGLRQVLRIIIAAGAVEVGTHRSDGQRIKCKGL  642

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
            + + + EF++        SS++     T+  SAHQMGSCR+G       V+  G++WE E
Sbjct  643  TEESLQEFLDDVPVVGGASSKE--EYWTMYVSAHQMGSCRIGATQEEGAVDENGQSWEAE  700

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            GLF+ D+SV PTA+G+NPM+T+Q+ +YC +  +   L
Sbjct  701  GLFVCDASVLPTAIGINPMLTIQSTSYCISNKIADLL  737



>ref|XP_010433200.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Camelina sativa]
Length=748

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 93/155 (60%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      ++Y   K D+ +L+ GL + LR+L AAGA E+GT    G+ +K +G 
Sbjct  588  RDIGSGEVMKENEVTYRTTKKDRENLRAGLRQALRVLIAAGAVEVGTYRSDGQRMKCEGT  647

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +R+ I+EF+++          G   T   SAHQM SCRMG       ++  GE+WE EGL
Sbjct  648  TRESIEEFLDEVDVVGGVSTKGEYWTSYFSAHQMSSCRMGATEEEGALDENGESWEAEGL  707

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+ D SV P+A+GVNPM+T+Q+ AYC A  ++  L
Sbjct  708  FVCDGSVLPSAVGVNPMITIQSTAYCIATRIVNSL  742



>ref|XP_008382898.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2 
[Malus domestica]
Length=674

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 99/163 (61%), Gaps = 8/163 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       I Y + + DK +L+ GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  513  RDRGSGAVKREGRIHYTLDQLDKENLQVGLRQTLRILIAAGAVEVGTYRNDGQRIKCKGV  572

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              ++++ F++        S+R+   L T   SAHQMGSCRMG       V+  GE+WE +
Sbjct  573  EEEDLEVFLDTVVAAAGPSARE--ELWTTYSSAHQMGSCRMGATEEEGGVDENGESWEAK  630

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  221
            GLF+ D S+ PTA+GVNPM+T+++ AYC ++ + + L+   ++
Sbjct  631  GLFVCDGSLLPTAVGVNPMITIESTAYCISKRIAQSLEKQKYI  673



>ref|XP_008364320.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=743

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 98/157 (62%), Gaps = 8/157 (5%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD +SG       + Y + + DK +L  GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  586  RDXSSGVVKREGRVHYTLDQLDKENLLAGLRQALRILIAAGAVEVGTYRNDGQRIKCKGV  645

Query  511  SRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
              ++++EF++        S+R+   L T+  SAHQMGSCRMG       V+  GE+WE +
Sbjct  646  KEEDLEEFLDTVVTSAGPSARE--ELWTIYSSAHQMGSCRMGATEEEGGVDENGESWEAK  703

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            GLF+ D+S+ PTA+GVNPM+T+++ AYC ++ + + L
Sbjct  704  GLFVCDASLLPTAVGVNPMITIESTAYCISKKIAQSL  740



>ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
Length=748

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      ++Y   K D+ +L+ GL + LR+  AAGA E+GT    G+ +K +G 
Sbjct  588  RDIGSGEVMKESEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQRMKCEGI  647

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +++ ++EF+++  +       G   T   SAHQMGSCRMG       ++ +GE+WE EGL
Sbjct  648  TKEAMEEFLDEVDAVGGVSTKGEYWTTYFSAHQMGSCRMGATAEEGALDEIGESWEAEGL  707

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            F+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L++
Sbjct  708  FVCDGSVLPSAVGVNPMITIQSTAYCISSKIVDSLQS  744



>gb|ACN27562.1| unknown [Zea mays]
 gb|AFW63032.1| oxidoreductase [Zea mays]
Length=768

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       ++Y++  TD+ ++++G+ + LR+LAAAGA EIGT    G+     GA
Sbjct  605  RDRGSGTVHGERRVAYHLDATDRENMRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGA  664

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +   ++EF++        +      TL  +AHQMGSCRMG   R   V+  GE+WE   L
Sbjct  665  TEAALEEFLDGVDVVRGPQSKAEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSL  724

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P A+GVNPMVT+Q++AYC A  + + L+
Sbjct  725  YVCDGSVLPGAVGVNPMVTIQSVAYCLATGIAESLR  760



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       + Y     D+ +L+ GL + LRIL AAGA E+GT    G+ +K KG 
Sbjct  600  RDRGSGTVEGEGRVKYRFDALDRENLREGLRRALRILVAAGAVEVGTHRSDGQRMKCKGI  659

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
               +++EF++  S+         L TL  SAHQ+GSCR+G       V+  GE+WE +GL
Sbjct  660  EEKDLEEFLDGISAVGGPMSRRELWTLHASAHQIGSCRIGASEEEGGVDESGESWEAQGL  719

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D+SV P+A+G+NPM+T+Q++AYC ++ + + LK
Sbjct  720  FVCDASVLPSAVGINPMITIQSVAYCLSKGIAESLK  755



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 98/151 (65%), Gaps = 4/151 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            +D+ SGE      ++Y    TD+ +L+ GL + LR+L AAGA E+GT    G+ LK KG 
Sbjct  591  KDRGSGEVHMGGRVTYKFDATDRENLRAGLRRSLRVLVAAGAVEVGTHRSDGQKLKCKGV  650

Query  511  SRDEIDEFVEKESSRDL----GNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            S++E++EF++   S       G+   +  +AHQMGSC+MG + +   V+  GE+WE EGL
Sbjct  651  SKEELEEFLDTVFSVGGPLFGGDKWMVHTTAHQMGSCKMGRNEKDGGVDENGESWEAEGL  710

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSV  251
            ++ D+SV PTA+GVNPM+TV + AYC ++ +
Sbjct  711  YVCDASVLPTAIGVNPMITVMSTAYCLSKRI  741



>ref|NP_001148058.1| oxidoreductase [Zea mays]
 gb|ACG29606.1| oxidoreductase [Zea mays]
Length=768

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SG       ++Y++  TD+ ++++G+ + LR+LAAAGA EIGT    G+     GA
Sbjct  605  RDRGSGTVQGERRVAYHLDATDRENMRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGA  664

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +   ++EF++        +      TL  +AHQMGSCRMG   R   V+  GE+WE   L
Sbjct  665  TEAALEEFLDGVDVVRGPQSKAEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSL  724

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P A+GVNPMVT+Q++AYC A  + + L+
Sbjct  725  YVCDGSVLPGAVGVNPMVTIQSVAYCFATDIAESLR  760



>ref|XP_006283182.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
 gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
Length=754

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 98/161 (61%), Gaps = 4/161 (2%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      I+Y   K D+ +L+ GL + LR+L AAGA E+GT    G+ +K +G 
Sbjct  594  RDIGSGEVMKENEITYRTTKKDRENLRAGLRQALRVLIAAGAAEVGTYRSDGQRIKCEGT  653

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            SR+ I+EF+++  +       G   T   SAHQM SCRMG       ++  GE++E EGL
Sbjct  654  SREAIEEFLDEVDAVGGVSTKGEYWTTYFSAHQMSSCRMGATAEEGALDENGESFEAEGL  713

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  221
            F+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L++ + +
Sbjct  714  FVCDGSVLPSAVGVNPMITIQSTAYCISTRIVDSLQSKDKV  754



>ref|XP_010532672.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=746

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   I Y + KTDK ++  GL + LRIL +AGA E+GT    G+ LK KG 
Sbjct  586  RDRRSGEVMAEGRIRYTLDKTDKENIVAGLRQSLRILISAGAVEVGTHRSDGQRLKCKGI  645

Query  511  SRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
              + I+ F++  ++ D          +  SAHQMGSCR+G +     ++  GE+WE +GL
Sbjct  646  DEETIEAFLDTVTAEDGPGSYAEKWAVYASAHQMGSCRIGENEEKGALDLNGESWEAKGL  705

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            F+ D S  P+ALGVNPM+T+ A +YC +  ++K LK
Sbjct  706  FVCDGSALPSALGVNPMITIMATSYCISTGIVKSLK  741



>ref|XP_002464496.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
 gb|EER91494.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
Length=732

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 91/157 (58%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y   + D   L+NGL + LRIL AAGA E+GT    G  L+  G 
Sbjct  570  RDRGAGHVDGEGRVRYAPSREDVEELRNGLRQALRILVAAGAAEVGTHRSDGLRLRCDGG  629

Query  511  SRDEIDEFVEKESSRDLGNL------STLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
             RDE  E   KE +   G +        L  SAHQMGSCRMG  P+   V+  GE+WE E
Sbjct  630  LRDEDLEAFLKEVTVGEGPMLPGPDKWALHCSAHQMGSCRMGCSPKDGAVDGRGESWEAE  689

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            GL++ D SV PTA+GVNPM+T+Q+ AYC ++ + + L
Sbjct  690  GLYVCDGSVLPTAVGVNPMITIQSTAYCVSKGIAESL  726



>ref|XP_009136067.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Brassica rapa]
Length=740

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   ISY + K D+ ++  GL + LRIL AAGAEE+GT    G+ L  KG 
Sbjct  583  RDRGSGEVRTEGRISYVVDKIDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGV  642

Query  511  SRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
                I+EF++    +E  + +    ++  SAHQMGSCR+GVD     ++  GE+WE + L
Sbjct  643  DEKLIEEFLDSVSAEEGPKAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLDGESWEADKL  702

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  245
            F+ D SV P+A+GVNPM+T+ + AYC +  ++K
Sbjct  703  FVCDGSVLPSAVGVNPMITIMSTAYCISTRIVK  735



>ref|XP_012085273.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Jatropha curcas]
Length=735

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ SGE  +   I +   + DK +LK GL + LRIL  AGA E+GT    G+ +  KG 
Sbjct  580  RDQGSGEVKAEGRIKHWQNQFDKENLKIGLRQALRILVGAGAVEVGTYRSDGQKIACKGI  639

Query  511  SRDEIDEFVEKESSRDLGNLS---TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLF  341
               ++++F++  +   L +     TL+ SAHQMGSCRMG   +   V+  GE+WE + LF
Sbjct  640  QDKDLEDFLDTVTVSGLTSKEEHWTLLFSAHQMGSCRMGATEKEGAVDENGESWEAKDLF  699

Query  340  LADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            + D SV PTA+GVNPM+T+Q+ AYC ++ +++ LK
Sbjct  700  VCDGSVLPTAIGVNPMITIQSTAYCISRKIVESLK  734



>emb|CDY51703.1| BnaA03g58930D [Brassica napus]
Length=737

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 93/155 (60%), Gaps = 4/155 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SGE      ++Y   K D+ +L+ GL + LR+L AAGA E+GT    G+ +K +G 
Sbjct  578  RDYGSGEVLKENEVTYRTSKKDRENLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGI  637

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            +R+ ++EF++   +       G   T   SAHQM SCRMG       V+  GE+WE EGL
Sbjct  638  TREAMEEFLDGVDAVGGVSTKGEYWTTYFSAHQMCSCRMGRTAEEGAVDEKGESWEAEGL  697

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            F+ D SV PTA+GVNPM+T+Q+ AYC +  ++  L
Sbjct  698  FVCDGSVLPTAVGVNPMITIQSTAYCISTRIVASL  732



>ref|XP_011462285.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462286.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=697

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 99/158 (63%), Gaps = 4/158 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   +    SY +  +DK ++K G+ + LRIL AAGA E+GT    G  LK +G 
Sbjct  529  RDKGSGVIRTEGRASYELDVSDKENMKAGMRQALRILIAAGAVEVGTHRSDGLRLKCEGI  588

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             ++ ++EF++K    E  + L    T   SAHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  589  DKEGLEEFLDKVSAEEGPQSLVEKWTPYSSAHQMGSCRMGINEKEGAVDQNGESWEAEGL  648

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            F+ D SV P+A+GVNPM+T+++ AY  ++ + + L+  
Sbjct  649  FVCDGSVLPSAVGVNPMITIESTAYYLSKRLAESLRNQ  686



>ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=765

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 99/158 (63%), Gaps = 4/158 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RDK SG   +    SY +  +DK ++K G+ + LRIL AAGA E+GT    G  LK +G 
Sbjct  597  RDKGSGVIRTEGRASYELDVSDKENMKAGMRQALRILIAAGAVEVGTHRSDGLRLKCEGI  656

Query  511  SRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
             ++ ++EF++K    E  + L    T   SAHQMGSCRMG++ +   V+  GE+WE EGL
Sbjct  657  DKEGLEEFLDKVSAEEGPQSLVEKWTPYSSAHQMGSCRMGINEKEGAVDQNGESWEAEGL  716

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  230
            F+ D SV P+A+GVNPM+T+++ AY  ++ + + L+  
Sbjct  717  FVCDGSVLPSAVGVNPMITIESTAYYLSKRLAESLRNQ  754



>dbj|BAK02336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 95/156 (61%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG       I+Y++   D+ + + GL + LRIL AAGA E+GT    G+ L+ KGA
Sbjct  596  RDHGSGTVHGERRIAYHLDPVDRENQREGLRRALRILVAAGATEVGTHRSDGQKLRCKGA  655

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            + +E++EF++  S     +      +L  +AHQMGSCRM        V+  GE+WEVE L
Sbjct  656  TDEEVEEFLDGVSGVRGPQSKSEKWSLCCTAHQMGSCRMAATAGDGAVDTRGESWEVERL  715

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P A+GVNPM+T+Q++AYC A  + + L+
Sbjct  716  YVCDGSVLPGAVGVNPMITIQSVAYCLATGIAEQLR  751



>dbj|BAK00483.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=594

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD  SG       I+Y++   D+ + + GL + LRIL AAGA E+G     G+ L+ KGA
Sbjct  431  RDHGSGTVHGERRIAYHLDPVDRENQREGLRRALRILVAAGATEVGIHRSDGQKLRCKGA  490

Query  511  SRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  344
            + +E++EF++  S     +      +L  +AHQMGSCRM        V+  GE+WEVE L
Sbjct  491  TDEEVEEFLDGVSGVRGPQSKSEKWSLCCTAHQMGSCRMAATAGDGAVDTRGESWEVERL  550

Query  343  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  236
            ++ D SV P A+GVNPM+T+Q++AYC A  + + L+
Sbjct  551  YVCDGSVLPGAVGVNPMITIQSVAYCLATGIAEQLR  586



>gb|EAY78905.1| hypothetical protein OsI_34008 [Oryza sativa Indica Group]
Length=564

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 94/158 (59%), Gaps = 5/158 (3%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + +   + D   L+ GL + LRIL AAGA E+GT    G  L+ KGA
Sbjct  386  RDRAAGTVGGEGRVRFTPSRGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLRCKGA  445

Query  511  SRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  347
              ++++ F     VEK       +   L+ SAHQMGSCRMG   +   V+  GE+WE EG
Sbjct  446  RDEDVEAFLDEVSVEKGPMHPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEG  505

Query  346  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  233
            L++ D S+ PTA+GVNPM+T++++AYC A+ + + L +
Sbjct  506  LYVCDGSLLPTAVGVNPMITIESVAYCVAKGIAESLAS  543



>ref|XP_002464495.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
 gb|EER91493.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
Length=774

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 92/157 (59%), Gaps = 6/157 (4%)
 Frame = -2

Query  691  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  512
            RD+ +G       + Y   + D   L+NGL + LRIL AAGA E+GT    G  L+  G 
Sbjct  610  RDRGAGTVDGEGRVRYTPNRADAEELRNGLRRALRILVAAGAAEVGTHRSDGFGLRCNGG  669

Query  511  SRDE-----IDEFVEKESSRDLG-NLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  350
             RD+     +DE    E     G +   L  SAHQMGSCRMG  P+   V+  GE+WE E
Sbjct  670  VRDDELEAFLDEVTVAEGPMRPGPDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAE  729

Query  349  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  239
            GL++ D S+ PTA+GVNPM+T+Q+IA+C ++ + + L
Sbjct  730  GLYVCDGSLLPTAVGVNPMITIQSIAFCLSKGIAETL  766



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1183832463410