BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5485

Length=862
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774266.1|  PREDICTED: actin-related protein 4-like            357   1e-120   Nicotiana sylvestris
ref|XP_009612118.1|  PREDICTED: actin-related protein 4 isoform X1      358   4e-118   Nicotiana tomentosiformis
ref|XP_011097012.1|  PREDICTED: actin-related protein 4 isoform X1      356   2e-117   Sesamum indicum [beniseed]
emb|CDP10197.1|  unnamed protein product                                356   2e-117   Coffea canephora [robusta coffee]
ref|XP_006362361.1|  PREDICTED: actin-related protein 4-like            356   2e-117   Solanum tuberosum [potatoes]
ref|XP_009778472.1|  PREDICTED: actin-related protein 4-like            348   5e-117   Nicotiana sylvestris
ref|XP_004252241.1|  PREDICTED: actin-related protein 4                 354   1e-116   Solanum lycopersicum
ref|XP_008453382.1|  PREDICTED: actin-related protein 4                 353   4e-116   Cucumis melo [Oriental melon]
ref|XP_003521054.1|  PREDICTED: actin-related protein 4-like            353   7e-116   Glycine max [soybeans]
ref|XP_004138236.1|  PREDICTED: actin-related protein 4                 352   1e-115   Cucumis sativus [cucumbers]
ref|XP_012092989.1|  PREDICTED: actin-related protein 4-like            352   2e-115   Jatropha curcas
ref|XP_004515315.1|  PREDICTED: actin-related protein 4-like isof...    352   2e-115   Cicer arietinum [garbanzo]
ref|XP_004515316.1|  PREDICTED: actin-related protein 4-like isof...    351   2e-115   Cicer arietinum [garbanzo]
ref|XP_006440935.1|  hypothetical protein CICLE_v100208362mg            340   1e-114   
ref|XP_010677969.1|  PREDICTED: actin-related protein 4                 349   2e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007134394.1|  hypothetical protein PHAVU_010G044300g             349   2e-114   Phaseolus vulgaris [French bean]
ref|XP_003529017.1|  PREDICTED: actin-related protein 4-like            348   3e-114   Glycine max [soybeans]
ref|XP_002317939.1|  Actin-related family protein                       348   5e-114   
gb|EYU44127.1|  hypothetical protein MIMGU_mgv1a006688mg                347   8e-114   Erythranthe guttata [common monkey flower]
ref|XP_011014466.1|  PREDICTED: actin-related protein 4-like            347   1e-113   Populus euphratica
emb|CBI15426.3|  unnamed protein product                                346   4e-113   Vitis vinifera
ref|XP_007014880.1|  Actin-related protein 4 isoform 1                  345   4e-113   
gb|KJB83476.1|  hypothetical protein B456_013G249800                    344   5e-113   Gossypium raimondii
ref|XP_011013156.1|  PREDICTED: actin-related protein 4-like isof...    342   5e-113   Populus euphratica
ref|XP_011013154.1|  PREDICTED: actin-related protein 4-like isof...    342   5e-113   Populus euphratica
ref|XP_002275561.2|  PREDICTED: actin-related protein 4                 345   9e-113   Vitis vinifera
gb|KJB83474.1|  hypothetical protein B456_013G249800                    344   2e-112   Gossypium raimondii
gb|KEH28123.1|  actin-related protein ARP4                              343   2e-112   Medicago truncatula
ref|XP_006485767.1|  PREDICTED: actin-related protein 4-like            343   4e-112   Citrus sinensis [apfelsine]
ref|XP_003615307.1|  Actin-related protein                              343   5e-112   
gb|KDO64534.1|  hypothetical protein CISIN_1g0374702mg                  342   5e-112   Citrus sinensis [apfelsine]
gb|AES98265.2|  actin-related protein ARP4                              343   5e-112   Medicago truncatula
ref|XP_006374349.1|  Actin-related family protein                       340   6e-112   
ref|XP_003615306.1|  Actin-related protein                              343   6e-112   
ref|XP_011013153.1|  PREDICTED: actin-related protein 4-like isof...    341   7e-112   Populus euphratica
ref|XP_011013152.1|  PREDICTED: actin-related protein 4-like isof...    341   1e-111   Populus euphratica
ref|XP_007212269.1|  hypothetical protein PRUPE_ppa006685mg             340   1e-111   
ref|XP_009339362.1|  PREDICTED: actin-related protein 4-like            342   1e-111   Pyrus x bretschneideri [bai li]
gb|ACJ85813.1|  unknown                                                 341   3e-111   Medicago truncatula
ref|XP_009344621.1|  PREDICTED: actin-related protein 4-like            340   4e-111   Pyrus x bretschneideri [bai li]
ref|XP_002511960.1|  protein binding protein, putative                  340   6e-111   Ricinus communis
ref|XP_008368454.1|  PREDICTED: actin-related protein 4                 340   1e-110   
gb|KJB83478.1|  hypothetical protein B456_013G249800                    339   1e-110   Gossypium raimondii
gb|KCW83833.1|  hypothetical protein EUGRSUZ_B007042                    334   3e-110   Eucalyptus grandis [rose gum]
ref|XP_008226362.1|  PREDICTED: actin-related protein 4                 338   4e-110   Prunus mume [ume]
ref|XP_010031801.1|  PREDICTED: actin-related protein 4                 335   9e-109   Eucalyptus grandis [rose gum]
gb|ACU18101.1|  unknown                                                 331   1e-108   Glycine max [soybeans]
ref|XP_008811208.1|  PREDICTED: actin-related protein 4                 333   3e-108   Phoenix dactylifera
ref|XP_010260462.1|  PREDICTED: actin-related protein 4                 333   5e-108   Nelumbo nucifera [Indian lotus]
ref|XP_003530654.1|  PREDICTED: actin-related protein 4 isoform X1      331   2e-107   Glycine max [soybeans]
ref|XP_010940353.1|  PREDICTED: actin-related protein 4                 328   2e-106   Elaeis guineensis
ref|XP_010094708.1|  hypothetical protein L484_003016                   326   5e-106   
ref|XP_010539996.1|  PREDICTED: actin-related protein 4                 327   1e-105   Tarenaya hassleriana [spider flower]
ref|XP_004294179.1|  PREDICTED: actin-related protein 4-like            326   2e-105   Fragaria vesca subsp. vesca
ref|XP_006390493.1|  hypothetical protein EUTSA_v10018569mg             324   1e-104   Eutrema salsugineum [saltwater cress]
gb|EPS72646.1|  hypothetical protein M569_02110                         323   1e-104   Genlisea aurea
ref|XP_006837032.1|  PREDICTED: actin-related protein 4                 322   5e-104   Amborella trichopoda
ref|NP_564051.1|  actin-related protein 4                               322   5e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AAM53244.1|AF507912_1  actin-related protein 4                       322   5e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011628816.1|  PREDICTED: actin-related protein 4                 322   9e-104   Amborella trichopoda
ref|XP_010477023.1|  PREDICTED: actin-related protein 4                 321   1e-103   Camelina sativa [gold-of-pleasure]
gb|AAM65324.1|  unknown                                                 321   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416603.1|  hypothetical protein EUTSA_v10007641mg             321   2e-103   Eutrema salsugineum [saltwater cress]
ref|XP_002890276.1|  hypothetical protein ARALYDRAFT_472063             321   2e-103   
ref|XP_009110345.1|  PREDICTED: actin-related protein 4 isoform X2      320   3e-103   Brassica rapa
ref|XP_010428343.1|  PREDICTED: actin-related protein 4-like            320   4e-103   
emb|CDX96721.1|  BnaA08g22640D                                          320   5e-103   
ref|XP_010459462.1|  PREDICTED: actin-related protein 4-like            319   7e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010498232.1|  PREDICTED: actin-related protein 4-like            319   8e-103   Camelina sativa [gold-of-pleasure]
gb|KFK44003.1|  hypothetical protein AALP_AA1G202200                    319   1e-102   Arabis alpina [alpine rockcress]
ref|XP_006307538.1|  hypothetical protein CARUB_v10009163mg             318   1e-102   Capsella rubella
gb|KHG07777.1|  Actin-related 4 -like protein                           318   2e-102   Gossypium arboreum [tree cotton]
emb|CDY26159.1|  BnaA06g12580D                                          318   3e-102   Brassica napus [oilseed rape]
gb|AAW81736.1|  Putative Acttin-related protein 4 (ARP4)                318   3e-102   Brassica oleracea
gb|KFK41829.1|  hypothetical protein AALP_AA2G176800                    317   4e-102   Arabis alpina [alpine rockcress]
emb|CDX83847.1|  BnaC08g17980D                                          317   5e-102   
ref|XP_009110344.1|  PREDICTED: actin-related protein 4 isoform X1      315   2e-101   Brassica rapa
emb|CDY19213.1|  BnaC05g14140D                                          315   5e-101   Brassica napus [oilseed rape]
ref|XP_009413467.1|  PREDICTED: actin-related protein 4                 314   5e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009149328.1|  PREDICTED: actin-related protein 4-like            312   8e-100   Brassica rapa
gb|AAF25998.1|AC013354_17  F15H18.8                                     321   8e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KEH19612.1|  actin-related protein ARP4                              310   3e-99    Medicago truncatula
ref|XP_004304616.1|  PREDICTED: actin-related protein 4-like            306   6e-98    Fragaria vesca subsp. vesca
ref|XP_002982148.1|  hypothetical protein SELMODRAFT_268538             302   2e-96    Selaginella moellendorffii
ref|XP_002966143.1|  hypothetical protein SELMODRAFT_266988             302   2e-96    Selaginella moellendorffii
ref|XP_004986029.1|  PREDICTED: actin-related protein 4-like            302   3e-96    Setaria italica
ref|XP_002466003.1|  hypothetical protein SORBIDRAFT_01g049880          298   9e-95    Sorghum bicolor [broomcorn]
ref|XP_001764145.1|  actin-related protein Arp4                         297   3e-94    
ref|XP_008672855.1|  PREDICTED: uncharacterized protein LOC100279...    296   8e-94    
gb|ACG40489.1|  actin-like protein 6A                                   296   9e-94    Zea mays [maize]
ref|XP_001778436.1|  actin-related protein ARP4                         292   5e-92    
ref|XP_003559002.1|  PREDICTED: actin-related protein 4                 280   2e-87    Brachypodium distachyon [annual false brome]
ref|XP_009376700.1|  PREDICTED: actin-related protein 4-like            267   2e-86    Pyrus x bretschneideri [bai li]
ref|XP_006659807.1|  PREDICTED: actin-related protein 4-like            275   2e-85    Oryza brachyantha
dbj|BAK04027.1|  predicted protein                                      273   8e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001060954.1|  Os08g0137200                                       272   1e-84    
ref|NP_001146189.1|  uncharacterized protein LOC100279759               265   2e-84    
gb|KHN12240.1|  Actin-related protein 4                                 258   1e-82    Glycine soja [wild soybean]
ref|XP_004510131.1|  PREDICTED: actin-related protein 4-like            262   5e-82    
gb|KJB83475.1|  hypothetical protein B456_013G249800                    263   2e-81    Gossypium raimondii
gb|AES98264.2|  actin-related protein ARP4                              239   8e-72    Medicago truncatula
ref|XP_007014881.1|  Actin-related protein 4 isoform 2                  229   4e-69    
gb|EEE68011.1|  hypothetical protein OsJ_25972                          224   4e-66    Oryza sativa Japonica Group [Japonica rice]
gb|EMT14913.1|  Actin-related protein 4                                 223   6e-65    
gb|ABK26087.1|  unknown                                                 208   8e-64    Picea sitchensis
ref|XP_008359367.1|  PREDICTED: actin-related protein 4-like            195   7e-59    
ref|XP_002504876.1|  actin superfamily                                  205   8e-59    Micromonas commoda
gb|ERN20528.1|  hypothetical protein AMTR_s00068p00197380               195   1e-58    Amborella trichopoda
ref|XP_005848140.1|  hypothetical protein CHLNCDRAFT_145478             199   2e-58    Chlorella variabilis
ref|XP_003060727.1|  actin superfamily                                  199   3e-56    Micromonas pusilla CCMP1545
ref|XP_005651985.1|  putative Acttin-related protein 4                  188   1e-52    Coccomyxa subellipsoidea C-169
ref|XP_001417251.1|  predicted protein                                  184   5e-51    Ostreococcus lucimarinus CCE9901
ref|XP_011398010.1|  Actin-related protein 4                            182   7e-50    Auxenochlorella protothecoides
gb|EMT08634.1|  Actin-related protein 4                                 180   1e-49    
ref|XP_003078795.1|  Actin-related protein Arp2/3 complex, subuni...    179   3e-49    Ostreococcus tauri
gb|KIZ06770.1|  Actin-related protein 4                                 172   3e-48    Monoraphidium neglectum
ref|XP_007512384.1|  unknown                                            177   4e-48    Bathycoccus prasinos
gb|EMS61463.1|  hypothetical protein TRIUR3_27205                       181   4e-48    Triticum urartu
gb|KEH17932.1|  actin-related protein ARP4                              170   5e-47    Medicago truncatula
gb|EFX88198.1|  hypothetical protein DAPPUDRAFT_192057                  167   1e-44    Daphnia pulex
ref|XP_006803379.1|  PREDICTED: actin-like protein 6A-like              161   2e-44    Neolamprologus brichardi [lyretail cichlid]
ref|XP_001696669.1|  actin-related protein                              167   4e-44    Chlamydomonas reinhardtii
ref|XP_011065381.1|  PREDICTED: actin-like protein 6B                   166   6e-44    Acromyrmex echinatior
ref|XP_012058580.1|  PREDICTED: actin-like protein 6B                   166   6e-44    Atta cephalotes
ref|XP_011329793.1|  PREDICTED: actin-like protein 6B                   166   6e-44    Ooceraea biroi
ref|XP_007236717.1|  PREDICTED: actin-like protein 6A                   162   8e-44    
dbj|BAK63837.1|  actin-like 6A isoform 2                                159   8e-44    Pan troglodytes
gb|KFM67516.1|  Actin-like protein 6A                                   165   8e-44    Stegodyphus mimosarum
ref|XP_008209454.1|  PREDICTED: actin-like protein 6B                   165   8e-44    Nasonia vitripennis
ref|XP_011640286.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...    165   8e-44    
ref|XP_011875237.1|  PREDICTED: actin-like protein 6B                   165   1e-43    Vollenhovia emeryi
ref|XP_001607305.1|  PREDICTED: actin-like protein 6B                   165   1e-43    
gb|EAW78398.1|  actin-like 6A, isoform CRA_b                            159   2e-43    Homo sapiens [man]
ref|XP_011143432.1|  PREDICTED: actin-like protein 6B                   164   2e-43    Harpegnathos saltator
gb|KFZ49160.1|  Actin-like 6A                                           159   2e-43    Podiceps cristatus
ref|XP_625202.1|  PREDICTED: brahma associated protein 55kd             164   2e-43    
ref|XP_003702788.2|  PREDICTED: actin-like protein 6B                   164   3e-43    Megachile rotundata
ref|XP_006618378.1|  PREDICTED: actin-like protein 6B-like              164   3e-43    Apis dorsata [rock honeybee]
ref|XP_011266307.1|  PREDICTED: actin-like protein 6B                   164   3e-43    Camponotus floridanus
ref|XP_003400531.1|  PREDICTED: actin-like protein 6A-like isoform 1    164   3e-43    Bombus terrestris [large earth bumblebee]
gb|ELU05751.1|  hypothetical protein CAPTEDRAFT_156089                  163   4e-43    Capitella teleta
ref|NP_001106400.1|  uncharacterized protein LOC100127559               163   4e-43    Xenopus tropicalis [western clawed frog]
ref|XP_007552869.1|  PREDICTED: actin-like protein 6A                   161   4e-43    
ref|XP_003484999.1|  PREDICTED: actin-like protein 6A-like isoform 1    163   5e-43    Bombus impatiens
ref|XP_006627413.1|  PREDICTED: actin-like protein 6B-like              163   5e-43    Lepisosteus oculatus
ref|XP_005746795.1|  PREDICTED: actin-like protein 6A-like isofor...    161   6e-43    Pundamilia nyererei
gb|AAH45889.1|  Actin-like 6A                                           162   7e-43    Danio rerio [leopard danio]
ref|XP_011699800.1|  PREDICTED: actin-like protein 6B                   163   7e-43    Wasmannia auropunctata
ref|XP_001521333.1|  PREDICTED: actin-like protein 6A                   159   8e-43    
gb|EDL19263.1|  actin-like 6B, isoform CRA_b                            159   9e-43    Mus musculus [mouse]
ref|XP_002428884.1|  conserved hypothetical protein                     162   9e-43    Pediculus humanus corporis [human body lice]
ref|XP_011172797.1|  PREDICTED: actin-like protein 6B                   162   9e-43    Solenopsis invicta [imported red fire ant]
ref|NP_775347.1|  actin-like protein 6A                                 162   1e-42    Danio rerio [leopard danio]
ref|XP_010869611.1|  PREDICTED: actin-like protein 6A isoform X2        162   1e-42    Esox lucius
gb|AAQ94585.1|  BAF53                                                   162   1e-42    Danio rerio [leopard danio]
ref|XP_010869610.1|  PREDICTED: actin-like protein 6A isoform X1        162   1e-42    Esox lucius
ref|XP_004032474.1|  hypothetical protein IMG5_121850                   161   1e-42    Ichthyophthirius multifiliis
ref|XP_006810270.1|  PREDICTED: actin-like protein 6A-like              162   2e-42    Neolamprologus brichardi [lyretail cichlid]
ref|XP_008328111.1|  PREDICTED: actin-like protein 6A                   162   2e-42    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005991979.1|  PREDICTED: actin-like protein 6A                   162   2e-42    Latimeria chalumnae
ref|XP_008291929.1|  PREDICTED: actin-like protein 6A isoform X2        161   2e-42    Stegastes partitus
ref|XP_008291928.1|  PREDICTED: actin-like protein 6A isoform X1        162   2e-42    Stegastes partitus
ref|XP_005800552.1|  PREDICTED: actin-like protein 6A-like              161   2e-42    Xiphophorus maculatus
ref|XP_011503708.1|  PREDICTED: actin-like protein 6B                   161   2e-42    Ceratosolen solmsi marchali
ref|XP_005165974.1|  PREDICTED: actin-like protein 6A isoform X1        162   2e-42    Danio rerio [leopard danio]
ref|XP_008406236.1|  PREDICTED: actin-like protein 6A                   161   2e-42    Poecilia reticulata
ref|XP_008550900.1|  PREDICTED: actin-like protein 6B                   162   2e-42    Microplitis demolitor
ref|XP_004570293.1|  PREDICTED: actin-like protein 6A-like isofor...    161   3e-42    Maylandia zebra
ref|XP_005931067.1|  PREDICTED: actin-like protein 6A-like isofor...    161   3e-42    
ref|XP_006029648.1|  PREDICTED: actin-like protein 6B-like              161   3e-42    
ref|XP_004570292.1|  PREDICTED: actin-like protein 6A-like isofor...    161   3e-42    
gb|KFO63835.1|  Actin-like 6B                                           159   3e-42    Corvus brachyrhynchos
ref|XP_008525567.1|  PREDICTED: actin-like protein 6B isoform X3        159   3e-42    Equus przewalskii [Przewalski horse]
ref|XP_004067770.1|  PREDICTED: actin-like protein 6A                   161   3e-42    Oryzias latipes [Japanese rice fish]
ref|XP_003439834.1|  PREDICTED: actin-like protein 6A-like isoform 1    161   3e-42    Oreochromis niloticus
ref|XP_006262955.1|  PREDICTED: actin-like protein 6B-like              161   3e-42    
ref|XP_002817818.2|  PREDICTED: actin-like protein 6B                   159   3e-42    
ref|XP_009682183.1|  PREDICTED: actin-like protein 6A isoform X2        160   4e-42    Struthio camelus australis
gb|KFP26311.1|  Actin-like 6A                                           159   4e-42    Colius striatus
gb|KFO54818.1|  Actin-like 6A                                           159   4e-42    Corvus brachyrhynchos
ref|XP_007518209.1|  PREDICTED: actin-like protein 6A isoform X2        159   4e-42    Erinaceus europaeus [common hedgehog]
ref|XP_006232315.1|  PREDICTED: actin-like protein 6A isoform X1        159   4e-42    Rattus norvegicus [brown rat]
ref|XP_004647348.1|  PREDICTED: actin-like protein 6A isoform X2        159   4e-42    
ref|XP_006535566.1|  PREDICTED: actin-like protein 6A isoform X1        159   4e-42    Mus musculus [mouse]
ref|XP_008047151.1|  PREDICTED: actin-like protein 6B                   159   4e-42    Carlito syrichta
gb|KFQ32022.1|  Actin-like 6A                                           159   4e-42    Merops nubicus
gb|KGL88205.1|  Actin-like 6A                                           159   4e-42    Charadrius vociferus
gb|KFV01543.1|  Actin-like 6A                                           159   4e-42    Pterocles gutturalis
ref|XP_006132714.1|  PREDICTED: actin-like protein 6B                   160   4e-42    
gb|KGL76983.1|  Actin-like 6A                                           159   4e-42    Tinamus guttatus
gb|KFP19413.1|  Actin-like 6A                                           159   4e-42    Egretta garzetta
gb|KFV20323.1|  Actin-like 6A                                           159   4e-42    Tauraco erythrolophus
gb|KFQ28004.1|  Actin-like 6A                                           159   4e-42    Mesitornis unicolor
gb|KFP77679.1|  Actin-like 6A                                           159   4e-42    Apaloderma vittatum
gb|KFQ63895.1|  Actin-like 6A                                           159   4e-42    Pelecanus crispus
ref|XP_010395639.1|  PREDICTED: actin-like protein 6A isoform X2        159   4e-42    
ref|XP_003794326.1|  PREDICTED: actin-like protein 6A isoform 2         160   4e-42    
ref|XP_007444616.1|  PREDICTED: actin-like protein 6B-like              161   4e-42    Python bivittatus
gb|KFV85942.1|  Actin-like 6A                                           159   4e-42    Struthio camelus australis
gb|KFW90198.1|  Actin-like 6A                                           159   4e-42    Phalacrocorax carbo [common cormorant]
gb|KFR15061.1|  Actin-like 6A                                           159   4e-42    Opisthocomus hoazin [hoatzin]
gb|KFQ02629.1|  Actin-like 6A                                           159   4e-42    Haliaeetus albicilla
gb|KFW65518.1|  Actin-like 6A                                           159   5e-42    Pygoscelis adeliae
gb|KFV41246.1|  Actin-like 6A                                           159   5e-42    Gavia stellata
gb|KFV40481.1|  Actin-like 6A                                           159   5e-42    Tyto alba [Schleiereule]
gb|KFO13612.1|  Actin-like 6A                                           159   5e-42    Balearica regulorum gibbericeps
ref|XP_007607109.1|  PREDICTED: actin-like protein 6A isoform X2        160   5e-42    
gb|KFQ15202.1|  Actin-like 6A                                           159   5e-42    Leptosomus discolor
ref|XP_005383100.1|  PREDICTED: actin-like protein 6A isoform X3        159   5e-42    
gb|KFW06112.1|  Actin-like 6A                                           159   5e-42    Eurypyga helias
gb|KFP37110.1|  Actin-like 6A                                           159   5e-42    Chlamydotis macqueenii
ref|XP_010591075.1|  PREDICTED: actin-like protein 6A isoform X2        159   5e-42    
ref|XP_008836883.1|  PREDICTED: actin-like protein 6A isoform X2        159   5e-42    Nannospalax galili
ref|XP_001496334.3|  PREDICTED: actin-like 6A isoform X1                159   5e-42    Equus caballus [domestic horse]
ref|XP_003256549.1|  PREDICTED: actin-like protein 6A isoform 2         159   5e-42    Nomascus leucogenys [White-cheeked Gibbon]
gb|KFQ41526.1|  Actin-like 6A                                           159   5e-42    Nestor notabilis
ref|NP_817126.1|  actin-like protein 6A isoform 2                       159   5e-42    Homo sapiens [man]
ref|XP_004675047.1|  PREDICTED: actin-like protein 6A isoform X2        159   5e-42    
gb|KFP80771.1|  Actin-like 6A                                           159   5e-42    Acanthisitta chloris
gb|KFP55361.1|  Actin-like 6A                                           159   5e-42    Cariama cristata
gb|KFO83098.1|  Actin-like 6A                                           159   5e-42    Buceros rhinoceros silvestris
ref|XP_007946464.1|  PREDICTED: actin-like protein 6A isoform X2        159   5e-42    Orycteropus afer afer
ref|XP_006162791.1|  PREDICTED: actin-like protein 6A isoform X2        159   5e-42    Tupaia chinensis
gb|KFQ87125.1|  Actin-like 6A                                           159   5e-42    Phoenicopterus ruber ruber
gb|KFQ73026.1|  Actin-like 6A                                           159   5e-42    Phaethon lepturus
gb|KFM13458.1|  Actin-like 6A                                           159   5e-42    Aptenodytes forsteri
ref|XP_004901946.1|  PREDICTED: actin-like protein 6A isoform X2        159   5e-42    
ref|XP_008139639.1|  PREDICTED: actin-like protein 6B isoform X2        159   5e-42    
ref|XP_006867762.1|  PREDICTED: actin-like protein 6A isoform X2        159   5e-42    Chrysochloris asiatica
ref|XP_004424766.1|  PREDICTED: actin-like protein 6A isoform 2         159   5e-42    
gb|KFV69681.1|  Actin-like 6A                                           159   5e-42    Picoides pubescens
ref|XP_004708659.1|  PREDICTED: actin-like protein 6A isoform X2        159   6e-42    Echinops telfairi [lesser hedgehog tenrec]
gb|KFO96088.1|  Actin-like 6A                                           159   6e-42    Calypte anna
ref|XP_005670065.1|  PREDICTED: actin-like 6A isoform X3                159   6e-42    Sus scrofa [pigs]
ref|XP_009682182.1|  PREDICTED: actin-like protein 6A isoform X1        160   6e-42    Struthio camelus australis
ref|XP_010335894.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...    159   6e-42    Saimiri boliviensis boliviensis
gb|EFA84276.1|  actin-like protein 6A                                   160   6e-42    Heterostelium album PN500
ref|XP_002162686.1|  PREDICTED: actin-like protein 6A-like              160   6e-42    Hydra vulgaris
ref|XP_006884087.1|  PREDICTED: actin-like protein 6A isoform X2        159   6e-42    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|ETE60477.1|  Actin-like protein 6A                                   160   6e-42    Ophiophagus hannah
ref|XP_009286318.1|  PREDICTED: actin-like protein 6A isoform X2        159   7e-42    Aptenodytes forsteri
dbj|BAE41036.1|  unnamed protein product                                160   7e-42    Mus musculus [mouse]
ref|XP_006770085.1|  PREDICTED: actin-like protein 6A                   159   7e-42    Myotis davidii
ref|XP_007422848.1|  PREDICTED: actin-like protein 6A                   160   7e-42    Python bivittatus
ref|XP_010176442.1|  PREDICTED: actin-like protein 6A                   159   8e-42    
emb|CDQ58638.1|  unnamed protein product                                160   8e-42    Oncorhynchus mykiss
ref|XP_005051313.1|  PREDICTED: actin-like protein 6A                   159   8e-42    
ref|XP_009969016.1|  PREDICTED: actin-like protein 6A                   159   8e-42    Tyto alba [Schleiereule]
ref|XP_010202825.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...    159   8e-42    Colius striatus
ref|XP_003470003.1|  PREDICTED: actin-like protein 6B                   160   8e-42    Cavia porcellus [guinea pig]
ref|XP_001366950.1|  PREDICTED: actin-like protein 6B                   160   8e-42    Monodelphis domestica
ref|XP_005232994.1|  PREDICTED: actin-like protein 6A                   159   8e-42    
ref|XP_009955780.1|  PREDICTED: actin-like protein 6A                   159   9e-42    Leptosomus discolor
gb|EFB29344.1|  hypothetical protein PANDA_000241                       159   9e-42    Ailuropoda melanoleuca
ref|XP_007954035.1|  PREDICTED: actin-like protein 6B                   160   9e-42    Orycteropus afer afer
ref|XP_010081827.1|  PREDICTED: actin-like protein 6A                   159   9e-42    Pterocles gutturalis
ref|XP_004666364.1|  PREDICTED: actin-like protein 6B                   159   9e-42    Jaculus jaculus
ref|XP_010974551.1|  PREDICTED: actin-like protein 6A                   160   9e-42    Camelus dromedarius [camel]
ref|XP_008642714.1|  PREDICTED: actin-like protein 6A                   159   9e-42    
dbj|BAC41116.1|  unnamed protein product                                160   9e-42    Mus musculus [mouse]
gb|EHH51492.1|  hypothetical protein EGM_10871                          159   9e-42    Macaca fascicularis [crab eating macaque]
gb|EMC85724.1|  Actin-like protein 6A                                   159   1e-41    
ref|XP_010395638.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
gb|EHH52043.1|  hypothetical protein EGM_12410                          159   1e-41    Macaca fascicularis [crab eating macaque]
ref|XP_005533822.1|  PREDICTED: actin-like protein 6B-like              159   1e-41    
ref|NP_989337.1|  actin-like 6A                                         159   1e-41    Xenopus tropicalis [western clawed frog]
ref|XP_005879165.1|  PREDICTED: actin-like protein 6B                   159   1e-41    Myotis brandtii
ref|XP_005484852.1|  PREDICTED: actin-like protein 6A                   159   1e-41    Zonotrichia albicollis
dbj|BAD96932.1|  actin-like 6A isoform 1 variant                        159   1e-41    Homo sapiens [man]
ref|XP_005525127.1|  PREDICTED: actin-like protein 6A                   159   1e-41    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004691940.1|  PREDICTED: actin-like protein 6B isoform X1        159   1e-41    Condylura cristata
ref|XP_009641281.1|  PREDICTED: actin-like protein 6A                   159   1e-41    Egretta garzetta
ref|XP_009915640.1|  PREDICTED: actin-like protein 6A                   159   1e-41    Haliaeetus albicilla
ref|XP_005419077.1|  PREDICTED: actin-like protein 6A                   159   1e-41    Geospiza fortis
ref|XP_009901912.1|  PREDICTED: actin-like protein 6A                   160   1e-41    Picoides pubescens
ref|XP_005146975.1|  PREDICTED: actin-like protein 6A                   159   1e-41    Melopsittacus undulatus
ref|NP_062647.2|  actin-like protein 6A                                 159   1e-41    Mus musculus [mouse]
sp|Q4R333.1|ACL6A_MACFA  RecName: Full=Actin-like protein 6A; Alt...    159   1e-41    Macaca fascicularis [crab eating macaque]
ref|XP_010571227.1|  PREDICTED: actin-like protein 6A                   159   1e-41    Haliaeetus leucocephalus
ref|XP_004647347.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_422784.3|  PREDICTED: actin-like 6A                              159   1e-41    
ref|XP_003509127.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
gb|EDL35008.1|  actin-like 6A, isoform CRA_c                            159   1e-41    
ref|NP_057272.1|  actin-like protein 6B                                 159   1e-41    
ref|XP_006017246.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_004675046.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_005598689.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...    159   1e-41    
ref|XP_005343823.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_010143413.1|  PREDICTED: actin-like protein 6A                   160   1e-41    
ref|XP_009073785.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_006276038.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_005024768.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_005383099.1|  PREDICTED: actin-like protein 6A isoform X2        159   1e-41    
ref|XP_003467569.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_003256548.1|  PREDICTED: actin-like protein 6A isoform 1         159   1e-41    
ref|XP_010189836.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_006162790.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_008836882.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_002716488.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|NP_001034122.1|  actin-like protein 6A                              159   1e-41    
ref|XP_007518200.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_004901945.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
gb|ELR58223.1|  Actin-like protein 6B                                   159   1e-41    
ref|XP_007946463.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|NP_004292.1|  actin-like protein 6A isoform 1                       159   1e-41    
ref|XP_007466757.1|  PREDICTED: actin-like protein 6A isoform X2        159   1e-41    
ref|XP_010946115.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_006867761.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_004424765.1|  PREDICTED: actin-like protein 6A isoform 1         159   1e-41    
ref|NP_001098505.1|  actin-like protein 6A                              159   1e-41    
ref|XP_003412917.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_004617366.1|  PREDICTED: actin-like protein 6B                   159   1e-41    
ref|XP_005286018.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_005893238.1|  PREDICTED: actin-like protein 6B                   159   1e-41    
ref|XP_004705656.1|  PREDICTED: actin-like protein 6B                   159   1e-41    
ref|NP_113581.1|  actin-like protein 6B                                 159   1e-41    
ref|XP_006884086.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_008525565.1|  PREDICTED: actin-like protein 6B isoform X1        159   1e-41    
ref|XP_004708658.1|  PREDICTED: actin-like protein 6A isoform X1        159   1e-41    
ref|XP_011765983.1|  PREDICTED: actin-like protein 6B isoform X1        159   1e-41    
ref|XP_004761592.1|  PREDICTED: actin-like protein 6B isoform X1        159   1e-41    
ref|XP_004890711.1|  PREDICTED: actin-like protein 6B isoform X1        159   1e-41    
ref|XP_004398410.1|  PREDICTED: actin-like protein 6A isoform 1         159   1e-41    
ref|XP_005883069.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_004324041.1|  PREDICTED: actin-like protein 6B                   159   1e-41    
ref|XP_004382380.1|  PREDICTED: actin-like protein 6A isoform 2         159   1e-41    
ref|XP_008830563.1|  PREDICTED: actin-like protein 6B                   159   1e-41    
ref|XP_006138560.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_003132593.1|  PREDICTED: actin-like 6A isoformX1                 159   1e-41    
emb|CAB66543.1|  hypothetical protein                                   159   1e-41    
ref|XP_009998303.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_006859703.1|  PREDICTED: actin-like protein 6B                   159   1e-41    
ref|XP_008140546.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_005956232.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...    159   1e-41    
ref|XP_005506676.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
ref|XP_011912653.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...    159   1e-41    
ref|XP_003974270.1|  PREDICTED: actin-like protein 6A                   159   1e-41    
gb|AAC94992.1|  BAF53a                                                  159   2e-41    
ref|XP_007195444.1|  PREDICTED: actin-like protein 6A isoform X1        160   2e-41    
ref|XP_009938393.1|  PREDICTED: actin-like protein 6A                   159   2e-41    
ref|XP_007466756.1|  PREDICTED: actin-like protein 6A isoform X1        160   2e-41    
ref|XP_005670064.1|  PREDICTED: actin-like 6A isoform X2                159   2e-41    
ref|XP_004382379.1|  PREDICTED: actin-like protein 6A isoform 1         159   2e-41    
ref|XP_002193131.1|  PREDICTED: actin-like protein 6A                   159   2e-41    
dbj|GAM25133.1|  hypothetical protein SAMD00019534_083080               159   2e-41    
ref|XP_848224.1|  PREDICTED: actin-like 6A isoformX3                    159   2e-41    
ref|XP_008696731.1|  PREDICTED: actin-like protein 6B                   159   2e-41    
ref|XP_005383098.1|  PREDICTED: actin-like protein 6A isoform X1        159   2e-41    
ref|XP_009557618.1|  PREDICTED: actin-like protein 6A                   159   2e-41    
ref|XP_009697260.1|  PREDICTED: actin-like protein 6A                   159   2e-41    
ref|XP_008940972.1|  PREDICTED: actin-like protein 6A                   160   2e-41    
ref|XP_009578242.1|  PREDICTED: actin-like protein 6A                   159   2e-41    
ref|XP_008496136.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...    160   2e-41    
ref|XP_006084957.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...    159   2e-41    
ref|NP_001080451.1|  actin-like 6A                                      159   2e-41    
ref|XP_003218152.1|  PREDICTED: actin-like protein 6A                   159   2e-41    
ref|XP_003422558.1|  PREDICTED: actin-like protein 6B                   159   2e-41    
ref|XP_008703523.1|  PREDICTED: actin-like protein 6A isoform X1        159   2e-41    
ref|XP_006249182.1|  PREDICTED: actin-like protein 6B isoform X1        159   2e-41    
ref|XP_008922781.1|  PREDICTED: actin-like protein 6A                   159   2e-41    
ref|XP_011997093.1|  PREDICTED: actin-like protein 6B isoform X1        159   2e-41    
ref|XP_010212559.1|  PREDICTED: actin-like protein 6A                   159   2e-41    
ref|XP_009871140.1|  PREDICTED: actin-like protein 6A                   159   3e-41    
ref|XP_006637533.1|  PREDICTED: actin-like protein 6A-like              160   3e-41    
gb|EDL35009.1|  actin-like 6A, isoform CRA_d                            159   3e-41    
ref|XP_007502038.1|  PREDICTED: actin-like protein 6A                   159   3e-41    
ref|XP_008638075.1|  PREDICTED: actin-like protein 6B                   159   3e-41    
gb|EMP38394.1|  Actin-like protein 6A                                   158   3e-41    
ref|XP_007057058.1|  PREDICTED: actin-like protein 6A                   158   3e-41    
ref|XP_009471160.1|  PREDICTED: actin-like protein 6A                   159   3e-41    
ref|XP_009988590.1|  PREDICTED: actin-like protein 6A                   159   3e-41    
ref|XP_009320007.1|  PREDICTED: actin-like protein 6A                   159   4e-41    
ref|XP_006155816.1|  PREDICTED: actin-like protein 6B                   159   4e-41    
ref|XP_010124414.1|  PREDICTED: actin-like protein 6A                   159   4e-41    
ref|XP_007074080.1|  PREDICTED: actin-like protein 6B                   158   4e-41    
ref|XP_004045981.1|  PREDICTED: actin-like protein 6B                   159   5e-41    
ref|XP_009893632.1|  PREDICTED: actin-like protein 6A                   159   6e-41    
ref|XP_005170633.1|  PREDICTED: actin-like 6B isoform X1                157   7e-41    
ref|XP_009048498.1|  hypothetical protein LOTGIDRAFT_225683             157   1e-40    
ref|XP_004351728.1|  actin-like protein 6A                              157   1e-40    
ref|XP_006046528.1|  PREDICTED: actin-like protein 6B isoform X1        158   1e-40    
ref|XP_011301420.1|  PREDICTED: actin-like protein 6B                   157   1e-40    
gb|ELK25448.1|  Actin-like protein 6A                                   158   1e-40    
ref|XP_007887354.1|  PREDICTED: actin-like protein 6A isoform X2        156   2e-40    
ref|NP_001018576.1|  actin-like 6B                                      155   2e-40    
gb|ELK06925.1|  Actin-like protein 6B                                   155   2e-40    
ref|XP_011456529.1|  PREDICTED: actin-like protein 6B                   156   2e-40    
ref|XP_003766094.1|  PREDICTED: actin-like protein 6A                   158   2e-40    
ref|XP_001945563.1|  PREDICTED: actin-like protein 6B                   156   2e-40    
ref|XP_006504701.1|  PREDICTED: actin-like protein 6B isoform X3        153   2e-40    
gb|KFO74965.1|  Actin-like 6A                                           155   2e-40    
ref|NP_001279710.1|  actin-like 6A                                      156   2e-40    
ref|XP_006504702.1|  PREDICTED: actin-like protein 6B isoform X4        152   2e-40    
ref|XP_005062306.1|  PREDICTED: actin-like protein 6B-like              157   2e-40    
ref|XP_004603344.1|  PREDICTED: actin-like protein 6A                   157   3e-40    
ref|XP_011661144.1|  PREDICTED: actin-like protein 6B                   155   4e-40    
ref|XP_006504699.1|  PREDICTED: actin-like protein 6B isoform X2        153   6e-40    
ref|XP_004021057.1|  PREDICTED: actin-like protein 6B isoform X2        154   1e-39    
ref|XP_001642052.1|  predicted protein                                  154   2e-39    
ref|XP_003278148.1|  PREDICTED: actin-like protein 6B                   153   2e-39    
gb|AFK47281.1|  unknown                                                 145   2e-39    
ref|XP_006504698.1|  PREDICTED: actin-like protein 6B isoform X1        153   2e-39    
ref|XP_002590506.1|  hypothetical protein BRAFLDRAFT_59623              152   4e-39    
ref|XP_004457201.1|  PREDICTED: actin-like protein 6B isoform 3         152   4e-39    
gb|AEI29166.1|  actin-like protein                                      146   7e-39    
ref|XP_010745346.1|  PREDICTED: actin-like protein 6A                   151   9e-39    
ref|XP_002115616.1|  hypothetical protein TRIADDRAFT_29808              151   1e-38    
gb|ADZ73581.1|  actin 1                                                 145   1e-38    
gb|ACO10332.1|  Actin-like protein 6B                                   151   2e-38    
ref|XP_011097013.1|  PREDICTED: actin-related protein 4 isoform X2      149   2e-38    
gb|KFK24235.1|  hypothetical protein AALP_AAs59108U000100               145   2e-38    
gb|AAL60594.1|  actin                                                   147   2e-38    
gb|ERL94757.1|  hypothetical protein D910_12031                         149   2e-38    
gb|KIZ06802.1|  Actin                                                   149   2e-38    
ref|XP_004457200.1|  PREDICTED: actin-like protein 6B isoform 2         150   3e-38    
ref|XP_003289725.1|  hypothetical protein DICPUDRAFT_48789              150   3e-38    
ref|XP_640964.1|  actin-like protein 6A                                 150   3e-38    
dbj|BAJ78228.1|  actin                                                  147   4e-38    
ref|XP_001009983.2|  Actin family protein                               150   4e-38    
ref|XP_005838967.1|  hypothetical protein GUITHDRAFT_102601             149   6e-38    
gb|KIZ04517.1|  Actin                                                   148   7e-38    
gb|ENN76756.1|  hypothetical protein YQE_06597                          149   7e-38    
gb|AFP43695.1|  actin 3                                                 142   1e-37    
tpg|DAA51050.1|  TPA: putative actin family protein                     142   1e-37    
gb|AAK92365.1|AF363530_1  actin-3                                       144   2e-37    
gb|AAX92681.1|  actin                                                   141   2e-37    
gb|ADT65428.1|  actin                                                   141   2e-37    
emb|CDS03258.1|  hypothetical protein LRAMOSA00660                      148   3e-37    
ref|XP_002958261.1|  actin-related protein Arp4                         147   3e-37    
emb|CAM98703.1|  actin I                                                146   3e-37    
gb|ADI46834.1|  ARP4f                                                   147   3e-37    
ref|XP_005537113.1|  actin                                              146   3e-37    
emb|CAM98701.1|  actin II                                               146   3e-37    
gb|ETO11538.1|  hypothetical protein RFI_25838                          140   3e-37    
emb|CEG83635.1|  hypothetical protein RMATCC62417_17518                 143   3e-37    
gb|AFP43696.1|  actin4                                                  141   4e-37    
gb|AAF71266.1|AF246716_1  actin-like protein                            142   4e-37    
ref|XP_006350765.1|  PREDICTED: actin-like                              146   4e-37    
gb|ADE05541.1|  actin                                                   141   4e-37    
gb|AAK82991.1|AF285176_1  actin                                         146   4e-37    
ref|XP_011039962.1|  PREDICTED: actin-like isoform X2                   146   4e-37    
gb|AFD62266.1|  actin                                                   141   4e-37    
gb|ESA10096.1|  hypothetical protein GLOINDRAFT_199267                  147   4e-37    
gb|ADI46900.1|  ARP4m                                                   147   4e-37    
ref|XP_009406076.1|  PREDICTED: actin-3                                 146   4e-37    
gb|AIO05828.1|  actin                                                   141   5e-37    
ref|XP_005707521.1|  actin                                              146   5e-37    
gb|AEW46682.1|  actin                                                   146   5e-37    
ref|XP_011432967.1|  PREDICTED: actin-5-like                            145   6e-37    
ref|XP_011039960.1|  PREDICTED: actin-100-like isoform X1               146   6e-37    
ref|XP_001782687.1|  predicted protein                                  145   6e-37    
gb|AFP43694.1|  actin 2                                                 140   6e-37    
gb|AEE98359.1|  actin                                                   143   6e-37    
gb|ACJ05348.1|  actin                                                   142   7e-37    
ref|XP_001782688.1|  predicted protein                                  145   7e-37    
gb|AFY06656.1|  actin 2                                                 141   7e-37    
gb|AHZ58479.1|  actin                                                   145   7e-37    
ref|XP_001421686.1|  predicted protein                                  145   7e-37    
gb|ADW83713.1|  actin 1                                                 145   7e-37    
ref|XP_009416898.1|  PREDICTED: actin-3                                 145   8e-37    
ref|XP_009411056.1|  PREDICTED: actin-2-like                            145   8e-37    
gb|EIE87769.1|  hypothetical protein RO3G_12480                         146   8e-37    
gb|AAF40438.1|AF234528_2  actin 1                                       145   8e-37    
gb|ACJ05350.1|  actin                                                   142   8e-37    
ref|XP_006381600.1|  hypothetical protein POPTR_0006s14210g             145   8e-37    
ref|XP_004241231.1|  PREDICTED: actin-82                                145   9e-37    
ref|XP_010520110.1|  PREDICTED: actin-like                              145   1e-36    
emb|CDS35954.1|  actin 6a                                               145   1e-36    
gb|KFH73492.1|  hypothetical protein MVEG_00708                         146   1e-36    
gb|KEH39427.1|  actin-97                                                145   1e-36    
emb|CDS22741.1|  actin 6a                                               145   1e-36    
emb|CDP22042.1|  unnamed protein product                                137   1e-36    
ref|XP_008200234.1|  PREDICTED: actin-like protein 6B isoform X1        142   1e-36    
gb|ABY66084.1|  actin                                                   142   1e-36    
gb|AEI29165.1|  actin-like protein                                      138   1e-36    
gb|ACF28565.1|  actin                                                   141   1e-36    
emb|CAG08066.1|  unnamed protein product                                145   1e-36    
ref|XP_008122944.1|  PREDICTED: actin-like protein 6B                   145   1e-36    
sp|O65315.1|ACT_COLSC  RecName: Full=Actin                              145   1e-36    
sp|P24902.1|ACT_PINCO  RecName: Full=Actin                              139   1e-36    
gb|AFP43693.1|  actin 1                                                 142   1e-36    
emb|CDH60136.1|  actin-like 6a                                          146   1e-36    
gb|EMT21476.1|  Actin-1                                                 144   1e-36    
gb|AEL88913.1|  actin                                                   142   1e-36    
gb|AEL88911.1|  actin                                                   142   1e-36    
gb|ABK21898.1|  unknown                                                 141   1e-36    
sp|P30167.1|ACT3_SOLTU  RecName: Full=Actin-58                          144   1e-36    
dbj|BAN13564.1|  actin                                                  142   1e-36    
gb|ABS83240.2|  actin 7                                                 142   2e-36    
ref|XP_006345961.1|  PREDICTED: actin-58-like                           144   2e-36    
dbj|BAJ06410.1|  actin                                                  142   2e-36    
sp|P30165.1|ACT2_PEA  RecName: Full=Actin-2                             144   2e-36    
ref|XP_009389520.1|  PREDICTED: actin-100-like                          144   2e-36    
ref|XP_009417581.1|  PREDICTED: actin-2-like                            144   2e-36    
ref|XP_008788993.1|  PREDICTED: actin-101-like                          144   2e-36    
ref|XP_006348992.1|  PREDICTED: actin-58-like                           144   2e-36    
ref|XP_010937718.1|  PREDICTED: actin-3                                 144   2e-36    
gb|AAW31852.1|  actin                                                   138   2e-36    
gb|ACF32705.1|  actin                                                   140   2e-36    
ref|XP_003560589.1|  PREDICTED: actin-1                                 144   2e-36    



>ref|XP_009774266.1| PREDICTED: actin-related protein 4-like, partial [Nicotiana sylvestris]
Length=244

 Score =   357 bits (917),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESYKLYCQ+ IASDIKECVSRAPDTPYDDSSYSNIP T YELPDGQTIE+GADRF
Sbjct  50   FPDTTESYKLYCQRAIASDIKECVSRAPDTPYDDSSYSNIPTTSYELPDGQTIEVGADRF  109

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDI+FNPSLVQTIPGMESFAETA SLRGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  110  KIPDIIFNPSLVQTIPGMESFAETAASLRGLPQMVIESINKCDVDIRRELFSSILLAGGT  169

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  170  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  229

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  230  EYEEHGASYVQRKCP  244



>ref|XP_009612118.1| PREDICTED: actin-related protein 4 isoform X1 [Nicotiana tomentosiformis]
Length=435

 Score =   358 bits (919),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESYKLYCQ+ IASDIKECVSRAPDTPYDDSSYSNIP T YELPDGQTIE+GADRF
Sbjct  241  FPDTTESYKLYCQRAIASDIKECVSRAPDTPYDDSSYSNIPTTSYELPDGQTIEVGADRF  300

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDI+FNPSLVQTIPGMESFAETA SLRGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  301  KIPDIIFNPSLVQTIPGMESFAETAASLRGLPQMVIESINKCDVDIRRELFSSILLAGGT  360

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  361  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  420

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  421  EYEEHGASYVQRKCP  435



>ref|XP_011097012.1| PREDICTED: actin-related protein 4 isoform X1 [Sesamum indicum]
Length=435

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLYCQ+VI  DIKECV RAPDTPYD++SYSNIPMTPYELPDGQTIEIGADRF
Sbjct  241  FPNTTESYKLYCQRVIVGDIKECVCRAPDTPYDETSYSNIPMTPYELPDGQTIEIGADRF  300

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQTIPGMESF ETA+S RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  301  KIPDVLFNPSLVQTIPGMESFVETASSARGLPQMVIESINKCDVDIRRELFSSILLAGGT  360

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  361  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  420

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  421  EYEEHGASYIQRKCP  435



>emb|CDP10197.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLYCQ+VIASDIKECV RAPDTPYDDSSYSNIPMT YELPDGQTIEIGADRF
Sbjct  241  FPNTTESYKLYCQRVIASDIKECVCRAPDTPYDDSSYSNIPMTSYELPDGQTIEIGADRF  300

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K PDILFNPSL QTIPGME+FAETA+S+RGLPQMV+ESI++CDVDIRREL+SSILL+GGT
Sbjct  301  KAPDILFNPSLAQTIPGMENFAETASSVRGLPQMVLESINKCDVDIRRELFSSILLAGGT  360

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  361  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  420

Query  322  EYEEHGASYVQRKCP  278
            E+EEHGASYVQRKCP
Sbjct  421  EFEEHGASYVQRKCP  435



>ref|XP_006362361.1| PREDICTED: actin-related protein 4-like [Solanum tuberosum]
Length=435

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESYKLYCQ+ IASDIKECVSRAPDTPYDDSSYSNIP T YELPDGQTIE+GADRF
Sbjct  241  FPDTTESYKLYCQRAIASDIKECVSRAPDTPYDDSSYSNIPTTSYELPDGQTIEVGADRF  300

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSLVQTIPGMESFAETA SLRGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  301  KIPDILFNPSLVQTIPGMESFAETAASLRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  360

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  361  SSMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  420

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  421  EYEEHGASYVQRKCP  435



>ref|XP_009778472.1| PREDICTED: actin-related protein 4-like [Nicotiana sylvestris]
Length=252

 Score =   348 bits (894),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 188/194 (97%), Gaps = 0/194 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESYKLYCQ+ IASDIKECVSRAPDTPYDDSSYSNIP T YELPDGQTIE+GADRF
Sbjct  58   FPDTTESYKLYCQRAIASDIKECVSRAPDTPYDDSSYSNIPTTSYELPDGQTIEVGADRF  117

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDI+FNPSLVQTIPGMESFAET  SLRGLPQMVIESI++CDVDIRREL+SSILL+ GT
Sbjct  118  KIPDIIFNPSLVQTIPGMESFAETVASLRGLPQMVIESINKCDVDIRRELFSSILLAWGT  177

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  178  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  237

Query  322  EYEEHGASYVQRKC  281
            EYEEHGASYVQRKC
Sbjct  238  EYEEHGASYVQRKC  251



>ref|XP_004252241.1| PREDICTED: actin-related protein 4 [Solanum lycopersicum]
Length=435

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESYKLYCQ+ IASDIKECVSRAPDTPYDDSSYSNIP T YELPDGQ IE+GADRF
Sbjct  241  FPDTTESYKLYCQRAIASDIKECVSRAPDTPYDDSSYSNIPTTSYELPDGQIIEVGADRF  300

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDI+FNPSLVQTIPGMESFAETA SLRGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  301  KIPDIIFNPSLVQTIPGMESFAETAASLRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  360

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  361  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  420

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  421  EYEEHGASYVQRKCP  435



>ref|XP_008453382.1| PREDICTED: actin-related protein 4 [Cucumis melo]
Length=445

 Score =   353 bits (907),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 179/195 (92%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  251  FPNTTESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQTIPGMESF ETA S++GLP MVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLVQTIPGMESFTETARSVQGLPHMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  431  EYEEHGASYIQRKCP  445



>ref|XP_003521054.1| PREDICTED: actin-related protein 4-like [Glycine max]
 gb|KHN31101.1| Actin-related protein 4 [Glycine soja]
Length=445

 Score =   353 bits (905),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 179/195 (92%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLYCQ+VIASDIKECV RAPDTPYD+S+YSNIPMT YELPDGQTIEIGADRF
Sbjct  251  FPNTTESYKLYCQRVIASDIKECVCRAPDTPYDESAYSNIPMTSYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQ+IPG ESFAE A S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLVQSIPGTESFAEIAPSVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  431  EYEEHGASYIQRKCP  445



>ref|XP_004138236.1| PREDICTED: actin-related protein 4 [Cucumis sativus]
 ref|XP_011648825.1| PREDICTED: actin-related protein 4 [Cucumis sativus]
 gb|KGN63807.1| hypothetical protein Csa_1G021970 [Cucumis sativus]
Length=445

 Score =   352 bits (903),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  251  FPNTTESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQTIPGMESF ETA S++GLP MVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLVQTIPGMESFTETARSVQGLPHMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  430

Query  322  EYEEHGASYVQRKCP  278
            E+EEHGASY+QRKCP
Sbjct  431  EFEEHGASYIQRKCP  445



>ref|XP_012092989.1| PREDICTED: actin-related protein 4-like [Jatropha curcas]
 gb|KDP20102.1| hypothetical protein JCGZ_05871 [Jatropha curcas]
Length=441

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDT YD+SSYSNIPMTPYELPDGQTIEIGADRF
Sbjct  247  FPNTTESYKLYSQRVIASDIKECVCRAPDTLYDESSYSNIPMTPYELPDGQTIEIGADRF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL QTIPGMESFAE A ++RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  307  KIPDILFNPSLAQTIPGMESFAEIAPNVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  367  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  427  EYEEHGASYVQRKCP  441



>ref|XP_004515315.1| PREDICTED: actin-related protein 4-like isoform X1 [Cicer arietinum]
Length=445

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASD+KECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIG+DRF
Sbjct  251  FPNTTESYKLYSQRVIASDVKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGSDRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL QTIPGMESFAE A S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLAQTIPGMESFAEIAPSVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFS+S
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSRS  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  431  EYEEHGASYIQRKCP  445



>ref|XP_004515316.1| PREDICTED: actin-related protein 4-like isoform X2 [Cicer arietinum]
Length=444

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASD+KECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIG+DRF
Sbjct  250  FPNTTESYKLYSQRVIASDVKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGSDRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL QTIPGMESFAE A S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  310  KIPDVLFNPSLAQTIPGMESFAEIAPSVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFS+S
Sbjct  370  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSRS  429

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  430  EYEEHGASYIQRKCP  444



>ref|XP_006440935.1| hypothetical protein CICLE_v100208362mg, partial [Citrus clementina]
 gb|ESR54175.1| hypothetical protein CICLE_v100208362mg, partial [Citrus clementina]
Length=199

 Score =   340 bits (873),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLYCQ+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQ IEIGADRF
Sbjct  6    FPNTTESYKLYCQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQVIEIGADRF  65

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K PD+LFNPSLVQTIPGME+FAE     RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  66   KTPDVLFNPSLVQTIPGMENFAEN-IPFRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  124

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKV++SGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  125  ASMQQLKERLEKDLLEESPQAARVKVVSSGNATERRFSVWIGGSILASLGSFQQMWFSKS  184

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  185  EYEEHGASYIQRKCP  199



>ref|XP_010677969.1| PREDICTED: actin-related protein 4 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+ESY+LYCQ+VIASDIK+CV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIG+DRF
Sbjct  251  FPNTSESYRLYCQRVIASDIKDCVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGSDRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K PD+LFNPSLVQTIPGMES+ ETA S RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KTPDVLFNPSLVQTIPGMESYVETAASARGLPQMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERR+SVWIGGSILASLGSFQQMWFSKS
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRYSVWIGGSILASLGSFQQMWFSKS  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  431  EYEEHGASYIQRKCP  445



>ref|XP_007134394.1| hypothetical protein PHAVU_010G044300g [Phaseolus vulgaris]
 gb|ESW06388.1| hypothetical protein PHAVU_010G044300g [Phaseolus vulgaris]
Length=446

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIPMT YELPDGQT+EIG+DRF
Sbjct  252  FPNTTESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTSYELPDGQTLEIGSDRF  311

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQ+IPGMESFAE A S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  312  KIPDVLFNPSLVQSIPGMESFAEIAPSVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  371

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  372  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  431

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  432  EYEEHGASYIQRKCP  446



>ref|XP_003529017.1| PREDICTED: actin-related protein 4-like [Glycine max]
Length=446

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKL+ Q+VIASDIKECV RAPDTPYD+S+YSNIPMT YELPDGQT+EIGADRF
Sbjct  252  FPNTTESYKLFSQRVIASDIKECVCRAPDTPYDESAYSNIPMTSYELPDGQTVEIGADRF  311

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQ+IPGMESFAE A S+RGLPQMVIESI++CDVDIRREL++SILL+GGT
Sbjct  312  KIPDVLFNPSLVQSIPGMESFAEIAPSVRGLPQMVIESINKCDVDIRRELFNSILLAGGT  371

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  372  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  431

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  432  EYEEHGASYIQRKCP  446



>ref|XP_002317939.1| Actin-related family protein [Populus trichocarpa]
 gb|EEE96159.1| Actin-related family protein [Populus trichocarpa]
Length=441

 Score =   348 bits (892),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            F NTT+SY+LY Q+VIASDIKECV RAPDTPYD+SSYSNIPMTPYELPDGQTIEIGADRF
Sbjct  247  FTNTTDSYRLYSQRVIASDIKECVCRAPDTPYDESSYSNIPMTPYELPDGQTIEIGADRF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSLVQTIPGM++F E A S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  307  KIPDILFNPSLVQTIPGMDNFVEIAPSVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  367  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKA  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  427  EYEEHGASYVQRKCP  441



>gb|EYU44127.1| hypothetical protein MIMGU_mgv1a006688mg [Erythranthe guttata]
Length=435

 Score =   347 bits (891),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VI  DIKECV RAPDTPYDD+SYSNIPMTPYELPDGQTIEIGADRF
Sbjct  241  FPNTTESYKLYSQRVIVGDIKECVCRAPDTPYDDTSYSNIPMTPYELPDGQTIEIGADRF  300

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQTIPGMES  ETA+S RGLPQMVIESI++CDVDIRREL+S ILLSGGT
Sbjct  301  KIPDVLFNPSLVQTIPGMESSVETASSARGLPQMVIESINKCDVDIRRELFSGILLSGGT  360

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEE+PQAARVKVL+SGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  361  ASMQQLKERLEKDLLEETPQAARVKVLSSGNATERRFSVWIGGSILASLGSFQQMWFSKS  420

Query  322  EYEEHGASYVQRKCP  278
            E+EEHGASY+QRKCP
Sbjct  421  EFEEHGASYIQRKCP  435



>ref|XP_011014466.1| PREDICTED: actin-related protein 4-like [Populus euphratica]
Length=441

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            F NTTESY+LY Q+VIASDIKECV RAPDTPYD+SSYSNIPMTPYELPDGQTIEIGADRF
Sbjct  247  FTNTTESYRLYSQRVIASDIKECVCRAPDTPYDESSYSNIPMTPYELPDGQTIEIGADRF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSLVQTI GM++F E A S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  307  KIPDILFNPSLVQTILGMDNFVEIAPSVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  367  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  427  EYEEHGASYVQRKCP  441



>emb|CBI15426.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDTP+D+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  248  FPNTTESYKLYSQRVIASDIKECVCRAPDTPFDESAYSNIPMTPYELPDGQTIEIGADRF  307

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD+LFNPSL QTIP MESFA+ A S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  308  KVPDVLFNPSLAQTIPNMESFADIAPSVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  367

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQ ARVKVLASGN+TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  368  ASMQQLKERLEKDLLEESPQTARVKVLASGNSTERRFSVWIGGSILASLGSFQQMWFSKA  427

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  428  EYEEHGASYIQRKCP  442



>ref|XP_007014880.1| Actin-related protein 4 isoform 1 [Theobroma cacao]
 gb|EOY32499.1| Actin-related protein 4 isoform 1 [Theobroma cacao]
Length=438

 Score =   345 bits (886),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  244  FPNTTESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNP L QTIPGM +FAE + S RGLPQMVIESI+RCDVDIR+EL+ SILL+GGT
Sbjct  304  KIPDVLFNPPLAQTIPGMNNFAEISPSFRGLPQMVIESINRCDVDIRKELFGSILLAGGT  363

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  364  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  423

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  424  EYEEHGASYIQRKCP  438



>gb|KJB83476.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
Length=396

 Score =   344 bits (882),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESY+LY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  202  FPHTTESYRLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  261

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP L QTIPGM++FAE + S+RGLPQMVIESI+RCDVDIR+EL+ SILL+GGT
Sbjct  262  KIPDILFNPPLAQTIPGMDNFAEISPSVRGLPQMVIESINRCDVDIRKELFGSILLAGGT  321

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  322  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  381

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  382  EYEEHGASYIQRKCP  396



>ref|XP_011013156.1| PREDICTED: actin-related protein 4-like isoform X4 [Populus euphratica]
Length=337

 Score =   342 bits (876),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+T ESY+LY Q+VIASDIKECV RAPDTPYD+SSYSNIPMTPYELPDGQTIEIGADRF
Sbjct  143  FPSTPESYRLYSQRVIASDIKECVCRAPDTPYDESSYSNIPMTPYELPDGQTIEIGADRF  202

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSLVQTIPGM++F E A+S RGLPQM +ESI++CDVDIRREL+SSILL+GGT
Sbjct  203  KIPDILFNPSLVQTIPGMDNFVEIASSARGLPQMAVESINKCDVDIRRELFSSILLAGGT  262

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQ WFSKS
Sbjct  263  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQTWFSKS  322

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SYVQRKCP
Sbjct  323  EYEEHGVSYVQRKCP  337



>ref|XP_011013154.1| PREDICTED: actin-related protein 4-like isoform X3 [Populus euphratica]
 ref|XP_011013155.1| PREDICTED: actin-related protein 4-like isoform X3 [Populus euphratica]
Length=338

 Score =   342 bits (876),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+T ESY+LY Q+VIASDIKECV RAPDTPYD+SSYSNIPMTPYELPDGQTIEIGADRF
Sbjct  144  FPSTPESYRLYSQRVIASDIKECVCRAPDTPYDESSYSNIPMTPYELPDGQTIEIGADRF  203

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSLVQTIPGM++F E A+S RGLPQM +ESI++CDVDIRREL+SSILL+GGT
Sbjct  204  KIPDILFNPSLVQTIPGMDNFVEIASSARGLPQMAVESINKCDVDIRRELFSSILLAGGT  263

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQ WFSKS
Sbjct  264  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQTWFSKS  323

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SYVQRKCP
Sbjct  324  EYEEHGVSYVQRKCP  338



>ref|XP_002275561.2| PREDICTED: actin-related protein 4 [Vitis vinifera]
Length=444

 Score =   345 bits (884),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDTP+D+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  250  FPNTTESYKLYSQRVIASDIKECVCRAPDTPFDESAYSNIPMTPYELPDGQTIEIGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD+LFNPSL QTIP MESFA+ A S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  310  KVPDVLFNPSLAQTIPNMESFADIAPSVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQ ARVKVLASGN+TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  370  ASMQQLKERLEKDLLEESPQTARVKVLASGNSTERRFSVWIGGSILASLGSFQQMWFSKA  429

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  430  EYEEHGASYIQRKCP  444



>gb|KJB83474.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
 gb|KJB83477.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
Length=438

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESY+LY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  244  FPHTTESYRLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP L QTIPGM++FAE + S+RGLPQMVIESI+RCDVDIR+EL+ SILL+GGT
Sbjct  304  KIPDILFNPPLAQTIPGMDNFAEISPSVRGLPQMVIESINRCDVDIRKELFGSILLAGGT  363

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  364  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  423

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  424  EYEEHGASYIQRKCP  438



>gb|KEH28123.1| actin-related protein ARP4 [Medicago truncatula]
Length=417

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+ESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  223  FPNTSESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  282

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL  +IPGMESFAE A S+RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  283  KIPDVLFNPSLAHSIPGMESFAEIAPSVRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  342

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  343  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  402

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  403  EYEEHGASYIQRKCP  417



>ref|XP_006485767.1| PREDICTED: actin-related protein 4-like [Citrus sinensis]
Length=441

 Score =   343 bits (879),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLYCQ+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQ IEIGADRF
Sbjct  248  FPNTTESYKLYCQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQVIEIGADRF  307

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K PD+LFNPSLVQTIPGME+FAE     RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  308  KTPDVLFNPSLVQTIPGMENFAEN-IPFRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKV++SGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  367  ASMQQLKERLEKDLLEESPQAARVKVVSSGNATERRFSVWIGGSILASLGSFQQMWFSKS  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  427  EYEEHGASYIQRKCP  441



>ref|XP_003615307.1| Actin-related protein [Medicago truncatula]
Length=445

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+ESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  251  FPNTSESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL  +IPGMESFAE A S+RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLAHSIPGMESFAEIAPSVRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  431  EYEEHGASYIQRKCP  445



>gb|KDO64534.1| hypothetical protein CISIN_1g0374702mg, partial [Citrus sinensis]
Length=410

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLYCQ+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQ IEIGADRF
Sbjct  217  FPNTTESYKLYCQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQVIEIGADRF  276

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K PD+LFNPSLVQTIPGME+FAE     RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  277  KTPDVLFNPSLVQTIPGMENFAEN-IPFRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  335

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKV++SGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  336  ASMQQLKERLEKDLLEESPQAARVKVVSSGNATERRFSVWIGGSILASLGSFQQMWFSKS  395

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  396  EYEEHGASYIQRKCP  410



>gb|AES98265.2| actin-related protein ARP4 [Medicago truncatula]
Length=445

 Score =   343 bits (879),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+ESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  251  FPNTSESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL  +IPGMESFAE A S+RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLAHSIPGMESFAEIAPSVRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  431  EYEEHGASYIQRKCP  445



>ref|XP_006374349.1| Actin-related family protein [Populus trichocarpa]
 gb|ERP52146.1| Actin-related family protein [Populus trichocarpa]
Length=378

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESY+LY Q+VIASDIKECV RAPDTPYD+SSYSNIPMTPYELPDGQTIEIGADRF
Sbjct  184  FPSTTESYRLYSQRVIASDIKECVCRAPDTPYDESSYSNIPMTPYELPDGQTIEIGADRF  243

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL+QTIPGM++F E A+S RGLPQM IESI++CDVDIRREL+SSILL+GGT
Sbjct  244  KIPDILFNPSLIQTIPGMDNFVEIASSARGLPQMAIESINKCDVDIRRELFSSILLAGGT  303

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESP AARVKVLASGNATERRFSVWIGGSILASLGSFQQ WFSKS
Sbjct  304  ASMQQLKERLEKDLLEESPPAARVKVLASGNATERRFSVWIGGSILASLGSFQQTWFSKS  363

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SYVQRKCP
Sbjct  364  EYEEHGVSYVQRKCP  378



>ref|XP_003615306.1| Actin-related protein [Medicago truncatula]
Length=444

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+ESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  250  FPNTSESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL  +IPGMESFAE A S+RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  310  KIPDVLFNPSLAHSIPGMESFAEIAPSVRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  370  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  429

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  430  EYEEHGASYIQRKCP  444



>ref|XP_011013153.1| PREDICTED: actin-related protein 4-like isoform X2 [Populus euphratica]
Length=409

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+T ESY+LY Q+VIASDIKECV RAPDTPYD+SSYSNIPMTPYELPDGQTIEIGADRF
Sbjct  215  FPSTPESYRLYSQRVIASDIKECVCRAPDTPYDESSYSNIPMTPYELPDGQTIEIGADRF  274

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSLVQTIPGM++F E A+S RGLPQM +ESI++CDVDIRREL+SSILL+GGT
Sbjct  275  KIPDILFNPSLVQTIPGMDNFVEIASSARGLPQMAVESINKCDVDIRRELFSSILLAGGT  334

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQ WFSKS
Sbjct  335  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQTWFSKS  394

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SYVQRKCP
Sbjct  395  EYEEHGVSYVQRKCP  409



>ref|XP_011013152.1| PREDICTED: actin-related protein 4-like isoform X1 [Populus euphratica]
Length=420

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+T ESY+LY Q+VIASDIKECV RAPDTPYD+SSYSNIPMTPYELPDGQTIEIGADRF
Sbjct  226  FPSTPESYRLYSQRVIASDIKECVCRAPDTPYDESSYSNIPMTPYELPDGQTIEIGADRF  285

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSLVQTIPGM++F E A+S RGLPQM +ESI++CDVDIRREL+SSILL+GGT
Sbjct  286  KIPDILFNPSLVQTIPGMDNFVEIASSARGLPQMAVESINKCDVDIRRELFSSILLAGGT  345

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQ WFSKS
Sbjct  346  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQTWFSKS  405

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SYVQRKCP
Sbjct  406  EYEEHGVSYVQRKCP  420



>ref|XP_007212269.1| hypothetical protein PRUPE_ppa006685mg [Prunus persica]
 gb|EMJ13468.1| hypothetical protein PRUPE_ppa006685mg [Prunus persica]
Length=400

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 187/195 (96%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+V+ASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  207  FPNTTESYKLYSQRVVASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  266

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL QTIPG+E+FAE A  LRGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  267  KIPDILFNPSLAQTIPGVENFAEIA-PLRGLPQMVIESINKCDVDIRRELFSSILLAGGT  325

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGN+TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  326  ASMQQLKERLEKDLLEESPQAARVKVLASGNSTERRFSVWIGGSILASLGSFQQMWFSKA  385

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  386  EYEEHGASYVQRKCP  400



>ref|XP_009339362.1| PREDICTED: actin-related protein 4-like [Pyrus x bretschneideri]
 ref|XP_009339363.1| PREDICTED: actin-related protein 4-like [Pyrus x bretschneideri]
Length=444

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESY+LY Q++IASDIKECV RAPDTPYD+ +YSNIPMT YELPDGQTIEIGADRF
Sbjct  250  FPNTTESYRLYAQRIIASDIKECVCRAPDTPYDEIAYSNIPMTSYELPDGQTIEIGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL QTIPGME FAE A+++RGLPQMVIESI++CDVDIRREL+SSI+L+GGT
Sbjct  310  KIPDILFNPSLAQTIPGMEHFAEIASTVRGLPQMVIESINKCDVDIRRELFSSIMLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKD+LEESPQAARVKVL +GN+TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  370  ASMQQLKERLEKDMLEESPQAARVKVLVAGNSTERRFSVWIGGSILASLGSFQQMWFSKA  429

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  430  EYEEHGASYIQRKCP  444



>gb|ACJ85813.1| unknown [Medicago truncatula]
 gb|AFK47724.1| unknown [Medicago truncatula]
Length=445

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+ESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  251  FPNTSESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL  +IPGMESFAE A S+RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLAHSIPGMESFAEIAPSVRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  431  EYEEHGASYIQRKCP  445



>ref|XP_009344621.1| PREDICTED: actin-related protein 4-like [Pyrus x bretschneideri]
Length=444

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESY+LY Q++IASDIKECV RAPDTPYD+ +YSNIPMT YELPDGQTIEIGADRF
Sbjct  250  FPNTTESYRLYSQRIIASDIKECVCRAPDTPYDEIAYSNIPMTSYELPDGQTIEIGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL QTIPGME FAE A ++RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  310  KIPDILFNPSLAQTIPGMEHFAEIAPTVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKD+LEESPQAARVKVL +GN+TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  370  ASMQQLKERLEKDMLEESPQAARVKVLVAGNSTERRFSVWIGGSILASLGSFQQMWFSKA  429

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  430  EYEEHGASYIQRKCP  444



>ref|XP_002511960.1| protein binding protein, putative [Ricinus communis]
 gb|EEF50629.1| protein binding protein, putative [Ricinus communis]
Length=442

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q++IASDIKECV RAPDT YD+ +YSNIPMTPYELPDGQTIEIGADRF
Sbjct  248  FPNTTESYKLYSQRIIASDIKECVCRAPDTAYDEKAYSNIPMTPYELPDGQTIEIGADRF  307

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP L QTIPGME+  E A ++RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  308  KIPDILFNPPLAQTIPGMENSPEIAPNVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  367

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  368  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  427

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  428  EYEEHGASYVQRKCP  442



>ref|XP_008368454.1| PREDICTED: actin-related protein 4 [Malus domestica]
Length=444

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESY+LY Q++IASDIKECV R+PDTPYD+ +YSNIPMT YELPDGQTIEIGADRF
Sbjct  250  FPNTTESYRLYSQRIIASDIKECVCRSPDTPYDEIAYSNIPMTSYELPDGQTIEIGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL QTIPGME FAE A ++RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  310  KIPDILFNPSLAQTIPGMEHFAEIAPAVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKD+LEESPQAARVKVL +GN+TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  370  ASMQQLKERLEKDMLEESPQAARVKVLVAGNSTERRFSVWIGGSILASLGSFQQMWFSKA  429

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  430  EYEEHGASYIQRKCP  444



>gb|KJB83478.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
Length=439

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 1/196 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESY+LY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  244  FPHTTESYRLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP L QTIPGM++FAE + S+RGLPQMVIESI+RCDVDIR+EL+ SILL+GGT
Sbjct  304  KIPDILFNPPLAQTIPGMDNFAEISPSVRGLPQMVIESINRCDVDIRKELFGSILLAGGT  363

Query  502  ASMQQlke-rlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
            ASMQQLKE   +  L  ESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK
Sbjct  364  ASMQQLKERLEKDLLEVESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  423

Query  325  SEYEEHGASYVQRKCP  278
            SEYEEHGASY+QRKCP
Sbjct  424  SEYEEHGASYIQRKCP  439



>gb|KCW83833.1| hypothetical protein EUGRSUZ_B007042, partial [Eucalyptus grandis]
Length=326

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESY+LY Q+VIASDIK+ V RAPD+PYD+S+Y+NIPMTPYELPDGQTIEIG+DRF
Sbjct  132  FPNTTESYRLYSQRVIASDIKDSVCRAPDSPYDESAYANIPMTPYELPDGQTIEIGSDRF  191

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNP+L QTIPGMESF+E A S+RGL QMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  192  KIPDVLFNPTLSQTIPGMESFSEFAPSVRGLSQMVIESINKCDVDIRRELFSSILLAGGT  251

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  252  ASMQQLKERLEKDLLEESPQAARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKT  311

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  312  EYEEHGASYVQRKCP  326



>ref|XP_008226362.1| PREDICTED: actin-related protein 4 [Prunus mume]
Length=442

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESYKLY Q+V+ASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  249  LPNTTESYKLYSQRVVASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  308

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL QTIPG+E+FAE A  LRGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  309  KIPDILFNPSLAQTIPGVENFAEIA-PLRGLPQMVIESINKCDVDIRRELFSSILLAGGT  367

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGN+TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  368  ASMQQLKERLEKDLLEESPQAARVKVLASGNSTERRFSVWIGGSILASLGSFQQMWFSKA  427

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  428  EYEEHGASYVQRKCP  442



>ref|XP_010031801.1| PREDICTED: actin-related protein 4 [Eucalyptus grandis]
Length=445

 Score =   335 bits (858),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESY+LY Q+VIASDIK+ V RAPD+PYD+S+Y+NIPMTPYELPDGQTIEIG+DRF
Sbjct  251  FPNTTESYRLYSQRVIASDIKDSVCRAPDSPYDESAYANIPMTPYELPDGQTIEIGSDRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNP+L QTIPGMESF+E A S+RGL QMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPTLSQTIPGMESFSEFAPSVRGLSQMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKT  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  431  EYEEHGASYVQRKCP  445



>gb|ACU18101.1| unknown [Glycine max]
Length=353

 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESYKLY Q+VIASDIKECV R PD+PYD+  YSNIPMTPYELPDGQ IE+G+DRF
Sbjct  159  FPHTTESYKLYSQRVIASDIKECVCRTPDSPYDERVYSNIPMTPYELPDGQIIEVGSDRF  218

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP LVQTIPGMESFAE A S+RGLP+M+IESI++CDVDIRREL+S+ILL+GGT
Sbjct  219  KIPDILFNPLLVQTIPGMESFAEIAPSIRGLPKMIIESINKCDVDIRRELFSTILLTGGT  278

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASM QLKER+EKDLLEESPQAARVKV  SGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  279  ASMHQLKERIEKDLLEESPQAARVKVFVSGNATERRFSVWIGGSILASLGSFQQMWFSKS  338

Query  322  EYEEHGASYVQRKCP  278
            EYEE GASY+QRKCP
Sbjct  339  EYEEQGASYIQRKCP  353



>ref|XP_008811208.1| PREDICTED: actin-related protein 4 [Phoenix dactylifera]
Length=445

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIA DIKECV R PDT +D+++Y+N+PMT YELPDGQTIEIGADRF
Sbjct  251  FPNTTESYKLYSQRVIAGDIKECVCRVPDTAFDETAYANVPMTSYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL QTIPGMES+A++A  +RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLAQTIPGMESYADSAIPVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEK+L+EE+PQAARVKVLASGNA ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  371  ASMQQLKERLEKELMEEAPQAARVKVLASGNAIERRFSVWIGGSILASLGSFQQMWFSKA  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  431  EYEEHGVSYIQRKCP  445



>ref|XP_010260462.1| PREDICTED: actin-related protein 4 [Nelumbo nucifera]
Length=445

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VI SDIKECV RAPD  YD+++Y+N+PMT YELPDGQT+EIGADRF
Sbjct  251  FPNTTESYKLYSQRVIVSDIKECVCRAPDALYDETAYANVPMTSYELPDGQTLEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL+Q IPGMESF+E+  ++RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLIQIIPGMESFSESNPTIRGLPQMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKA  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  431  EYEEHGVSYIQRKCP  445



>ref|XP_003530654.1| PREDICTED: actin-related protein 4 isoform X1 [Glycine max]
 gb|KHN16587.1| Actin-related protein 4 [Glycine soja]
Length=431

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESYKLY Q+VIASDIKECV R PD+PYD+  YSNIPMTPYELPDGQ IE+G+DRF
Sbjct  237  FPHTTESYKLYSQRVIASDIKECVCRTPDSPYDERVYSNIPMTPYELPDGQIIEVGSDRF  296

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP LVQTIPGMESFAE A S+RGLP+M+IESI++CDVDIRREL+S+ILL+GGT
Sbjct  297  KIPDILFNPLLVQTIPGMESFAEIAPSIRGLPKMIIESINKCDVDIRRELFSTILLTGGT  356

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASM QLKER+EKDLLEESPQAARVKV  SGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  357  ASMHQLKERIEKDLLEESPQAARVKVFVSGNATERRFSVWIGGSILASLGSFQQMWFSKS  416

Query  322  EYEEHGASYVQRKCP  278
            EYEE GASY+QRKCP
Sbjct  417  EYEEQGASYIQRKCP  431



>ref|XP_010940353.1| PREDICTED: actin-related protein 4 [Elaeis guineensis]
Length=445

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASD+KECV R PDT +D+++Y+N+PMT YELPDGQTIEIGADRF
Sbjct  251  FPNTTESYKLYSQRVIASDVKECVCRVPDTAFDETAYANVPMTSYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL Q I GMESFA++A  +RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLAQMILGMESFADSAAPVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEK+L+EE+PQAARVKVLASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  371  ASMQQLKERLEKELMEEAPQAARVKVLASGNSIERRFSVWIGGSILASLGSFQQMWFSKA  430

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  431  EYEEHGVSYIQRKCP  445



>ref|XP_010094708.1| hypothetical protein L484_003016 [Morus notabilis]
 gb|EXB56754.1| hypothetical protein L484_003016 [Morus notabilis]
Length=397

 Score =   326 bits (835),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  201  FPNTTESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K PD+LFNPSLVQTIPGME FAETA S+RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  261  KTPDVLFNPSLVQTIPGMECFAETAASVRGLPQMVIESINKCDVDIRRELFSSILLAGGT  320

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  321  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  380

Query  322  E  320
            E
Sbjct  381  E  381



>ref|XP_010539996.1| PREDICTED: actin-related protein 4 [Tarenaya hassleriana]
Length=441

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTE+Y+L+CQ++I SDIKE V R PDTPYDD+SYSNIPMT YELPDGQT+EIGADRF
Sbjct  247  LPDTTETYRLFCQRMIVSDIKESVCRVPDTPYDDTSYSNIPMTSYELPDGQTLEIGADRF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD++FNP LVQTIPGME++     S+RGLP MVIESI++CDVDIRRELYSSILL+GGT
Sbjct  307  KIPDVMFNPFLVQTIPGMENYTGMLPSIRGLPHMVIESINKCDVDIRRELYSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQ+ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  367  ASMQQLKERLEKDLLEESPQSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  427  EYEEHGASYIQRKCP  441



>ref|XP_004294179.1| PREDICTED: actin-related protein 4-like [Fragaria vesca subsp. 
vesca]
Length=435

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY +++IASDIKECV RAPD+ YD+SSYSNIPMTPYELPDGQTIEIG+DRF
Sbjct  241  FPNTTESYKLYSKRIIASDIKECVCRAPDSSYDESSYSNIPMTPYELPDGQTIEIGSDRF  300

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL QTIPGME+FAE A SLRGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  301  KIPDVLFNPSLAQTIPGMENFAEIAPSLRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  360

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDL+EESP AARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  361  ASMQQLKERLEKDLVEESPHAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKA  420

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  421  EYEEHGASYVQRKCP  435



>ref|XP_006390493.1| hypothetical protein EUTSA_v10018569mg [Eutrema salsugineum]
 gb|ESQ27779.1| hypothetical protein EUTSA_v10018569mg [Eutrema salsugineum]
Length=440

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            PNTTESYKL+CQ++I SDIK+ + R PDTPYDD SYSNIPMT YELPDGQT+EIGADRFK
Sbjct  247  PNTTESYKLFCQRMIVSDIKDSICRVPDTPYDDKSYSNIPMTSYELPDGQTLEIGADRFK  306

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
             PD++FNPS+VQTIPGME + +    +RGLPQMVI+SIS+CDVDIRRELYSSILL+GGT+
Sbjct  307  TPDVMFNPSIVQTIPGMEYYTDMLPLVRGLPQMVIQSISKCDVDIRRELYSSILLAGGTS  366

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
            SMQQLKERLEKDLLEESPQ+ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKSE
Sbjct  367  SMQQLKERLEKDLLEESPQSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKSE  426

Query  319  YEEHGASYVQRKCP  278
            YEEHGASY+QRKCP
Sbjct  427  YEEHGASYIQRKCP  440



>gb|EPS72646.1| hypothetical protein M569_02110, partial [Genlisea aurea]
Length=418

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP TTESYKLY Q+VI  DIKE V R PD  YD++SYSNIPMT YELPDGQTIEIGADRF
Sbjct  224  FPYTTESYKLYSQRVIVGDIKESVCRVPDIAYDETSYSNIPMTSYELPDGQTIEIGADRF  283

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ILFNP LVQTIPGME F E A+  RGLPQMVIESI++CDVDIRRELY SILL+GGT
Sbjct  284  KIPEILFNPYLVQTIPGMEGFGEAASMARGLPQMVIESINKCDVDIRRELYGSILLAGGT  343

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKER+EKDLLEESP +ARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  344  ASMQQLKERMEKDLLEESPHSARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  403

Query  322  EYEEHGASYVQRKCP  278
            E+EEHGASY+QRKCP
Sbjct  404  EFEEHGASYIQRKCP  418



>ref|XP_006837032.1| PREDICTED: actin-related protein 4 [Amborella trichopoda]
 ref|XP_011621071.1| PREDICTED: actin-related protein 4 [Amborella trichopoda]
 gb|ERM99885.1| hypothetical protein AMTR_s00110p00032330 [Amborella trichopoda]
Length=444

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            F NTTESYKLYCQ+VIASDIKE V RAPDT +D+++Y+NIP T YELPDGQTIEIGADRF
Sbjct  251  FSNTTESYKLYCQRVIASDIKEAVCRAPDTAFDETAYANIPTTSYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP ILFNPSL+ TIPGM+ F + +T  RGLPQMVIESI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPGILFNPSLIHTIPGMDKF-DHSTPSRGLPQMVIESINKCDVDIRRELFSSILLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQ+KERLEKDL+EE+PQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  370  ASMQQMKERLEKDLMEEAPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  429

Query  322  EYEEHGASYVQRKCP  278
            E+EEHGASY+QRKCP
Sbjct  430  EFEEHGASYIQRKCP  444



>ref|NP_564051.1| actin-related protein 4 [Arabidopsis thaliana]
 sp|Q84M92.1|ARP4_ARATH RecName: Full=Actin-related protein 4 [Arabidopsis thaliana]
 tpg|DAA00027.1| TPA_exp: actin-related protein 4; AtARP4 [Arabidopsis thaliana]
 gb|AAP21282.1| At1g18450 [Arabidopsis thaliana]
 dbj|BAF00057.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29715.1| actin-related protein 4 [Arabidopsis thaliana]
Length=441

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  247  IPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +AE   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  307  KVPDVMFNPSIVQTIPGMEKYAEMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  367  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  427  EYEEHGASYIQRKCP  441



>gb|AAM53244.1|AF507912_1 actin-related protein 4 [Arabidopsis thaliana]
Length=442

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  248  IPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  307

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +AE   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  308  KVPDVMFNPSIVQTIPGMEKYAEMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  367

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  368  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  427

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  428  EYEEHGASYIQRKCP  442



>ref|XP_011628816.1| PREDICTED: actin-related protein 4 [Amborella trichopoda]
 ref|XP_011628817.1| PREDICTED: actin-related protein 4 [Amborella trichopoda]
Length=444

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 184/195 (94%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            +PNTTESYK+YCQ+VIA D KE V RAPDT +D+++Y+NIPMTPYELPDGQTIEIGADRF
Sbjct  251  YPNTTESYKMYCQRVIAGDTKESVCRAPDTAFDETAYTNIPMTPYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+P+ILF+PSL+  IPGME+  + +T +RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  311  KVPEILFSPSLIHMIPGMENL-DNSTPIRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQ+KERLEKDL+EE+PQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  370  ASMQQVKERLEKDLMEEAPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  429

Query  322  EYEEHGASYVQRKCP  278
            E+EEHGASY+QRKCP
Sbjct  430  EFEEHGASYIQRKCP  444



>ref|XP_010477023.1| PREDICTED: actin-related protein 4 [Camelina sativa]
Length=439

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  245  IPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  304

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  305  KVPDVMFNPSIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  364

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  365  SSMQQLKERLEKDLVEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  424

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  425  EYEEHGASYIQRKCP  439



>gb|AAM65324.1| unknown [Arabidopsis thaliana]
Length=441

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  247  IPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  307  KVPDVMFNPSIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  367  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  427  EYEEHGASYIQRKCP  441



>ref|XP_006416603.1| hypothetical protein EUTSA_v10007641mg [Eutrema salsugineum]
 dbj|BAJ34096.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34956.1| hypothetical protein EUTSA_v10007641mg [Eutrema salsugineum]
Length=443

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP + YELPDGQT+EIGADRF
Sbjct  249  LPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTSSYELPDGQTLEIGADRF  308

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +A+   S+RGLPQMV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  309  KVPDVMFNPSIVQTIPGMEKYADMIPSVRGLPQMVMESINKCDVDIRRELYSSILLAGGT  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  369  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  429  EYEEHGASYIQRKCP  443



>ref|XP_002890276.1| hypothetical protein ARALYDRAFT_472063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66535.1| hypothetical protein ARALYDRAFT_472063 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQ +EIGADRF
Sbjct  247  IPNTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQMLEIGADRF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  307  KVPDVMFNPSIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  367  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  427  EYEEHGASYIQRKCP  441



>ref|XP_009110345.1| PREDICTED: actin-related protein 4 isoform X2 [Brassica rapa]
Length=438

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGAD+F
Sbjct  244  LPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADKF  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD++FNPS+VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  304  KIPDVMFNPSIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  363

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  364  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  423

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  424  EYEEHGASYIQRKCP  438



>ref|XP_010428343.1| PREDICTED: actin-related protein 4-like [Camelina sativa]
Length=438

 Score =   320 bits (820),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P+TTESYKL+CQ++I SDIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRFK
Sbjct  245  PDTTESYKLFCQRMIVSDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRFK  304

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            +PD++FNPS+VQTIPGM +  +   S+RGLPQMVIESIS+CD DIRRELYSSILL+GGT+
Sbjct  305  VPDVIFNPSIVQTIPGMGNNTDMLHSVRGLPQMVIESISKCDADIRRELYSSILLAGGTS  364

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
            SMQQLKERLEKDL+EESPQ+ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKSE
Sbjct  365  SMQQLKERLEKDLVEESPQSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKSE  424

Query  319  YEEHGASYVQRKCP  278
            YEEHGASY+QRKCP
Sbjct  425  YEEHGASYIQRKCP  438



>emb|CDX96721.1| BnaA08g22640D [Brassica napus]
Length=438

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGAD+F
Sbjct  244  LPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADKF  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD++FNPS+VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  304  KIPDVMFNPSIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  363

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  364  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  423

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  424  EYEEHGASYIQRKCP  438



>ref|XP_010459462.1| PREDICTED: actin-related protein 4-like [Camelina sativa]
Length=439

 Score =   319 bits (818),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  245  IPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  304

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  305  KVPDVMFNPSIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  364

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFS S
Sbjct  365  SSMQQLKERLEKDLVEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSNS  424

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  425  EYEEHGASYIQRKCP  439



>ref|XP_010498232.1| PREDICTED: actin-related protein 4-like [Camelina sativa]
Length=439

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+T ESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  245  IPDTKESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  304

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  305  KVPDVMFNPSIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  364

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  365  SSMQQLKERLEKDLVEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  424

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  425  EYEEHGASYIQRKCP  439



>gb|KFK44003.1| hypothetical protein AALP_AA1G202200 [Arabis alpina]
Length=443

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  249  LPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  308

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +++   S+RGLP MV+ESI++CDVD+RRELYSSILL+GGT
Sbjct  309  KVPDVMFNPSIVQTIPGMEKYSDMIPSVRGLPHMVMESINKCDVDMRRELYSSILLAGGT  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  369  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  429  EYEEHGASYIQRKCP  443



>ref|XP_006307538.1| hypothetical protein CARUB_v10009163mg [Capsella rubella]
 gb|EOA40436.1| hypothetical protein CARUB_v10009163mg [Capsella rubella]
Length=441

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  247  IPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNP +VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  307  KVPDVMFNPPIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  366

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  367  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  426

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  427  EYEEHGASYIQRKCP  441



>gb|KHG07777.1| Actin-related 4 -like protein [Gossypium arboreum]
Length=421

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 174/184 (95%), Gaps = 1/184 (1%)
 Frame = -1

Query  826  QKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFKIPDILFNPSLV  647
            Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRFKIPDILFNP L 
Sbjct  238  QRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRFKIPDILFNPPLA  297

Query  646  QTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTASMQQlkerlek  467
            QTIPGM++ AE ++S+RGLPQMVIESI+RCDVDIR+EL+ SILL+GGTASMQQLKERLEK
Sbjct  298  QTIPGMDNLAEISSSVRGLPQMVIESINRCDVDIRKELFGSILLAGGTASMQQLKERLEK  357

Query  466  -dlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYVQ  290
              L  ESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASY+Q
Sbjct  358  DLLEVESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQ  417

Query  289  RKCP  278
            RKCP
Sbjct  418  RKCP  421



>emb|CDY26159.1| BnaA06g12580D [Brassica napus]
Length=442

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SY+NIP T YELPDGQT+EIGADRFK
Sbjct  249  PDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYANIPTTSYELPDGQTLEIGADRFK  308

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            IPD++FNPS+VQTIPGME + +   ++RGLP MV+ESI++CDVDIRRELYSSILL+GGT+
Sbjct  309  IPDVMFNPSIVQTIPGMEKYGDMIPTVRGLPHMVMESINKCDVDIRRELYSSILLAGGTS  368

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
            SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKSE
Sbjct  369  SMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKSE  428

Query  319  YEEHGASYVQRKCP  278
            YEEHGASY+QRKCP
Sbjct  429  YEEHGASYIQRKCP  442



>gb|AAW81736.1| Putative Acttin-related protein 4 (ARP4) [Brassica oleracea]
Length=442

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SY+NIP T YELPDGQT+EIGADRFK
Sbjct  249  PDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYANIPTTSYELPDGQTLEIGADRFK  308

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            IPD++FNPS+VQTIPGME + +   ++RGLP MV+ESI++CDVDIRRELYSSILL+GGT+
Sbjct  309  IPDVMFNPSIVQTIPGMEKYGDMIPTVRGLPHMVMESINKCDVDIRRELYSSILLAGGTS  368

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
            SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKSE
Sbjct  369  SMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKSE  428

Query  319  YEEHGASYVQRKCP  278
            YEEHGASY+QRKCP
Sbjct  429  YEEHGASYIQRKCP  442



>gb|KFK41829.1| hypothetical protein AALP_AA2G176800 [Arabis alpina]
Length=441

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P+TTESYKL+CQ++I SDIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIG+DRFK
Sbjct  248  PDTTESYKLFCQRMIVSDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGSDRFK  307

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            +PD++FNP +VQTIPGMES+ +   S+RGLP MVIE IS+CDVD+RRELYSSILL+GGT+
Sbjct  308  VPDVMFNPYIVQTIPGMESYTDMLPSVRGLPNMVIECISKCDVDVRRELYSSILLAGGTS  367

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
            SMQQLKERLEKDL+EESPQ+ARVKVLASGN TERRFSVWIGGSILASLGSFQQMW SKSE
Sbjct  368  SMQQLKERLEKDLVEESPQSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWLSKSE  427

Query  319  YEEHGASYVQRKCP  278
            YEEHGASY+QRKCP
Sbjct  428  YEEHGASYIQRKCP  441



>emb|CDX83847.1| BnaC08g17980D [Brassica napus]
Length=439

 Score =   317 bits (812),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGAD+F
Sbjct  245  LPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADKF  304

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD +FNPS+VQTIPG E +AE   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  305  KIPDAMFNPSIVQTIPGTEKYAEMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  364

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  365  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  424

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  425  EYEEHGASYIQRKCP  439



>ref|XP_009110344.1| PREDICTED: actin-related protein 4 isoform X1 [Brassica rapa]
Length=439

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQ-KVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADR  686
             P+TTESYKL+CQ ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGAD+
Sbjct  244  LPDTTESYKLFCQQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADK  303

Query  685  FKIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
            FKIPD++FNPS+VQTIPGME +A+   S+RGLP MV+ESI++CDVDIRRELYSSILL+GG
Sbjct  304  FKIPDVMFNPSIVQTIPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGG  363

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
            T+SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSK
Sbjct  364  TSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSK  423

Query  325  SEYEEHGASYVQRKCP  278
            SEYEEHGASY+QRKCP
Sbjct  424  SEYEEHGASYIQRKCP  439



>emb|CDY19213.1| BnaC05g14140D [Brassica napus]
Length=442

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SY+NIP T YELPDGQT+EIGADRFK
Sbjct  249  PDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYANIPTTSYELPDGQTLEIGADRFK  308

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            IPD++FNPS+VQTI GME + +   ++RGLP MV+ESI++CDVDIRRELYSSILL+GGT+
Sbjct  309  IPDVMFNPSIVQTIHGMEKYGDMIPTVRGLPHMVMESINKCDVDIRRELYSSILLAGGTS  368

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
            SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKSE
Sbjct  369  SMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKSE  428

Query  319  YEEHGASYVQRKCP  278
            YEEHGASY+QRKCP
Sbjct  429  YEEHGASYIQRKCP  442



>ref|XP_009413467.1| PREDICTED: actin-related protein 4 [Musa acuminata subsp. malaccensis]
Length=437

 Score =   314 bits (805),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESYKLY Q+ IASDIKE V R PDT +++S Y+N+PMTPYELPDGQTIEIGADRF
Sbjct  244  IPNTTESYKLYSQRAIASDIKESVCRVPDTAFEESGYANVPMTPYELPDGQTIEIGADRF  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQTIPGMESFA +A S+ GLPQMVIESI+RCD DI+REL+SSILL+GGT
Sbjct  304  KIPDVLFNPSLVQTIPGMESFAGSA-SVSGLPQMVIESINRCDADIKRELFSSILLAGGT  362

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASM QLKERLEK+L+EE+PQAARVKVLASGN+ ERRFSVWIGGSILASLGSFQQ+WFSK+
Sbjct  363  ASMLQLKERLEKELMEEAPQAARVKVLASGNSIERRFSVWIGGSILASLGSFQQLWFSKA  422

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG S +QRKCP
Sbjct  423  EYEEHGVSNIQRKCP  437



>ref|XP_009149328.1| PREDICTED: actin-related protein 4-like [Brassica rapa]
Length=450

 Score =   312 bits (799),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SY+NIP T YELPDGQT+EIGADRFK
Sbjct  257  PDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYANIPTTSYELPDGQTLEIGADRFK  316

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            IPD++FNPS+VQTIPGME + +   ++RGLP MV+ESI++CDVDIRRELY SI L+GGT+
Sbjct  317  IPDVMFNPSIVQTIPGMEKYGDMIPTVRGLPHMVMESINKCDVDIRRELYRSIPLAGGTS  376

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
            SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKSE
Sbjct  377  SMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKSE  436

Query  319  YEEHGASYVQRKCP  278
            YEEHGASY+QRKCP
Sbjct  437  YEEHGASYIQRKCP  450



>gb|AAF25998.1|AC013354_17 F15H18.8 [Arabidopsis thaliana]
Length=777

 Score =   321 bits (823),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+TTESYKL+CQ++I  DIK+ + R PDTPYDD SYSNIP T YELPDGQT+EIGADRF
Sbjct  583  IPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRF  642

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PD++FNPS+VQTIPGME +AE   S+RGLP MV+ESI++CDVDIRRELYSSILL+GGT
Sbjct  643  KVPDVMFNPSIVQTIPGMEKYAEMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGT  702

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +SMQQLKERLEKDL+EESP +ARVKVLASGN TERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  703  SSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKS  762

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  763  EYEEHGASYIQRKCP  777



>gb|KEH19612.1| actin-related protein ARP4, partial [Medicago truncatula]
Length=429

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+ESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  250  FPNTSESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL  +IPGMESFAE A S+RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  310  KIPDVLFNPSLAHSIPGMESFAEIAPSVRGLPQMVIQSINKCDVDIRRELFSSILLAGGT  369

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  370  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  429



>ref|XP_004304616.1| PREDICTED: actin-related protein 4-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011468261.1| PREDICTED: actin-related protein 4-like [Fragaria vesca subsp. 
vesca]
Length=433

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY +++IAS IKE V R PDTPYD+SS+SNIPM PYELPDGQ IEIG+DRF
Sbjct  240  FPNTTESYKLYSKRIIASGIKEYVCRVPDTPYDESSHSNIPMVPYELPDGQIIEIGSDRF  299

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LF+PSL QTIPG+E+FAE A S  GLPQMVI+SI++CDVD RREL+SSILLSGGT
Sbjct  300  KIPDVLFSPSLAQTIPGVENFAEIAPSFPGLPQMVIDSINKCDVDYRRELFSSILLSGGT  359

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
             SMQQ  +   +  L+ESP+AARVKVLASGNAT RRFSVWIGGSILASLG F+ MWF+K+
Sbjct  360  LSMQQ-LKERLEKDLKESPRAARVKVLASGNATGRRFSVWIGGSILASLGQFRYMWFTKA  418

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASYVQRKCP
Sbjct  419  EYEEHGASYVQRKCP  433



>ref|XP_002982148.1| hypothetical protein SELMODRAFT_268538 [Selaginella moellendorffii]
 gb|EFJ16816.1| hypothetical protein SELMODRAFT_268538 [Selaginella moellendorffii]
Length=414

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 175/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTT+SY+ Y Q+VIA+DIKE V R PD  +D+ SY+NIP TPYELPDG TIE+GA+RF
Sbjct  219  FPNTTDSYRRYMQRVIAADIKETVCRVPDGIFDEHSYANIPTTPYELPDGHTIEVGAERF  278

Query  682  KIPDILFNPSLVQTIPGMESFA-ETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
            K+PD++FNP+L+QTIPGME +  +T  +LRGLPQMV + I +CDVDIRREL+S+ILL+GG
Sbjct  279  KVPDLMFNPALIQTIPGMEKYGVDTGLTLRGLPQMVSDCIGKCDVDIRRELFSTILLAGG  338

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
            TASMQQLKERLEKDL+EE+PQAARVKVLASGN  ERRFSVWIGGSILASLGSFQQMWFSK
Sbjct  339  TASMQQLKERLEKDLVEEAPQAARVKVLASGNTIERRFSVWIGGSILASLGSFQQMWFSK  398

Query  325  SEYEEHGASYVQRKCP  278
            +EYEEHG SYVQRKCP
Sbjct  399  AEYEEHGPSYVQRKCP  414



>ref|XP_002966143.1| hypothetical protein SELMODRAFT_266988 [Selaginella moellendorffii]
 gb|EFJ32170.1| hypothetical protein SELMODRAFT_266988 [Selaginella moellendorffii]
Length=415

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 175/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTT+SY+ Y Q+VIA+DIKE V R PD  +D+ SY+NIP TPYELPDG TIE+GA+RF
Sbjct  220  FPNTTDSYRRYMQRVIAADIKETVCRVPDGIFDEHSYANIPTTPYELPDGHTIEVGAERF  279

Query  682  KIPDILFNPSLVQTIPGMESFA-ETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
            K+PD++FNP+L+QTIPGME +  +T  +LRGLPQMV + I +CDVDIRREL+S+ILL+GG
Sbjct  280  KVPDLMFNPALIQTIPGMEKYGVDTGLTLRGLPQMVSDCIGKCDVDIRRELFSTILLAGG  339

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
            TASMQQLKERLEKDL+EE+PQAARVKVLASGN  ERRFSVWIGGSILASLGSFQQMWFSK
Sbjct  340  TASMQQLKERLEKDLVEEAPQAARVKVLASGNTIERRFSVWIGGSILASLGSFQQMWFSK  399

Query  325  SEYEEHGASYVQRKCP  278
            +EYEEHG SYVQRKCP
Sbjct  400  AEYEEHGPSYVQRKCP  415



>ref|XP_004986029.1| PREDICTED: actin-related protein 4-like [Setaria italica]
Length=443

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 177/195 (91%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESY+LYC + IASDIKE V R PDT +D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  250  LPNTTESYRLYCMRAIASDIKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PDILFNPSL QTIPG++ FA+   S+RGLP+MVI+S++RCDVDIR+EL+S+ILLSGG+
Sbjct  310  KVPDILFNPSLSQTIPGVDGFADL-MSVRGLPRMVIDSVNRCDVDIRKELFSNILLSGGS  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEESPQAARVKV+ASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  369  SSILQLKERLEKEVLEESPQAARVKVMASGNSVERRFSVWIGGSILASLGSFQQMWFSKA  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  429  EYEEHGVSYIQRKCP  443



>ref|XP_002466003.1| hypothetical protein SORBIDRAFT_01g049880 [Sorghum bicolor]
 gb|EER93001.1| hypothetical protein SORBIDRAFT_01g049880 [Sorghum bicolor]
Length=443

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 177/195 (91%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESY+LYC + IASD+KE V R PDT +D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  250  LPNTTESYRLYCMRAIASDVKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PDILFNPSL QTIPG++ FA++ T +RGL +MVI+SI++CDVDIR+EL+S+ILLSGG+
Sbjct  310  KVPDILFNPSLSQTIPGIDGFADS-TPVRGLQRMVIDSINKCDVDIRKELFSNILLSGGS  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEESPQAARVKV+ASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  369  SSILQLKERLEKEVLEESPQAARVKVMASGNSVERRFSVWIGGSILASLGSFQQMWFSKA  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  429  EYEEHGVSYIQRKCP  443



>ref|XP_001764145.1| actin-related protein Arp4 [Physcomitrella patens]
 gb|EDQ70986.1| actin-related protein Arp4 [Physcomitrella patens]
Length=443

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTT+SY  Y Q+ I +DIKE + R PD+ +D++SY+NIP TPYELPDGQ IEIGADRF
Sbjct  248  LPNTTDSYYAYAQRAIVADIKESICRVPDSAFDETSYANIPTTPYELPDGQIIEIGADRF  307

Query  682  KIPDILFNPSLVQTIPGMESFA-ETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
            KI DILFNP+L+QTIPGME F  E      GLPQMVIESI++CDVDIRREL++S++L+GG
Sbjct  308  KISDILFNPTLIQTIPGMEKFGTEAGIPFNGLPQMVIESINKCDVDIRRELFNSVMLAGG  367

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
            TASM Q+KERLEKDL+EE+PQAARVKVLASGN  ERRFSVWIGGSILASLGSFQQMWFSK
Sbjct  368  TASMHQMKERLEKDLMEEAPQAARVKVLASGNVLERRFSVWIGGSILASLGSFQQMWFSK  427

Query  325  SEYEEHGASYVQRKCP  278
            +EYEEHG +YVQRKCP
Sbjct  428  AEYEEHGPTYVQRKCP  443



>ref|XP_008672855.1| PREDICTED: uncharacterized protein LOC100279759 isoform X1 [Zea 
mays]
 gb|ACF83607.1| unknown [Zea mays]
 tpg|DAA42881.1| TPA: actin-like protein 6A isoform 1 [Zea mays]
 tpg|DAA42882.1| TPA: actin-like protein 6A isoform 2 [Zea mays]
Length=443

 Score =   296 bits (758),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 176/195 (90%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESY+LYC + IASD+KE V R PDT +D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  250  LPNTTESYRLYCMRAIASDVKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PDILFNPSL QTIPG++ FA++   +RGL +MVI+S+++CDVDIR+EL+S+ILLSGG+
Sbjct  310  KVPDILFNPSLSQTIPGIDGFADS-IPVRGLQRMVIDSVNKCDVDIRKELFSNILLSGGS  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEESPQAARVKV+ASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  369  SSILQLKERLEKEVLEESPQAARVKVMASGNSVERRFSVWIGGSILASLGSFQQMWFSKA  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  429  EYEEHGVSYIQRKCP  443



>gb|ACG40489.1| actin-like protein 6A [Zea mays]
Length=443

 Score =   296 bits (758),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 176/195 (90%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESY+LYC + IASD+KE V R PDT +D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  250  LPNTTESYRLYCMRAIASDVKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PDILFNPSL QTIPG++ FA++   +RGL +MVI+S+++CDVDIR+EL+S+ILLSGG+
Sbjct  310  KVPDILFNPSLSQTIPGIDGFADS-IPVRGLQRMVIDSVNKCDVDIRKELFSNILLSGGS  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEESPQAARVKV+ASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  369  SSILQLKERLEKEVLEESPQAARVKVMASGNSVERRFSVWIGGSILASLGSFQQMWFSKA  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  429  EYEEHGVSYIQRKCP  443



>ref|XP_001778436.1| actin-related protein ARP4 [Physcomitrella patens]
 gb|EDQ56794.1| actin-related protein ARP4 [Physcomitrella patens]
Length=451

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 174/196 (89%), Gaps = 2/196 (1%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            PNTT+SY  Y Q+ I +DIKE + R PD+ +DDSSY+NIP TPYELPDGQ IE+GADRFK
Sbjct  256  PNTTDSYYAYAQRAIVADIKESICRVPDSAFDDSSYANIPTTPYELPDGQIIEVGADRFK  315

Query  679  IPDILFNPSLVQ-TIPGMESFA-ETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
            I DILFNP+++Q TIPGME+F+ E  T+  GLPQMVIESI++CDVD+RREL++S++L+GG
Sbjct  316  ISDILFNPTIIQQTIPGMENFSTEAGTTFYGLPQMVIESINKCDVDLRRELFNSVMLAGG  375

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
            TA+M Q+KERLEKDL+EE+P AARVKVLASGNA ERRFSVWIGGSILAS+GSFQQMWFSK
Sbjct  376  TAAMHQMKERLEKDLMEEAPPAARVKVLASGNALERRFSVWIGGSILASMGSFQQMWFSK  435

Query  325  SEYEEHGASYVQRKCP  278
            +EYEEHG +YVQRKCP
Sbjct  436  AEYEEHGPTYVQRKCP  451



>ref|XP_003559002.1| PREDICTED: actin-related protein 4 [Brachypodium distachyon]
Length=443

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 177/195 (91%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTT+SY+LYC + IASDIKE V R PDTPYD+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  250  FPNTTDSYRLYCMRAIASDIKESVCRVPDTPYDEVAYANVPTTSYELPDGQTIEVGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP L QTIPG++ F ++ T +RGLP+MV++S++RCDVDIR+EL SSILLSGG+
Sbjct  310  KIPDILFNPYLSQTIPGIDGFGDS-TPIRGLPRMVLDSVNRCDVDIRKELLSSILLSGGS  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEESPQ+ARVKVLASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  369  SSIIQLKERLEKEVLEESPQSARVKVLASGNSIERRFSVWIGGSILASLGSFQQMWFSKA  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  429  EYEEHGVSYIQRKCP  443



>ref|XP_009376700.1| PREDICTED: actin-related protein 4-like [Pyrus x bretschneideri]
 ref|XP_009376701.1| PREDICTED: actin-related protein 4-like [Pyrus x bretschneideri]
Length=154

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -1

Query  739  MTPYELPDGQTIEIGADRFKIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISR  560
            MT YELPDGQTIEIGADRFKIPDILFNPSL QTIPGME FAE A+++RGLPQMVIESI++
Sbjct  1    MTSYELPDGQTIEIGADRFKIPDILFNPSLAQTIPGMEHFAEIASTVRGLPQMVIESINK  60

Query  559  CDVDIRRELYSSILLSGGTASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWI  380
            CDVDIRREL+SSI+L+GGTASMQQLKERLEKD+LEESPQAARVKVL +GN+TERRFSVWI
Sbjct  61   CDVDIRRELFSSIMLAGGTASMQQLKERLEKDMLEESPQAARVKVLVAGNSTERRFSVWI  120

Query  379  GGSILASLGSFQQMWFSKSEYEEHGASYVQRKCP  278
            GGSILASLGSFQQMWFSK+EYEEHGASY+QRKCP
Sbjct  121  GGSILASLGSFQQMWFSKAEYEEHGASYIQRKCP  154



>ref|XP_006659807.1| PREDICTED: actin-related protein 4-like [Oryza brachyantha]
Length=443

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 173/195 (89%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESYKLYC + IASDIKE V R PDT +D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  250  LPNTTESYKLYCMRAIASDIKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL QTIPG++ FA+T +S RGLP+MVI+S++RCDVDIR+EL SSILLSGG+
Sbjct  310  KIPDILFNPSLSQTIPGVDGFADTMSS-RGLPRMVIDSVNRCDVDIRKELLSSILLSGGS  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEES    RVKVLASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  369  SSILQLKERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKA  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  429  EYEEHGVSYIQRKCP  443



>dbj|BAK04027.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 175/195 (90%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESY+LY  + IASDIKE V R PDTP+D+ +Y+N+P T YELPDGQTIE+GA+RF
Sbjct  250  FPNTTESYRLYHMRAIASDIKETVCRVPDTPFDEVAYANVPTTSYELPDGQTIEVGAERF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP L QTIPG++ F ++ TS+RGLP+MV++S++RCDVDIR+EL SSILLSGG+
Sbjct  310  KIPDILFNPYLSQTIPGIDGFGDS-TSIRGLPRMVLDSVNRCDVDIRKELLSSILLSGGS  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLK+RLEK++LEE PQ ARVKVLASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  369  SSILQLKDRLEKEVLEECPQNARVKVLASGNSIERRFSVWIGGSILASLGSFQQMWFSKA  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  429  EYEEHGVSYIQRKCP  443



>ref|NP_001060954.1| Os08g0137200 [Oryza sativa Japonica Group]
 sp|Q6ZJW9.1|ARP4_ORYSJ RecName: Full=Actin-related protein 4 [Oryza sativa Japonica 
Group]
 sp|A2YR10.2|ARP4_ORYSI RecName: Full=Actin-related protein 4 [Oryza sativa Indica Group]
 dbj|BAD03074.1| putative actin-related protein 4 (ARP4) [Oryza sativa Japonica 
Group]
 dbj|BAF22868.1| Os08g0137200 [Oryza sativa Japonica Group]
 dbj|BAG95134.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82868.1| hypothetical protein OsI_27738 [Oryza sativa Indica Group]
Length=443

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 173/195 (89%), Gaps = 1/195 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESYKLYC + IASDIKE V R PDT +D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  250  LPNTTESYKLYCMRAIASDIKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNPSL QTIPG++ FA++  S+RGLP+MVI+S++RCDVDIR+EL SSILLSGG+
Sbjct  310  KIPDILFNPSLSQTIPGVDGFADS-MSVRGLPRMVIDSVNRCDVDIRKELLSSILLSGGS  368

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEES    RVKVLASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  369  SSILQLKERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKA  428

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  429  EYEEHGVSYIQRKCP  443



>ref|NP_001146189.1| uncharacterized protein LOC100279759 [Zea mays]
 gb|ACL53430.1| unknown [Zea mays]
Length=214

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESY+LYC + IASD+KE V R PDT +D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  35   LPNTTESYRLYCMRAIASDVKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRF  94

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+PDILFNPSL QTIPG++ FA++   +RGL +MVI+S+++CDVDIR+EL+S+ILLSGG+
Sbjct  95   KVPDILFNPSLSQTIPGIDGFADS-IPVRGLQRMVIDSVNKCDVDIRKELFSNILLSGGS  153

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEESPQAARVKV+ASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  154  SSILQLKERLEKEVLEESPQAARVKVMASGNSVERRFSVWIGGSILASLGSFQQMWFSKA  213

Query  322  E  320
            E
Sbjct  214  E  214



>gb|KHN12240.1| Actin-related protein 4 [Glycine soja]
Length=162

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 150/195 (77%), Gaps = 42/195 (22%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKL+ Q+VIASDIKECV RAPDTPYD+S+YSNIPMT YELPDGQT+EIGADRF
Sbjct  10   FPNTTESYKLFSQRVIASDIKECVCRAPDTPYDESAYSNIPMTSYELPDGQTVEIGADRF  69

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSLVQ                                          L+GGT
Sbjct  70   KIPDVLFNPSLVQ------------------------------------------LAGGT  87

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS
Sbjct  88   ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  147

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGASY+QRKCP
Sbjct  148  EYEEHGASYIQRKCP  162



>ref|XP_004510131.1| PREDICTED: actin-related protein 4-like [Cicer arietinum]
Length=338

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASD+KECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIG+DRF
Sbjct  166  FPNTTESYKLYSQRVIASDVKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGSDRF  225

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL QTIP MESFAE A S+RGLPQMVI  I++CDVDIRREL+SSILL+GGT
Sbjct  226  KIPDVLFNPSLAQTIPCMESFAEIAPSVRGLPQMVIGRINKCDVDIRRELFSSILLAGGT  285

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRF  392
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRF
Sbjct  286  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRF  322



>gb|KJB83475.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
Length=405

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP+TTESY+LY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  244  FPHTTESYRLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPDILFNP L QTIPGM++FAE + S+RGLPQMVIESI+RCDVDIR+EL+ SILL+GGT
Sbjct  304  KIPDILFNPPLAQTIPGMDNFAEISPSVRGLPQMVIESINRCDVDIRKELFGSILLAGGT  363

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRF  392
            ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRF
Sbjct  364  ASMQQLKERLEKDLLEESPQAARVKVLASGNATERRF  400



>gb|AES98264.2| actin-related protein ARP4 [Medicago truncatula]
Length=419

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+ESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIP T YELPDGQTIEIGADRF
Sbjct  251  FPNTSESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPTTSYELPDGQTIEIGADRF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNPSL  +IPGMESFAE A S+RGLPQMVI+SI++CDVDIRREL+SSILL+GGT
Sbjct  311  KIPDVLFNPSLAHSIPGMESFAEIAPSVRGLPQMVIDSINKCDVDIRRELFSSILLAGGT  370

Query  502  ASMQQlkerlekdlleESPQAARVKVL  422
            ASMQQLKERLEKDLLEESPQAARVK L
Sbjct  371  ASMQQLKERLEKDLLEESPQAARVKCL  397



>ref|XP_007014881.1| Actin-related protein 4 isoform 2 [Theobroma cacao]
 gb|EOY32500.1| Actin-related protein 4 isoform 2 [Theobroma cacao]
Length=339

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTTESYKLY Q+VIASDIKECV RAPDTPYD+S+YSNIPMTPYELPDGQTIEIGADRF
Sbjct  202  FPNTTESYKLYSQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQTIEIGADRF  261

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIPD+LFNP L QTIPGM +FAE + S RGLPQMVIESI+RCDVDIR+EL+ SILL+GGT
Sbjct  262  KIPDVLFNPPLAQTIPGMNNFAEISPSFRGLPQMVIESINRCDVDIRKELFGSILLAGGT  321

Query  502  ASMQQ  488
            ASMQQ
Sbjct  322  ASMQQ  326



>gb|EEE68011.1| hypothetical protein OsJ_25972 [Oryza sativa Japonica Group]
Length=424

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 156/195 (80%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             PNTTESYKLYC + IASDIKE V R PDT +D+ +Y+N+P T YELPDGQ +       
Sbjct  235  LPNTTESYKLYCMRAIASDIKESVCRVPDTAFDEVAYANVPTTSYELPDGQLV----GHL  290

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
              P  L     + TIPG++ FA++  S+RGLP+MVI+S++RCDVDIR+EL SSILLSGG+
Sbjct  291  MNPTSLNCHGHLHTIPGVDGFADS-MSVRGLPRMVIDSVNRCDVDIRKELLSSILLSGGS  349

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            +S+ QLKERLEK++LEES    RVKVLASGN+ ERRFSVWIGGSILASLGSFQQMWFSK+
Sbjct  350  SSILQLKERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKA  409

Query  322  EYEEHGASYVQRKCP  278
            EYEEHG SY+QRKCP
Sbjct  410  EYEEHGVSYIQRKCP  424



>gb|EMT14913.1| Actin-related protein 4 [Aegilops tauschii]
Length=489

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 163/220 (74%), Gaps = 40/220 (18%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQ---------  710
            FPNTT+SY+LY  + IASDIKE V R PDTP+D+ +Y+N+P T YELPDGQ         
Sbjct  250  FPNTTDSYRLYHMRAIASDIKETVCRVPDTPFDEVAYANVPTTSYELPDGQGYNLSMLHL  309

Query  709  --TIEIGADRFKIPDILFNPSLVQ----------------------------TIPGMESF  620
              TIE+GA RFKIPDILFNP L Q                            TIPG++ F
Sbjct  310  SRTIEVGAARFKIPDILFNPFLSQEQNKFIASVDAINNNNNNNKAFCPKQVGTIPGIDGF  369

Query  619  AETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTASMQQlkerlekdlleESPQA  440
             ++ TS+RGLP+MV+ES++RCDVDIR+EL SSILLSGG++S+ QLK+RLEK++LEESPQ 
Sbjct  370  GDS-TSIRGLPRMVLESVNRCDVDIRKELLSSILLSGGSSSILQLKDRLEKEVLEESPQN  428

Query  439  ARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
            ARVKVLASGN+TERRFSVWIGGSILASLGSFQQMWFSK+E
Sbjct  429  ARVKVLASGNSTERRFSVWIGGSILASLGSFQQMWFSKAE  468



>gb|ABK26087.1| unknown [Picea sitchensis]
Length=130

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  667  LFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTASMQQ  488
            +FNPSL+Q +P ME       SLRGLPQMVIESI++CDVDIRREL+SSILL+GGTASMQQ
Sbjct  1    MFNPSLLQMMPHMEKLDNLGHSLRGLPQMVIESINKCDVDIRRELFSSILLAGGTASMQQ  60

Query  487  lkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEH  308
            +KERLEKDL+EE+PQAARVKVLASGNA ERRFSVWIGGSILASLGSFQQMWFSK+EYEEH
Sbjct  61   MKERLEKDLMEEAPQAARVKVLASGNAIERRFSVWIGGSILASLGSFQQMWFSKAEYEEH  120

Query  307  GASYVQRKCP  278
            GASY+QRKCP
Sbjct  121  GASYIQRKCP  130



>ref|XP_008359367.1| PREDICTED: actin-related protein 4-like [Malus domestica]
 ref|XP_008366520.1| PREDICTED: actin-related protein 4-like [Malus domestica]
Length=118

 Score =   195 bits (496),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -1

Query  631  MESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTASMQQlkerlekdlleE  452
            ME FAE A ++RGLPQMVIESI++CDVDIRREL+SSILL+GGTASMQQLKERLEKD+LEE
Sbjct  1    MEHFAEIAPTVRGLPQMVIESINKCDVDIRRELFSSILLAGGTASMQQLKERLEKDMLEE  60

Query  451  SPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYVQRKCP  278
            SPQAARVKVL +GN+TERRFSVWIGGSILASLGSFQQMWFSK+EYEEHGASY+QRKCP
Sbjct  61   SPQAARVKVLVAGNSTERRFSVWIGGSILASLGSFQQMWFSKAEYEEHGASYIQRKCP  118



>ref|XP_002504876.1| actin superfamily [Micromonas sp. RCC299]
 gb|ACO66134.1| actin superfamily [Micromonas sp. RCC299]
Length=433

 Score =   205 bits (522),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 135/194 (70%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P+   SY+L+ Q+ IA+D+KE V R  DT Y ++   N+P   YELPDG  I++G +R+K
Sbjct  240  PDVAASYRLFKQREIAADLKETVCRLSDTAYSEAENQNMPSMQYELPDGNVIDVGVERYK  299

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            IP++LF P L+                +GL Q+V+++I+RCDVD+R++L+  +LL+GG +
Sbjct  300  IPELLFQPDLINGFGLGADAPAGVKDAKGLSQLVLDNINRCDVDVRKDLFGGMLLAGGGS  359

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
               QL+ERLE +L + +P   RVKV AS NA ER+F+ WIGGSILASLGSFQQMW SK E
Sbjct  360  LFPQLRERLEAELHDAAPTNVRVKVTASQNAVERKFATWIGGSILASLGSFQQMWMSKQE  419

Query  319  YEEHGASYVQRKCP  278
            YEEHGA+ V RKCP
Sbjct  420  YEEHGANLVHRKCP  433



>gb|ERN20528.1| hypothetical protein AMTR_s00068p00197380 [Amborella trichopoda]
Length=121

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 117/121 (97%), Gaps = 1/121 (1%)
 Frame = -1

Query  640  IPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTASMQQlkerlekdl  461
            IPGME+  + +T +RGLPQMVI+SI++CDVDIRREL+SSILL+GGTASMQQ+KERLEKDL
Sbjct  2    IPGMENL-DNSTPIRGLPQMVIDSINKCDVDIRRELFSSILLAGGTASMQQVKERLEKDL  60

Query  460  leESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYVQRKC  281
            +EE+PQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE+EEHGASY+QRKC
Sbjct  61   MEEAPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSEFEEHGASYIQRKC  120

Query  280  P  278
            P
Sbjct  121  P  121



>ref|XP_005848140.1| hypothetical protein CHLNCDRAFT_145478 [Chlorella variabilis]
 gb|EFN56038.1| hypothetical protein CHLNCDRAFT_145478 [Chlorella variabilis]
Length=271

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P+TT SY+ +C + IA+DIK+ + R  D  +D    ++IP   YELPDGQ I +G DRF 
Sbjct  75   PHTTASYRAWCVEAIAADIKDTICRVSDNVFDPQENASIPTVMYELPDGQEIAVGTDRFA  134

Query  679  IPDILFNPSLVQTIPGMESFAETA---TSLRGLPQMVIESISRCDVDIRRELYSSILLSG  509
            IP++LFNP L++  P   +  + A     L+G+  +  + IS+CDVDIR++LY+ ++L+G
Sbjct  135  IPEVLFNPPLLEGYPRAAARLKEAGVFDGLQGIQHLANDCISKCDVDIRKDLYAGVVLTG  194

Query  508  GTASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFS  329
            GTA    L++RLEK++ + +PQ A+VKV+   NA ERR+SVWIGGSILASLG+FQQMW S
Sbjct  195  GTAGFAALRDRLEKEVADLAPQMAKVKVVCPANAVERRYSVWIGGSILASLGTFQQMWMS  254

Query  328  KSEYEEHGASYVQRKCP  278
            K+EY E+GA  + +K P
Sbjct  255  KAEYREYGAGLIHKKAP  271



>ref|XP_003060727.1| actin superfamily [Micromonas pusilla CCMP1545]
 gb|EEH55496.1| actin superfamily [Micromonas pusilla CCMP1545]
Length=451

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 137/199 (69%), Gaps = 6/199 (3%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P T+  Y+L+ Q+ IA+D+KE V R  D  + +    NIP   YELPDG  I+IG +RFK
Sbjct  254  PKTSAGYRLFKQREIAADLKETVFRLSDQTFSEEDNQNIPAVSYELPDGNVIDIGVERFK  313

Query  679  IPDILFNPSLVQTIPGMESFAETATS-----LRGLPQMVIESISRCDVDIRRELYSSILL  515
            IP++LF P L+ ++ G+   A   T       +GLP +++E+I++CDVD+R++L+  ++L
Sbjct  314  IPELLFQPHLISSL-GLGKDAPDLTDPDGSPAKGLPALILETINKCDVDVRKDLFGGMIL  372

Query  514  SGGTASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMW  335
            +GG +    L+ERLE +L + +P   RVKV AS N  ER+F+ WIGGSILASLGSFQQMW
Sbjct  373  AGGGSLFGSLRERLEAELHDAAPTNVRVKVTASANNAERKFTTWIGGSILASLGSFQQMW  432

Query  334  FSKSEYEEHGASYVQRKCP  278
             SK EYEEHGA+ + RKCP
Sbjct  433  MSKQEYEEHGATLIHRKCP  451



>ref|XP_005651985.1| putative Acttin-related protein 4 [Coccomyxa subellipsoidea C-169]
 gb|EIE27441.1| putative Acttin-related protein 4 [Coccomyxa subellipsoidea C-169]
Length=398

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 127/195 (65%), Gaps = 27/195 (14%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FP T+ SY+ +  + IA+D+KE + R  D P+D    ++IP   YELPDGQ I++G DRF
Sbjct  231  FPQTSPSYRQFNMEQIAADVKESIGRVSDGPFDAEQNASIPTVNYELPDGQEIQVGPDRF  290

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K+P++LFNP                           +SI+RCD ++RR+LYS ILL+GGT
Sbjct  291  KVPEVLFNP---------------------------DSINRCDAELRRDLYSGILLAGGT  323

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            A    L++RLE++L E +P   +VKV +  N+ ER+FSVWIGGSILASLGSFQQMW SK 
Sbjct  324  AMFTGLRDRLERELAEAAPHNCKVKVTSPANSLERKFSVWIGGSILASLGSFQQMWVSKK  383

Query  322  EYEEHGASYVQRKCP  278
            EYEEHGA  V RK P
Sbjct  384  EYEEHGAGIVHRKAP  398



>ref|XP_001417251.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95544.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=425

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 130/194 (67%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P TT SY L+ ++ I  D+K  V    D  ++   + N+    YELPDG TIE+G +RF+
Sbjct  232  PKTTASYALFKRREIIEDLKATVCTLDDHTFNSDEHKNVAGVTYELPDGNTIEVGVERFQ  291

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            IP++ F P +++ +           SL+ + ++V+E I+  DVD+R++L+ S++L GG++
Sbjct  292  IPELFFQPEILRELNVDVPELGELKSLKSIQELVLECINNADVDVRKDLWGSLVLCGGSS  351

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
                ++ERLE  L + +PQ  + KV+AS N+ ERRF+ WIGGSILASLGSFQQ+W SK E
Sbjct  352  MFANMRERLEAALFDHAPQNVKTKVVASMNSVERRFATWIGGSILASLGSFQQLWMSKQE  411

Query  319  YEEHGASYVQRKCP  278
            YEEHGA+ VQRKCP
Sbjct  412  YEEHGANLVQRKCP  425



>ref|XP_011398010.1| Actin-related protein 4 [Auxenochlorella protothecoides]
 gb|KFM25122.1| Actin-related protein 4 [Auxenochlorella protothecoides]
Length=470

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 0/193 (0%)
 Frame = -1

Query  856  NTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFKI  677
              T+SY+ +    IA D+K+ V R  D P+D    +NIP   YELPDGQ I++GADRF +
Sbjct  278  TATDSYRRHTVLSIAQDLKDAVCRVSDGPFDPEENANIPQVTYELPDGQEIQVGADRFAV  337

Query  676  PDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTAS  497
            P+ LFNP L+       +  + A +   L   V E ++RCDVD RRELY++ LL+GGTA 
Sbjct  338  PEALFNPGLLARYGAEGAPDDAAPAPAPLQAAVNECVARCDVDARRELYANALLTGGTAG  397

Query  496  MQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSEY  317
               L+ERLE+++ E +P  ARVK+++  N  ERR+SVWIGGS+LASLGSFQQMW SK+EY
Sbjct  398  FASLRERLEREVTEAAPALARVKLVSPSNPVERRYSVWIGGSVLASLGSFQQMWMSKAEY  457

Query  316  EEHGASYVQRKCP  278
             E+G   + +K P
Sbjct  458  AEYGPGLIHKKAP  470



>gb|EMT08634.1| Actin-related protein 4 [Aegilops tauschii]
Length=496

 Score =   180 bits (457),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTT+SY+LYC + IASDIKE V R PDTP+D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  250  FPNTTDSYRLYCMRAIASDIKESVCRVPDTPFDEVAYANVPTTSYELPDGQTIEVGADRF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILL  515
            KIPDILFNP L QTIPG++ F ++ TS+RGLP+MV++S++RCDVDIR+EL S+IL+
Sbjct  310  KIPDILFNPYLSQTIPGIDGFGDS-TSIRGLPRMVLDSVNRCDVDIRKELLSNILV  364


 Score = 44.7 bits (104),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 40/80 (50%), Gaps = 0/80 (0%)
 Frame = -3

Query  515  FWGNSINATTKRTS*ERFA*GISTSSKSQSTGKWKCNRKEIQCMDRGQYIGITWFFSANV  336
            FW   IN   KRT  +R   G+ +    +  GKWK N +  QC+D  ++  I+    ANV
Sbjct  370  FWWLVINPADKRTPRKRSTGGVPSKCSRKGFGKWKFNGEAFQCLDWREHSCISRVVPANV  429

Query  335  VFKI*V*RTWGFICSKKMSL  276
            V +  V   W F+  ++M +
Sbjct  430  VLQSRVRGAWRFLYPEEMPM  449



>ref|XP_003078795.1| Actin-related protein Arp2/3 complex, subunit Arp2 (ISS) [Ostreococcus 
tauri]
 emb|CAL51675.1| Actin-related protein [Ostreococcus tauri]
Length=424

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 129/194 (66%), Gaps = 0/194 (0%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P T+ SY L+ ++ I  D+K  V +  D  +    + N+    YELPDG TIE+GA+RF+
Sbjct  231  PKTSASYSLFKRREIVEDLKATVYQLNDHFFRGDEHKNVAGITYELPDGNTIEVGAERFQ  290

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            IP++LF P +++ +            L+ + ++V+E I+  DVD+R++L+ +++L GG +
Sbjct  291  IPELLFQPDILKDLDVNVPSLSGDVKLKSIQELVLECINNSDVDVRKDLWGNLVLCGGGS  350

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
                ++ERL+  L + +PQ  + KV+AS N+ ERRFS WIGGSILASLGSFQQ+W SK E
Sbjct  351  MFTNMRERLDGALFDHAPQNVKTKVVASMNSVERRFSTWIGGSILASLGSFQQLWMSKQE  410

Query  319  YEEHGASYVQRKCP  278
            YEEHGA+ V RKCP
Sbjct  411  YEEHGANLVLRKCP  424



>gb|KIZ06770.1| Actin-related protein 4 [Monoraphidium neglectum]
Length=263

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 127/194 (65%), Gaps = 1/194 (1%)
 Frame = -1

Query  856  NTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFKI  677
            N T SY  +  + +A D KE + +A DT ++D   +++P   YELPDG  + IG DRF++
Sbjct  70   NITASYDAWGLEQVAQDAKESLCKASDTTFNDQEGASMPYALYELPDGTELNIGPDRFRV  129

Query  676  PDILFNPSLVQTIPGMESFAET-ATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
             + LF+ + V + PGM++        L   P MV  +I  CD D+RRE +SSI+L+GGT+
Sbjct  130  TETLFSTARVSSFPGMDNDPLVLGRQLLSWPAMVKNAIDGCDGDVRREFWSSIVLTGGTS  189

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
                ++ERLE++L   +P   +VKV A  N TE+RF+ WIGGSIL+SLGSFQQMW SK+E
Sbjct  190  LTPNVRERLERELTALAPGGTKVKVNAPVNPTEKRFATWIGGSILSSLGSFQQMWMSKAE  249

Query  319  YEEHGASYVQRKCP  278
            +EEHGA  + RK P
Sbjct  250  FEEHGAGLIHRKSP  263



>ref|XP_007512384.1| unknown [Bathycoccus prasinos]
 emb|CCO16984.1| unknown [Bathycoccus prasinos]
Length=459

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 129/201 (64%), Gaps = 9/201 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYD--DSSYSNIPMTPYELPDGQTIEIGAD  689
            FP T++SY L  +  IA D K  V R  D   D  +S  + +P   YELPDG TIE+G +
Sbjct  262  FPKTSKSYNLLKRHQIAEDAKASVMRLSDVRLDLKNSEINQMPTVQYELPDGNTIEVGVE  321

Query  688  RFKIPDILFNPSLVQTI----PGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSI  521
            RF +P+I+FNP++V  +    P +    + A SL   P  V+ SI   DVD R++L+ ++
Sbjct  322  RFIVPEIMFNPAIVDELKLKGPPVVDDMQNAMSL---PAQVLASIQNADVDARKDLFGNV  378

Query  520  LLSGGTASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQ  341
            +L+GG       KERLE  + + +PQ  + KV AS NA ERRF+ WIGGSILASLGSFQQ
Sbjct  379  ILTGGGTMFVNCKERLESAIFDHAPQNVKTKVTASQNAVERRFATWIGGSILASLGSFQQ  438

Query  340  MWFSKSEYEEHGASYVQRKCP  278
            MW SK+EY+E+G S++ +KCP
Sbjct  439  MWMSKAEYDEYGVSHIHKKCP  459



>gb|EMS61463.1| hypothetical protein TRIUR3_27205 [Triticum urartu]
Length=743

 Score =   181 bits (458),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNTT+SY+LYC + IASDIKE V R PDTP+D+ +Y+N+P T YELPDGQTIE+GADRF
Sbjct  274  FPNTTDSYRLYCMRAIASDIKESVCRVPDTPFDEVAYANVPTTSYELPDGQTIEVGADRF  333

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILL  515
            KIPDILFNP L QTIPG++ F ++ TS+RGLP+MV++S++RCDVDIR+EL S+IL+
Sbjct  334  KIPDILFNPYLSQTIPGIDGFGDS-TSIRGLPRMVLDSVNRCDVDIRKELLSNILV  388



>gb|KEH17932.1| actin-related protein ARP4 [Medicago truncatula]
Length=275

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 96/126 (76%), Gaps = 22/126 (17%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT+E+YK Y Q                     S+YSNIP T YELPDGQTIEIGADRF
Sbjct  153  FPNTSENYKFYSQ---------------------SAYSNIPTTSYELPDGQTIEIGADRF  191

Query  682  KIPDILFNPSLVQ-TIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
            KIPD+LFNPSL Q +IPGMESFAE A S+RGLPQMVI+SI+ CDVDIRREL+SSILL+GG
Sbjct  192  KIPDVLFNPSLAQVSIPGMESFAEIALSVRGLPQMVIKSINECDVDIRRELFSSILLTGG  251

Query  505  TASMQQ  488
            TASMQ+
Sbjct  252  TASMQK  257



>gb|EFX88198.1| hypothetical protein DAPPUDRAFT_192057 [Daphnia pulex]
Length=429

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 122/195 (63%), Gaps = 9/195 (5%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +    +  D PYD+ + S IPM  YE P+G   + G +RF
Sbjct  244  LPEVTKSWHNYMMKEVIRDFQSTALQVADAPYDEETVSTIPMVHYEFPNGYHQDFGCERF  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS ++ +           ++ G+  +V  S+  CD+D+R  LY +++++GG 
Sbjct  304  KIPEALFDPSSIKGV---------GNTMLGVGHVVTTSVGMCDIDLRPSLYGNVIVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +    +RL +DL  ++PQ+ R+K++++  + ERRF  WIGGSILASLGSFQQMW SK 
Sbjct  355  SLLLGFSDRLNRDLSAKTPQSMRLKIISASGSGERRFGAWIGGSILASLGSFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G + V+RKCP
Sbjct  415  EYEEGGKTQVERKCP  429



>ref|XP_006803379.1| PREDICTED: actin-like protein 6A-like [Neolamprologus brichardi]
Length=228

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 120/195 (62%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+ T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  42   LPHVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  101

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  102  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  153

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  154  TLIQGFTDRLNRELSQKTPPSMRLKLIANSTTVERRFSAWIGGSILASLGTFQQMWISKQ  213

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  214  EYEEGGKQCVDRKCP  228



>ref|XP_001696669.1| actin-related protein [Chlamydomonas reinhardtii]
 gb|EDP08646.1| actin-related protein [Chlamydomonas reinhardtii]
Length=458

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 132/198 (67%), Gaps = 5/198 (3%)
 Frame = -1

Query  856  NTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFKI  677
              T SY++Y  + +ASD+KE V R  +  + ++   ++P   YELPDGQ + +G +RF++
Sbjct  261  GVTPSYRMYQVEQVASDMKEAVCRTSEARFFEAEGVSVPTMVYELPDGQELYLGPERFRM  320

Query  676  PDILFNPSLVQTIPGMESFAETATS---LRGL--PQMVIESISRCDVDIRRELYSSILLS  512
             ++ + P    T P  +  A    +   +R L   ++V+++I++CDVD+R+++YS  +L+
Sbjct  321  AELFYQPVRADTSPNYKGGAAATPAPCPVRHLHHAEVVLDTINKCDVDLRKDMYSGAILT  380

Query  511  GGTASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWF  332
            GGT+ +   +ERLEK+L +  P  A+VKV+A+ N  ERRFS WIGGSIL+SLGSFQQ+W 
Sbjct  381  GGTSLIHGFRERLEKELGDLVPSQAKVKVVAATNQVERRFSTWIGGSILSSLGSFQQLWM  440

Query  331  SKSEYEEHGASYVQRKCP  278
            SK EY EHGA  + RKCP
Sbjct  441  SKKEYAEHGAPLINRKCP  458



>ref|XP_011065381.1| PREDICTED: actin-like protein 6B [Acromyrmex echinatior]
 gb|EGI70016.1| Actin-like protein 6A [Acromyrmex echinatior]
Length=440

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKSWHNYMVKKVVQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSIVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_012058580.1| PREDICTED: actin-like protein 6B [Atta cephalotes]
Length=440

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKSWHNYMVKKVVQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSIVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_011329793.1| PREDICTED: actin-like protein 6B [Cerapachys biroi]
 ref|XP_011329795.1| PREDICTED: actin-like protein 6B [Cerapachys biroi]
 ref|XP_011329796.1| PREDICTED: actin-like protein 6B [Cerapachys biroi]
 gb|EZA59957.1| Actin-like protein 6A [Cerapachys biroi]
Length=440

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K I  D +  + +  +TPYD+   S IP   YE P G   E G++RF
Sbjct  251  LPEVTKSWHNYMVKKIIQDFQATILQVSETPYDEKIVSTIPAVQYEFPTGYHQEFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            ++P+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RMPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_007236717.1| PREDICTED: actin-like protein 6A [Astyanax mexicanus]
Length=307

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  121  LPQVTRSWHNYMCNTVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  180

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  181  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVIVTGGN  232

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  233  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  292

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  293  EYEEGGKQCVDRKCP  307



>dbj|BAK63837.1| actin-like 6A isoform 2 [Pan troglodytes]
Length=208

 Score =   159 bits (403),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  22   LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  81

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  82   KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  133

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  134  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  193

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  194  EYEEGGKQCVERKCP  208



>gb|KFM67516.1| Actin-like protein 6A, partial [Stegodyphus mimosarum]
Length=434

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 121/195 (62%), Gaps = 7/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +  Y+  +  N+P+  YE P+G   + G +RF
Sbjct  247  LPEVTKSWHNYMVKEVLQDFQSSVLQVYEAQYEKEAVENMPIVHYEFPNGYNQDFGTERF  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS ++ IP         T++ G  Q+V  S+  CD+D+R  LY  ++L+GG 
Sbjct  307  QIPEALFDPSNIKGIP-------NTTTMMGAAQVVTTSVGMCDIDVRPSLYGGVILTGGN  359

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   ERL +DL  ++P + R+KV++S N  ERRF  WIGGSILASLG+FQQMW +K 
Sbjct  360  TLIQGFTERLNRDLAAKTPPSMRLKVISSNNGAERRFGSWIGGSILASLGTFQQMWITKQ  419

Query  322  EYEEHGASYVQRKCP  278
            EY+E G + V+RKCP
Sbjct  420  EYDEGGKTQVERKCP  434



>ref|XP_008209454.1| PREDICTED: actin-like protein 6B [Nasonia vitripennis]
 ref|XP_008209455.1| PREDICTED: actin-like protein 6B [Nasonia vitripennis]
Length=439

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +    +  ++PYD+   S IP  PYE P G   + G++RF
Sbjct  250  LPEVTKSWHNYMVKKLVQDFQATCLQVSESPYDEKGVSTIPAVPYEFPTGYRQDFGSERF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  310  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  364

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  365  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGSWIGGSILASIGTFQQMWISSQ  424

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  425  EYEESGKSQVERKCP  439



>ref|XP_011640286.1| PREDICTED: LOW QUALITY PROTEIN: actin-like protein 6B [Pogonomyrmex 
barbatus]
Length=440

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKSWHNYMVKKVIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSIVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_011875237.1| PREDICTED: actin-like protein 6B [Vollenhovia emeryi]
Length=440

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKSWHNYMVKKVIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSIVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_001607305.1| PREDICTED: actin-like protein 6B [Nasonia vitripennis]
 ref|XP_003428217.1| PREDICTED: actin-like protein 6B [Nasonia vitripennis]
 ref|XP_008214907.1| PREDICTED: actin-like protein 6B [Nasonia vitripennis]
Length=439

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 119/195 (61%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +    +  ++PYD+   S IP  PYE P G   + G +RF
Sbjct  250  LPEVTKSWHNYMVKKLVQDFQATCLQVSESPYDEKGVSTIPAVPYEFPTGYRQDFGCERF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  310  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  364

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  365  SFIQGFPERLNRDLSMRIPSSMRLKMISANGCAERRFGSWIGGSILASIGTFQQMWISSQ  424

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  425  EYEESGKSQVERKCP  439



>gb|EAW78398.1| actin-like 6A, isoform CRA_b [Homo sapiens]
 gb|EAW78400.1| actin-like 6A, isoform CRA_b [Homo sapiens]
 dbj|BAK62907.1| actin-like protein 6A [Pan troglodytes]
Length=226

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  40   LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  99

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  100  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  151

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  152  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  211

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  212  EYEEGGKQCVERKCP  226



>ref|XP_011143432.1| PREDICTED: actin-like protein 6B [Harpegnathos saltator]
 gb|EFN81970.1| Actin-like protein 6A [Harpegnathos saltator]
Length=440

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 121/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  IPEVTKSWHNYMVKKVIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY+S++++GG 
Sbjct  311  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVATSVGMCDVDMRPSLYASVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSVRIPTSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>gb|KFZ49160.1| Actin-like 6A, partial [Podiceps cristatus]
Length=239

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  53   LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  112

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  113  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  164

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  165  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  224

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  225  EYEEGGKQCVERKCP  239



>ref|XP_625202.1| PREDICTED: brahma associated protein 55kd [Apis mellifera]
Length=440

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 119/195 (61%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKSWHNYMVKKLIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K+++     ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISVNGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_003702788.2| PREDICTED: actin-like protein 6B [Megachile rotundata]
Length=461

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 119/195 (61%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  272  LPEVTKSWHNYMVKKLIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  331

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  332  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  386

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K+++     ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  387  SFIQGFPERLNRDLSMRIPSSMRLKLISVNGCAERRFGAWIGGSILASIGTFQQMWISSQ  446

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  447  EYEESGKSQVERKCP  461



>ref|XP_006618378.1| PREDICTED: actin-like protein 6B-like [Apis dorsata]
Length=440

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 119/195 (61%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKSWHNYMVKKLIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K+++     ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISVNGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_011266307.1| PREDICTED: actin-like protein 6B [Camponotus floridanus]
 ref|XP_011266308.1| PREDICTED: actin-like protein 6B [Camponotus floridanus]
 gb|EFN61463.1| Actin-like protein 6A [Camponotus floridanus]
Length=440

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPEVSKSWHNYMVKKVIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_003400531.1| PREDICTED: actin-like protein 6A-like isoform 1 [Bombus terrestris]
 ref|XP_003400532.1| PREDICTED: actin-like protein 6A-like isoform 2 [Bombus terrestris]
Length=440

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 119/195 (61%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKSWHNYMVKKLIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPAGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K+++     ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISVNGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>gb|ELU05751.1| hypothetical protein CAPTEDRAFT_156089 [Capitella teleta]
Length=428

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 124/194 (64%), Gaps = 7/194 (4%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P  T+S+  Y  K +  D    V +  DTP+ + S  N+P + YE P+G   E G +RF+
Sbjct  242  PEVTKSFHNYMVKDVLQDFAASVLQVSDTPFAEESVDNMPASHYEFPNGYNQEFGVERFR  301

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            +P+ LF+PS+++ I G       + S+  +  +V  S+  CD+DIR  LY+S+++ GG +
Sbjct  302  VPEGLFDPSIIKGIEG-------SNSMLSMGHVVTTSVGLCDIDIRPGLYNSVIVVGGNS  354

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
             +    +RL +DL  ++P + ++KV++S  ++ERRFS WIGGSILASLGSFQQMW SK E
Sbjct  355  LLNGFTDRLSRDLSTKTPASMKLKVISSSVSSERRFSSWIGGSILASLGSFQQMWISKQE  414

Query  319  YEEHGASYVQRKCP  278
            YEE G   V++KCP
Sbjct  415  YEEGGKGCVEKKCP  428



>ref|NP_001106400.1| uncharacterized protein LOC100127559 [Xenopus (Silurana) tropicalis]
 gb|AAI52063.1| LOC100127559 protein [Xenopus (Silurana) tropicalis]
Length=425

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 128/196 (65%), Gaps = 10/196 (5%)
 Frame = -1

Query  862  FPNTTESYKLY-CQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADR  686
             P  T+S++ Y C +VI  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R
Sbjct  239  LPTVTKSWQNYMCNEVI-QDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAER  297

Query  685  FKIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
             +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG
Sbjct  298  LRIPEGLFDPSNVKGLSG--------NTMLGVGHVVTSSIGMCDIDIRPGLYGSVIVTGG  349

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
               +Q   +RL ++L +++P + R+K++AS ++ ERRFS WIGGSILASLG+FQQMW SK
Sbjct  350  NTLLQGFNDRLNRELSQKTPPSMRLKLIASNSSIERRFSSWIGGSILASLGTFQQMWISK  409

Query  325  SEYEEHGASYVQRKCP  278
             EYEE G   V+RKCP
Sbjct  410  QEYEEGGKQCVERKCP  425



>ref|XP_007552869.1| PREDICTED: actin-like protein 6A [Poecilia formosa]
Length=345

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  159  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  218

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  219  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  270

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  271  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  330

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  331  EYEEGGKQCVDRKCP  345



>ref|XP_003484999.1| PREDICTED: actin-like protein 6A-like isoform 1 [Bombus impatiens]
 ref|XP_003485000.1| PREDICTED: actin-like protein 6A-like isoform 2 [Bombus impatiens]
Length=440

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+ T+S+  Y  K +  D +  V +  +TPYD+   S IP   YE P G   + G++RF
Sbjct  251  LPDVTKSWHNYMVKKLIQDFQATVLQVSETPYDEKIVSTIPAVQYEFPAGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   G+        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSMVQMRGGL-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K+++     ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISVNGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_006627413.1| PREDICTED: actin-like protein 6B-like [Lepisosteus oculatus]
Length=426

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 128/196 (65%), Gaps = 10/196 (5%)
 Frame = -1

Query  862  FPNTTESYKLY-CQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADR  686
             P  T+S+  Y C +VI  D +  V +  D+PYD+   + +P   +E+P G T + GA+R
Sbjct  240  LPPVTKSWHTYMCNEVI-QDFQASVLQVSDSPYDEQVAAQMPTVHFEMPSGYTTDYGAER  298

Query  685  FKIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
             +IP+ LF+PS V+ + G         ++ G+  ++  SI  CD+DIR  LYSS++++GG
Sbjct  299  LRIPEGLFDPSNVKGLSG--------NTMLGVGHVITTSIGMCDIDIRPGLYSSVIVTGG  350

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
               +Q   ERL ++L +++P + R+K++AS ++ ERRFS WIGGSILASLG+FQQMW SK
Sbjct  351  NTLLQGFTERLNRELSQKAPPSMRLKLIASNSSMERRFSPWIGGSILASLGTFQQMWISK  410

Query  325  SEYEEHGASYVQRKCP  278
             EYEE G   V+RKCP
Sbjct  411  QEYEEWGKESVERKCP  426



>ref|XP_005746795.1| PREDICTED: actin-like protein 6A-like isoform X2 [Pundamilia 
nyererei]
Length=349

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  163  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  222

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  223  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  274

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  275  TLIQGFTDRLNRELSQKTPPSMRLKLIANSTTVERRFSAWIGGSILASLGTFQQMWISKQ  334

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  335  EYEEGGKQCVDRKCP  349



>gb|AAH45889.1| Actin-like 6A [Danio rerio]
 gb|AAI64585.1| Actl6a protein [Danio rerio]
Length=429

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 120/195 (62%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNTVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  +++ G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKSLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_011699800.1| PREDICTED: actin-like protein 6B [Wasmannia auropunctata]
Length=440

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+++  Y  K +  D +  V +  +TP+D+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKTWHNYMVKKVIQDFQATVLQVSETPFDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSIVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|XP_001521333.1| PREDICTED: actin-like protein 6A, partial [Ornithorhynchus anatinus]
Length=303

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  117  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  176

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  177  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  228

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  229  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  288

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  289  EYEEGGKQCVERKCP  303



>gb|EDL19263.1| actin-like 6B, isoform CRA_b [Mus musculus]
 gb|EDM13261.1| actin-like 6B (predicted), isoform CRA_b [Rattus norvegicus]
Length=290

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y    +  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R 
Sbjct  104  LPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  163

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  164  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  215

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ER+FS WIGGSILASLG+FQQMW SK 
Sbjct  216  TLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQ  275

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  276  EYEEGGKQCVERKCP  290



>ref|XP_002428884.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB16146.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=438

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 118/195 (61%), Gaps = 6/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P    S+  Y  K +  D +  V +  + PYD+   S IP   YE P+G   +   +RF
Sbjct  250  LPEVRSSWHNYMTKRVVQDFQMSVLQVAENPYDEKQVSTIPAVHYEFPNGYHQDFSCERF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS+VQ + GM        ++ G+  +V  S+  CDVD+R  LYS+++++GG 
Sbjct  310  KIPEALFDPSMVQ-MKGM-----VGNTMLGVAHIVTTSVGMCDVDVRPALYSNVVVTGGN  363

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++A G A ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  364  SFLQGFPERLNRDLSVRIPTSMRLKMIACGGAAERRFGAWIGGSILASIGTFQQMWISAQ  423

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  424  EYEEGGKVQVERKCP  438



>ref|XP_011172797.1| PREDICTED: actin-like protein 6B [Solenopsis invicta]
Length=440

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+S+  Y  + +  D +  V +  +TP+D+   S IP   YE P G   + G++RF
Sbjct  251  LPEVTKSWHNYMVRKVIQDFQATVLQVSETPFDEKIVSTIPAVQYEFPTGYHQDFGSERF  310

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  311  RIPEALFDPSIVQMPRGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  365

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  366  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  425

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  426  EYEESGKSQVERKCP  440



>ref|NP_775347.1| actin-like protein 6A [Danio rerio]
 gb|AAM28208.1| BRG1/brm-associated factor 53A [Danio rerio]
Length=429

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNTVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_010869611.1| PREDICTED: actin-like protein 6A isoform X2 [Esox lucius]
Length=429

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNTVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLTRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>gb|AAQ94585.1| BAF53 [Danio rerio]
Length=428

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  242  LPQVTRSWHNYMCNTVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  301

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  302  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  353

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  354  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  413

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  414  EYEEGGKQCVDRKCP  428



>ref|XP_010869610.1| PREDICTED: actin-like protein 6A isoform X1 [Esox lucius]
Length=434

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  248  LPQVTRSWHNYMCNTVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  307

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  308  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  359

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  360  TLIQGFTDRLTRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  419

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  420  EYEEGGKQCVDRKCP  434



>ref|XP_004032474.1| hypothetical protein IMG5_121850 [Ichthyophthirius multifiliis]
 gb|EGR30887.1| hypothetical protein IMG5_121850 [Ichthyophthirius multifiliis]
Length=405

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 119/194 (61%), Gaps = 6/194 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
            FPNT +SY+LYC+  IA DIKE + R  D          +  T YELPDG  I     R 
Sbjct  217  FPNTLQSYELYCKHQIARDIKENICRVDDKGLTVGEMQ-LERTEYELPDGNFIHFDTARS  275

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            K  +  F+P         +   E +   RG+  MV+E+I++CD+DI+R+L+++I+L+GG 
Sbjct  276  KFSEYFFSP-----FENSDMAEEDSLKFRGMHHMVLEAINQCDIDIKRQLFNNIILTGGN  330

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +     RL+  L + SP  ++VK++A  ++ ER+FS WIGGSILASLGSFQ +W  K 
Sbjct  331  SLLSGFSSRLQNKLNDISPPNSKVKMIAYPSSVERKFSSWIGGSILASLGSFQSLWIGKQ  390

Query  322  EYEEHGASYVQRKC  281
            EY EHG S V++KC
Sbjct  391  EYMEHGKSIVEKKC  404



>ref|XP_006810270.1| PREDICTED: actin-like protein 6A-like [Neolamprologus brichardi]
Length=435

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 120/195 (62%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+ T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  249  LPHVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  308

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  309  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  360

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  361  TLIQGFTDRLNRELSQKTPPSMRLKLIANSTTVERRFSAWIGGSILASLGTFQQMWISKQ  420

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  421  EYEEGGKQCVDRKCP  435



>ref|XP_008328111.1| PREDICTED: actin-like protein 6A [Cynoglossus semilaevis]
Length=429

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_005991979.1| PREDICTED: actin-like protein 6A [Latimeria chalumnae]
Length=429

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 120/195 (62%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YE P+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNGVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEFPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVIVAGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  415  EYEEGGKQCVERKCP  429



>ref|XP_008291929.1| PREDICTED: actin-like protein 6A isoform X2 [Stegastes partitus]
Length=429

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_008291928.1| PREDICTED: actin-like protein 6A isoform X1 [Stegastes partitus]
Length=433

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  247  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  306

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  307  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  358

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  359  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  418

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  419  EYEEGGKQCVDRKCP  433



>ref|XP_005800552.1| PREDICTED: actin-like protein 6A-like [Xiphophorus maculatus]
Length=429

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_011503708.1| PREDICTED: actin-like protein 6B [Ceratosolen solmsi marchali]
Length=439

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 118/195 (61%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+ T+S+  Y  K +  D +    +  + PYD+   S  P  PYE P G   + G +RF
Sbjct  250  IPDVTKSWHNYMVKKLVQDFQATCLQVSEIPYDEKIVSTTPAVPYEFPTGYRQDFGCERF  309

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  310  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  364

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  365  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGSWIGGSILASIGTFQQMWISSQ  424

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  425  EYEESGKSQVERKCP  439



>ref|XP_005165974.1| PREDICTED: actin-like protein 6A isoform X1 [Danio rerio]
Length=455

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  269  LPQVTRSWHNYMCNTVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  328

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  329  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  380

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  381  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  440

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  441  EYEEGGKQCVDRKCP  455



>ref|XP_008406236.1| PREDICTED: actin-like protein 6A [Poecilia reticulata]
Length=429

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_008550900.1| PREDICTED: actin-like protein 6B [Microplitis demolitor]
Length=451

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P+ T+S++ Y  K +  D +    +  +TPYD+   S IP   YE P G   +  ++RF
Sbjct  262  LPDVTKSWQNYMVKKLVQDFQASTLQISETPYDEKIVSTIPAVQYEFPTGYHQDFSSERF  321

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS+VQ   GM        ++ G+  +V  S+  CDVD+R  LY S++++GG 
Sbjct  322  RIPEALFDPSMVQMRGGM-----VGNTMLGVGHIVTTSVGMCDVDVRPALYGSVVVTGGN  376

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
            + +Q   ERL +DL    P + R+K++++    ERRF  WIGGSILAS+G+FQQMW S  
Sbjct  377  SFIQGFPERLNRDLSMRIPSSMRLKLISANGCAERRFGAWIGGSILASIGTFQQMWISSQ  436

Query  322  EYEEHGASYVQRKCP  278
            EYEE G S V+RKCP
Sbjct  437  EYEESGKSQVERKCP  451



>ref|XP_004570293.1| PREDICTED: actin-like protein 6A-like isoform X3 [Maylandia zebra]
 ref|XP_005746794.1| PREDICTED: actin-like protein 6A-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005931068.1| PREDICTED: actin-like protein 6A-like isoform X2 [Haplochromis 
burtoni]
Length=429

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANSTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_005931067.1| PREDICTED: actin-like protein 6A-like isoform X1 [Haplochromis 
burtoni]
Length=432

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  246  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  305

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  306  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  357

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  358  TLIQGFTDRLNRELSQKTPPSMRLKLIANSTTVERRFSAWIGGSILASLGTFQQMWISKQ  417

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  418  EYEEGGKQCVDRKCP  432



>ref|XP_006029648.1| PREDICTED: actin-like protein 6B-like [Alligator sinensis]
Length=430

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y    +  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R 
Sbjct  244  LPQVSKSWHNYTCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  303

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  304  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  355

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  356  TLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERRFSPWIGGSILASLGTFQQMWISKQ  415

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  416  EYEEGGKQCVERKCP  430



>ref|XP_004570292.1| PREDICTED: actin-like protein 6A-like isoform X2 [Maylandia zebra]
Length=432

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  246  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  305

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  306  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  357

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  358  TLIQGFTDRLNRELSQKTPPSMRLKLIANSTTVERRFSAWIGGSILASLGTFQQMWISKQ  417

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  418  EYEEGGKQCVDRKCP  432



>gb|KFO63835.1| Actin-like 6B, partial [Corvus brachyrhynchos]
Length=353

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  +    +  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R 
Sbjct  167  LPQVSKSWHNFTCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  226

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  227  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  278

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  279  TLLQGFTDRLNRELAQKTPPSMRLKLIASNSTMERRFSPWIGGSILASLGTFQQMWISKQ  338

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  339  EYEEGGKQCVERKCP  353



>ref|XP_008525567.1| PREDICTED: actin-like protein 6B isoform X3 [Equus przewalskii]
Length=345

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y    +  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R 
Sbjct  159  LPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  218

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  219  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  270

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ER+FS WIGGSILASLG+FQQMW SK 
Sbjct  271  TLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQ  330

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  331  EYEEGGKQCVERKCP  345



>ref|XP_004067770.1| PREDICTED: actin-like protein 6A [Oryzias latipes]
Length=429

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTMHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANSTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_003439834.1| PREDICTED: actin-like protein 6A-like isoform 1 [Oreochromis 
niloticus]
Length=429

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSPYDEQVAAQMPTMHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQGFTDRLNRELSQKTPPSMRLKLIANSTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_006262955.1| PREDICTED: actin-like protein 6B-like [Alligator mississippiensis]
Length=426

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y    +  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R 
Sbjct  240  LPQVSKSWHNYTCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  299

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  300  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  351

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  352  TLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERRFSPWIGGSILASLGTFQQMWISKQ  411

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  412  EYEEGGKQCVERKCP  426



>ref|XP_002817818.2| PREDICTED: actin-like protein 6B [Pongo abelii]
 ref|XP_010343017.1| PREDICTED: actin-like protein 6B isoform X2 [Saimiri boliviensis 
boliviensis]
 ref|XP_010607797.1| PREDICTED: actin-like protein 6B isoform X5 [Fukomys damarensis]
 gb|EAW76503.1| actin-like 6B, isoform CRA_b [Homo sapiens]
Length=345

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y    +  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R 
Sbjct  159  LPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  218

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  219  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  270

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ER+FS WIGGSILASLG+FQQMW SK 
Sbjct  271  TLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQ  330

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  331  EYEEGGKQCVERKCP  345



>ref|XP_009682183.1| PREDICTED: actin-like protein 6A isoform X2 [Struthio camelus 
australis]
 ref|XP_010715173.1| PREDICTED: actin-like protein 6A [Meleagris gallopavo]
Length=376

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  190  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  249

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  250  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  301

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  302  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  361

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  362  EYEEGGKQCVERKCP  376



>gb|KFP26311.1| Actin-like 6A, partial [Colius striatus]
Length=367

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  181  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  240

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  241  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  292

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  293  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  352

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  353  EYEEGGKQCVERKCP  367



>gb|KFO54818.1| Actin-like 6A, partial [Corvus brachyrhynchos]
Length=367

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  181  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  240

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  241  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  292

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  293  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  352

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  353  EYEEGGKQCVERKCP  367



>ref|XP_007518209.1| PREDICTED: actin-like protein 6A isoform X2 [Erinaceus europaeus]
Length=376

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  190  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  249

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  250  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  301

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  302  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  361

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  362  EYEEGGKQCVERKCP  376



>ref|XP_006232315.1| PREDICTED: actin-like protein 6A isoform X1 [Rattus norvegicus]
 ref|XP_008759152.1| PREDICTED: actin-like protein 6A isoform X1 [Rattus norvegicus]
 ref|XP_008759153.1| PREDICTED: actin-like protein 6A isoform X1 [Rattus norvegicus]
Length=377

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  191  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  250

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  251  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  302

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  303  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  362

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  363  EYEEGGKQCVERKCP  377



>ref|XP_004647348.1| PREDICTED: actin-like protein 6A isoform X2 [Octodon degus]
Length=376

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  190  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  249

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  250  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  301

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  302  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  361

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  362  EYEEGGKQCVERKCP  376



>ref|XP_006535566.1| PREDICTED: actin-like protein 6A isoform X1 [Mus musculus]
Length=377

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  191  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  250

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  251  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  302

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  303  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  362

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  363  EYEEGGKQCVERKCP  377



>ref|XP_008047151.1| PREDICTED: actin-like protein 6B, partial [Tarsius syrichta]
Length=336

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 122/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y    +  D +  V +  D PYD+   + +P   YE+P+G   + GA+R 
Sbjct  150  LPQVSKSWHNYMCNEVIQDFQASVLQVSDCPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  209

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  210  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  261

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ER+FS WIGGSILASLG+FQQMW SK 
Sbjct  262  TLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQ  321

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  322  EYEEGGKQCVERKCP  336



>gb|KFQ32022.1| Actin-like 6A, partial [Merops nubicus]
Length=363

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  177  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  236

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  237  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  288

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  289  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  348

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  349  EYEEGGKQCVERKCP  363



>gb|KGL88205.1| Actin-like 6A, partial [Charadrius vociferus]
Length=367

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  181  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  240

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  241  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  292

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  293  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  352

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  353  EYEEGGKQCVERKCP  367



>gb|KFV01543.1| Actin-like 6A, partial [Pterocles gutturalis]
Length=367

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  181  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  240

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  241  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  292

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  293  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  352

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  353  EYEEGGKQCVERKCP  367



>ref|XP_006132714.1| PREDICTED: actin-like protein 6B [Pelodiscus sinensis]
Length=428

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y    +  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R 
Sbjct  242  LPQVSKSWHNYTCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  301

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  302  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  353

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  354  TLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERRFSPWIGGSILASLGTFQQMWISKQ  413

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  414  EYEEGGKQCVERKCP  428



>gb|KGL76983.1| Actin-like 6A, partial [Tinamus guttatus]
Length=371

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFP19413.1| Actin-like 6A, partial [Egretta garzetta]
Length=371

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFV20323.1| Actin-like 6A, partial [Tauraco erythrolophus]
Length=363

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  177  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  236

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  237  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  288

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  289  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  348

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  349  EYEEGGKQCVERKCP  363



>gb|KFQ28004.1| Actin-like 6A, partial [Mesitornis unicolor]
Length=367

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  181  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  240

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  241  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  292

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  293  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  352

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  353  EYEEGGKQCVERKCP  367



>gb|KFP77679.1| Actin-like 6A, partial [Apaloderma vittatum]
Length=367

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  181  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  240

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  241  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  292

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  293  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  352

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  353  EYEEGGKQCVERKCP  367



>gb|KFQ63895.1| Actin-like 6A, partial [Pelecanus crispus]
Length=371

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>ref|XP_010395639.1| PREDICTED: actin-like protein 6A isoform X2 [Corvus cornix cornix]
Length=376

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  190  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  249

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  250  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  301

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  302  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  361

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  362  EYEEGGKQCVERKCP  376



>ref|XP_003794326.1| PREDICTED: actin-like protein 6A isoform 2 [Otolemur garnettii]
 ref|XP_003794327.1| PREDICTED: actin-like protein 6A isoform 3 [Otolemur garnettii]
 ref|XP_004591334.1| PREDICTED: actin-like protein 6A isoform X2 [Ochotona princeps]
 ref|XP_006183832.1| PREDICTED: actin-like protein 6A [Camelus ferus]
 ref|XP_006210679.1| PREDICTED: actin-like protein 6A isoform X2 [Vicugna pacos]
Length=387

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_007444616.1| PREDICTED: actin-like protein 6B-like, partial [Python bivittatus]
Length=466

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  ++S+  Y    +  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R 
Sbjct  280  LPQVSKSWHSYVCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERL  339

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG 
Sbjct  340  RIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGN  391

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++AS +  ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  392  TLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERRFSPWIGGSILASLGTFQQMWISKQ  451

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  452  EYEEGGKQCVERKCP  466



>gb|KFV85942.1| Actin-like 6A, partial [Struthio camelus australis]
Length=371

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFW90198.1| Actin-like 6A, partial [Phalacrocorax carbo]
Length=367

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  181  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  240

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  241  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  292

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  293  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  352

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  353  EYEEGGKQCVERKCP  367



>gb|KFR15061.1| Actin-like 6A, partial [Opisthocomus hoazin]
Length=371

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFQ02629.1| Actin-like 6A, partial [Haliaeetus albicilla]
Length=371

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFW65518.1| Actin-like 6A, partial [Pygoscelis adeliae]
 gb|KFW81410.1| Actin-like 6A, partial [Manacus vitellinus]
Length=371

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFV41246.1| Actin-like 6A, partial [Gavia stellata]
Length=371

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFV40481.1| Actin-like 6A, partial [Tyto alba]
 gb|KFV93221.1| Actin-like 6A, partial [Fulmarus glacialis]
Length=371

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFO13612.1| Actin-like 6A, partial [Balearica regulorum gibbericeps]
Length=371

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>ref|XP_007607109.1| PREDICTED: actin-like protein 6A isoform X2 [Cricetulus griseus]
Length=387

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>gb|KFQ15202.1| Actin-like 6A, partial [Leptosomus discolor]
Length=371

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>ref|XP_005383100.1| PREDICTED: actin-like protein 6A isoform X3 [Chinchilla lanigera]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>gb|KFW06112.1| Actin-like 6A, partial [Eurypyga helias]
Length=371

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>gb|KFP37110.1| Actin-like 6A, partial [Chlamydotis macqueenii]
Length=371

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  185  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  244

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  245  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  296

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  297  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  356

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  357  EYEEGGKQCVERKCP  371



>ref|XP_010591075.1| PREDICTED: actin-like protein 6A isoform X2 [Loxodonta africana]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_008836883.1| PREDICTED: actin-like protein 6A isoform X2 [Nannospalax galili]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_001496334.3| PREDICTED: actin-like 6A isoform X1 [Equus caballus]
 ref|XP_004003181.1| PREDICTED: actin-like protein 6A isoform X1 [Ovis aries]
 ref|XP_004398412.1| PREDICTED: actin-like protein 6A isoform 3 [Odobenus rosmarus 
divergens]
 ref|XP_005201696.1| PREDICTED: actin-like protein 6A isoform X1 [Bos taurus]
 ref|XP_005639787.1| PREDICTED: actin-like 6A isoform X5 [Canis lupus familiaris]
 ref|XP_005639788.1| PREDICTED: actin-like 6A isoform X6 [Canis lupus familiaris]
 ref|XP_005639789.1| PREDICTED: actin-like 6A isoform X7 [Canis lupus familiaris]
 ref|XP_005639790.1| PREDICTED: actin-like 6A isoform X8 [Canis lupus familiaris]
 ref|XP_005639791.1| PREDICTED: actin-like 6A isoform X9 [Canis lupus familiaris]
 ref|XP_005892564.1| PREDICTED: actin-like protein 6A isoform X2 [Bos mutus]
 ref|XP_005892565.1| PREDICTED: actin-like protein 6A isoform X3 [Bos mutus]
 ref|XP_005965169.1| PREDICTED: actin-like protein 6A isoform X2 [Pantholops hodgsonii]
 ref|XP_005965170.1| PREDICTED: actin-like protein 6A isoform X3 [Pantholops hodgsonii]
 ref|XP_006745864.1| PREDICTED: actin-like protein 6A isoform X2 [Leptonychotes weddellii]
 ref|XP_006745865.1| PREDICTED: actin-like protein 6A isoform X3 [Leptonychotes weddellii]
 ref|XP_007094644.1| PREDICTED: actin-like protein 6A [Panthera tigris altaica]
 ref|XP_007466759.1| PREDICTED: actin-like protein 6A isoform X4 [Lipotes vexillifer]
 ref|XP_008519305.1| PREDICTED: actin-like protein 6A isoform X2 [Equus przewalskii]
 ref|XP_008519374.1| PREDICTED: actin-like protein 6A isoform X2 [Equus przewalskii]
 ref|XP_008703524.1| PREDICTED: actin-like protein 6A isoform X2 [Ursus maritimus]
 ref|XP_008703525.1| PREDICTED: actin-like protein 6A isoform X2 [Ursus maritimus]
 ref|XP_011216829.1| PREDICTED: actin-like protein 6A isoform X2 [Ailuropoda melanoleuca]
 ref|XP_011216835.1| PREDICTED: actin-like protein 6A isoform X2 [Ailuropoda melanoleuca]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_003256549.1| PREDICTED: actin-like protein 6A isoform 2 [Nomascus leucogenys]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>gb|KFQ41526.1| Actin-like 6A, partial [Nestor notabilis]
Length=372

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  186  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  245

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  246  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  297

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  298  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  357

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  358  EYEEGGKQCVERKCP  372



>ref|NP_817126.1| actin-like protein 6A isoform 2 [Homo sapiens]
 ref|NP_829888.1| actin-like protein 6A isoform 2 [Homo sapiens]
 ref|NP_001258600.1| actin-like protein 6A [Pan troglodytes]
 ref|XP_004038094.1| PREDICTED: actin-like protein 6A isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004038095.1| PREDICTED: actin-like protein 6A isoform 3 [Gorilla gorilla gorilla]
 ref|XP_005546498.1| PREDICTED: actin-like protein 6A isoform X2 [Macaca fascicularis]
 ref|XP_007970222.1| PREDICTED: actin-like protein 6A isoform X2 [Chlorocebus sabaeus]
 ref|XP_008979504.1| PREDICTED: actin-like protein 6A isoform X2 [Callithrix jacchus]
 ref|XP_009199585.1| PREDICTED: actin-like protein 6A isoform X2 [Papio anubis]
 ref|XP_009199586.1| PREDICTED: actin-like protein 6A isoform X2 [Papio anubis]
 ref|XP_011835773.1| PREDICTED: actin-like protein 6A isoform X2 [Mandrillus leucophaeus]
 ref|XP_011835774.1| PREDICTED: actin-like protein 6A isoform X2 [Mandrillus leucophaeus]
 ref|XP_011753439.1| PREDICTED: actin-like protein 6A [Macaca nemestrina]
 ref|XP_011941640.1| PREDICTED: actin-like protein 6A isoform X2 [Cercocebus atys]
 ref|XP_011941641.1| PREDICTED: actin-like protein 6A isoform X2 [Cercocebus atys]
 gb|AAH00949.1| Actin-like 6A [Homo sapiens]
 dbj|BAB87844.1| hArpNbeta-s [Homo sapiens]
 dbj|BAB87848.1| hArpNbeta-s [Homo sapiens]
 gb|EAW78397.1| actin-like 6A, isoform CRA_a [Homo sapiens]
 gb|EAW78399.1| actin-like 6A, isoform CRA_a [Homo sapiens]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_004675047.1| PREDICTED: actin-like protein 6A isoform X2 [Condylura cristata]
 ref|XP_004675048.1| PREDICTED: actin-like protein 6A isoform X3 [Condylura cristata]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>gb|KFP80771.1| Actin-like 6A, partial [Acanthisitta chloris]
Length=372

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  186  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  245

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  246  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  297

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  298  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  357

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  358  EYEEGGKQCVERKCP  372



>gb|KFP55361.1| Actin-like 6A, partial [Cariama cristata]
 gb|KFR06035.1| Actin-like 6A, partial [Nipponia nippon]
 gb|KFU84194.1| Actin-like 6A, partial [Chaetura pelagica]
Length=368

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  182  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  241

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  242  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  293

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  294  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  353

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  354  EYEEGGKQCVERKCP  368



>gb|KFO83098.1| Actin-like 6A, partial [Buceros rhinoceros silvestris]
Length=368

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  182  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  241

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  242  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  293

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  294  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  353

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  354  EYEEGGKQCVERKCP  368



>ref|XP_007946464.1| PREDICTED: actin-like protein 6A isoform X2 [Orycteropus afer 
afer]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_006162791.1| PREDICTED: actin-like protein 6A isoform X2 [Tupaia chinensis]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>gb|KFQ87125.1| Actin-like 6A, partial [Phoenicopterus ruber ruber]
Length=368

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  182  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  241

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  242  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  293

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  294  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  353

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  354  EYEEGGKQCVERKCP  368



>gb|KFQ73026.1| Actin-like 6A, partial [Phaethon lepturus]
Length=368

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  182  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  241

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  242  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  293

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  294  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  353

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  354  EYEEGGKQCVERKCP  368



>gb|KFM13458.1| Actin-like 6A [Aptenodytes forsteri]
Length=379

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  193  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  252

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  253  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  304

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  305  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  364

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  365  EYEEGGKQCVERKCP  379



>ref|XP_004901946.1| PREDICTED: actin-like protein 6A isoform X2 [Heterocephalus glaber]
 ref|XP_004834692.1| PREDICTED: actin-like protein 6A isoform X2 [Heterocephalus glaber]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_008139639.1| PREDICTED: actin-like protein 6B isoform X2 [Eptesicus fuscus]
Length=385

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 126/196 (64%), Gaps = 10/196 (5%)
 Frame = -1

Query  862  FPNTTESYKLY-CQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADR  686
             P  ++S+  Y C +VI  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R
Sbjct  199  LPQVSKSWHNYMCNEVI-QDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAER  257

Query  685  FKIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
             +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG
Sbjct  258  LRIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGG  309

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
               +Q   +RL ++L +++P + R+K++AS +  ER+FS WIGGSILASLG+FQQMW SK
Sbjct  310  NTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISK  369

Query  325  SEYEEHGASYVQRKCP  278
             EYEE G   V+RKCP
Sbjct  370  QEYEEGGKQCVERKCP  385



>ref|XP_006867762.1| PREDICTED: actin-like protein 6A isoform X2 [Chrysochloris asiatica]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_004424766.1| PREDICTED: actin-like protein 6A isoform 2 [Ceratotherium simum 
simum]
Length=387

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>gb|KFV69681.1| Actin-like 6A, partial [Picoides pubescens]
Length=368

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  182  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  241

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  242  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  293

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  294  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  353

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  354  EYEEGGKQCVERKCP  368



>ref|XP_004708659.1| PREDICTED: actin-like protein 6A isoform X2 [Echinops telfairi]
 ref|XP_004708660.1| PREDICTED: actin-like protein 6A isoform X3 [Echinops telfairi]
Length=387

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>gb|KFO96088.1| Actin-like 6A, partial [Calypte anna]
Length=384

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  198  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  257

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  258  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  309

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  310  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  369

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  370  EYEEGGKQCVERKCP  384



>ref|XP_005670065.1| PREDICTED: actin-like 6A isoform X3 [Sus scrofa]
Length=387

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_009682182.1| PREDICTED: actin-like protein 6A isoform X1 [Struthio camelus 
australis]
Length=404

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  218  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  277

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  278  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  329

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  330  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  389

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  390  EYEEGGKQCVERKCP  404



>ref|XP_010335894.1| PREDICTED: LOW QUALITY PROTEIN: actin-like protein 6A [Saimiri 
boliviensis boliviensis]
Length=389

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  203  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  262

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  263  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  314

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  315  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  374

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  375  EYEEGGKQCVERKCP  389



>gb|EFA84276.1| actin-like protein 6A [Polysphondylium pallidum PN500]
Length=425

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 119/194 (61%), Gaps = 12/194 (6%)
 Frame = -1

Query  859  PNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRFK  680
            P  TESY+ Y       D+KE   R  +    D    NI   PYELPDG  +E+G+DRF+
Sbjct  244  PELTESYRRYVSLETIRDLKESSFRVSNGAVGDDI--NIATVPYELPDGNLLEVGSDRFQ  301

Query  679  IPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGTA  500
            IP+++FNP+         S  +   +   LP+M+ +S+ +CD DIR+EL +++LLSGG  
Sbjct  302  IPELMFNPT---------SLNDETNNYLPLPKMIYDSVEKCDTDIRKELIANLLLSGGNT  352

Query  499  SMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKSE  320
              Q   +RL  +L + S    +VK +   +A ER++SVWIGGSIL SLG+FQQMW SKSE
Sbjct  353  LFQGFSDRLYMELGDLSQAFGKVKFVVP-SANERKYSVWIGGSILGSLGTFQQMWMSKSE  411

Query  319  YEEHGASYVQRKCP  278
            +EE G   V++KCP
Sbjct  412  WEEFGRPLVEKKCP  425



>ref|XP_002162686.1| PREDICTED: actin-like protein 6A-like [Hydra vulgaris]
Length=424

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 124/195 (64%), Gaps = 5/195 (3%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T+SYK Y +  +  D ++   +  D+P+  S   N+P   YE P+G   ++G +RF
Sbjct  235  LPPLTDSYKTYMKSELIRDFQKNCLQVSDSPFVQSELENVPGFHYEFPNGYNRQVGIERF  294

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            +I + LF+ + ++ I G ES     T+L G P ++   I  CD+DIR  LY+SI++ GG 
Sbjct  295  RISEGLFDTTHIKNIKGFES-----TTLLGAPHVINTCIGMCDIDIRPALYNSIVVVGGN  349

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +    ERL ++LL+++P   R+K++++  ++ERRFS WIGGSIL SLGSFQQMW SK 
Sbjct  350  TLINGFVERLNRELLQKTPSNMRLKLVSNNQSSERRFSSWIGGSILGSLGSFQQMWVSKQ  409

Query  322  EYEEHGASYVQRKCP  278
            EYEE GA  V++KCP
Sbjct  410  EYEESGAKVVEKKCP  424



>ref|XP_006884087.1| PREDICTED: actin-like protein 6A isoform X2 [Elephantulus edwardii]
 ref|XP_006884088.1| PREDICTED: actin-like protein 6A isoform X3 [Elephantulus edwardii]
Length=387

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>gb|ETE60477.1| Actin-like protein 6A, partial [Ophiophagus hannah]
Length=422

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  236  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSAYDEQVAAQMPTVHYEFPNGYNCDFGAERL  295

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  296  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  347

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  348  TLLQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  407

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  408  EYEEGGKQCVERKCP  422



>ref|XP_009286318.1| PREDICTED: actin-like protein 6A isoform X2 [Aptenodytes forsteri]
Length=398

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  212  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  271

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  272  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  323

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  324  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  383

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  384  EYEEGGKQCVERKCP  398



>dbj|BAE41036.1| unnamed protein product [Mus musculus]
Length=429

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  415  EYEEEGKQCVERKCP  429



>ref|XP_006770085.1| PREDICTED: actin-like protein 6A [Myotis davidii]
Length=387

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  201  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  260

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  261  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  312

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  313  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  372

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  373  EYEEGGKQCVERKCP  387



>ref|XP_007422848.1| PREDICTED: actin-like protein 6A [Python bivittatus]
Length=429

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSAYDEQVAAQMPTVHYEFPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLLQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  415  EYEEGGKQCVERKCP  429



>ref|XP_010176442.1| PREDICTED: actin-like protein 6A [Caprimulgus carolinensis]
Length=407

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  221  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  280

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  281  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  332

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  333  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  392

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  393  EYEEGGKQCVERKCP  407



>emb|CDQ58638.1| unnamed protein product [Oncorhynchus mykiss]
Length=429

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+PYD+   + +P   YELP+G   + GA+R 
Sbjct  243  LPQVTRSWHNYMCNTVIQDFQASVLQVSDSPYDEQVAAQMPTVHYELPNGYNCDFGAERL  302

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS  + + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  303  KIPEGLFDPSNAKGLSG--------NTMLGVGHVVTTSVGMCDIDIRPGLYGSVVVTGGN  354

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +    +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  355  TLISGFTDRLTRELSQKTPPSMRLKLIANNTTVERRFSAWIGGSILASLGTFQQMWISKQ  414

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V RKCP
Sbjct  415  EYEEGGKQCVDRKCP  429



>ref|XP_005051313.1| PREDICTED: actin-like protein 6A [Ficedula albicollis]
Length=416

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  230  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  289

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  290  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  341

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  342  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  401

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  402  EYEEGGKQCVERKCP  416



>ref|XP_009969016.1| PREDICTED: actin-like protein 6A [Tyto alba]
Length=416

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  230  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  289

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  290  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  341

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  342  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  401

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  402  EYEEGGKQCVERKCP  416



>ref|XP_010202825.1| PREDICTED: LOW QUALITY PROTEIN: actin-like protein 6A [Colius 
striatus]
Length=416

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = -1

Query  862  FPNTTESYKLYCQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADRF  683
             P  T S+  Y    +  D +  V +  D+ YD+   + +P   YE P+G   + GA+R 
Sbjct  230  LPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERL  289

Query  682  KIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGGT  503
            KIP+ LF+PS V+ + G         ++ G+  +V  S+  CD+DIR  LY S++++GG 
Sbjct  290  KIPEGLFDPSNVKGLSG--------NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGN  341

Query  502  ASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSKS  323
              +Q   +RL ++L +++P + R+K++A+    ERRFS WIGGSILASLG+FQQMW SK 
Sbjct  342  TLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQ  401

Query  322  EYEEHGASYVQRKCP  278
            EYEE G   V+RKCP
Sbjct  402  EYEEGGKQCVERKCP  416



>ref|XP_003470003.1| PREDICTED: actin-like protein 6B [Cavia porcellus]
Length=426

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 126/196 (64%), Gaps = 10/196 (5%)
 Frame = -1

Query  862  FPNTTESYKLY-CQKVIASDIKECVSRAPDTPYDDSSYSNIPMTPYELPDGQTIEIGADR  686
             P  ++S+  Y C +VI  D +  V +  D+PYD+   + +P   YE+P+G   + GA+R
Sbjct  240  LPQVSKSWHNYMCNEVI-QDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAER  298

Query  685  FKIPDILFNPSLVQTIPGMESFAETATSLRGLPQMVIESISRCDVDIRRELYSSILLSGG  506
             +IP+ LF+PS V+ + G         ++ G+  +V  SI  CD+DIR  LY S++++GG
Sbjct  299  LRIPEGLFDPSNVKGLSG--------NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGG  350

Query  505  TASMQQlkerlekdlleESPQAARVKVLASGNATERRFSVWIGGSILASLGSFQQMWFSK  326
               +Q   +RL ++L +++P + R+K++AS +  ER+FS WIGGSILASLG+FQQMW SK
Sbjct  351  NTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISK  410

Query  325  SEYEEHGASYVQRKCP  278
             EYEE G   V+RKCP
Sbjct  411  QEYEEGGKQCVERKCP  426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1908683925587