BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5465

Length=1014
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...    102   2e-20   Solanum tuberosum [potatoes]
ref|XP_009609967.1|  PREDICTED: late blight resistance protein R1...    100   4e-20   Nicotiana tomentosiformis
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...  98.6    5e-19   Solanum lycopersicum
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  97.4    1e-18   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...  96.7    2e-18   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...  96.3    2e-18   Nicotiana tomentosiformis
emb|CDP19489.1|  unnamed protein product                              96.7    2e-18   Coffea canephora [robusta coffee]
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...  96.3    2e-18   
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...  94.7    7e-18   Nicotiana sylvestris
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...  94.4    1e-17   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...  94.0    1e-17   Solanum lycopersicum
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...  94.0    2e-17   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...  94.0    2e-17   
emb|CDP20519.1|  unnamed protein product                              93.6    2e-17   Coffea canephora [robusta coffee]
emb|CDP21622.1|  unnamed protein product                              93.2    3e-17   Coffea canephora [robusta coffee]
ref|XP_009784309.1|  PREDICTED: putative late blight resistance p...  90.1    3e-17   Nicotiana sylvestris
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...  92.4    4e-17   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...  92.4    4e-17   Nicotiana sylvestris
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...  92.4    4e-17   Nicotiana sylvestris
emb|CDP05499.1|  unnamed protein product                              92.4    5e-17   Coffea canephora [robusta coffee]
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...  92.4    5e-17   Nicotiana tomentosiformis
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...  92.0    5e-17   Nicotiana tomentosiformis
gb|AEW48190.1|  disease resistance protein RX4                        92.0    7e-17   Solanum albicans
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  91.7    7e-17   Nicotiana tomentosiformis
emb|CDP18675.1|  unnamed protein product                              92.0    7e-17   Coffea canephora [robusta coffee]
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  91.7    7e-17   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  91.7    8e-17   Nicotiana tomentosiformis
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...  91.3    1e-16   Nicotiana sylvestris
emb|CDP20463.1|  unnamed protein product                              90.9    2e-16   Coffea canephora [robusta coffee]
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  90.5    2e-16   Solanum lycopersicum
ref|XP_006367921.1|  PREDICTED: putative late blight resistance p...  88.6    3e-16   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  90.1    3e-16   Sesamum indicum [beniseed]
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...  89.7    3e-16   
gb|AEW48201.1|  disease resistance protein RGH9                       89.4    4e-16   Solanum x edinense
emb|CDP19994.1|  unnamed protein product                              89.7    4e-16   Coffea canephora [robusta coffee]
emb|CAB56299.1|  NBS-LRR protein                                      89.4    4e-16   Solanum acaule
gb|AEW48216.1|  disease resistance protein RX3                        89.4    4e-16   Solanum leptophyes x Solanum sparsipilum
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...  89.0    5e-16   Solanum lycopersicum
ref|XP_009764269.1|  PREDICTED: putative late blight resistance p...  89.0    5e-16   Nicotiana sylvestris
gb|AEW48218.1|  disease resistance protein RX6                        88.6    7e-16   Solanum hondelmannii
ref|XP_006364072.1|  PREDICTED: putative late blight resistance p...  88.2    7e-16   
gb|AEW48217.1|  disease resistance protein RX5                        88.6    8e-16   Solanum stenotomum
emb|CAB50786.1|  Rx protein                                           88.2    9e-16   Solanum tuberosum [potatoes]
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...  88.2    1e-15   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...  87.4    2e-15   Solanum tuberosum [potatoes]
emb|CDP15705.1|  unnamed protein product                              87.4    2e-15   Coffea canephora [robusta coffee]
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...  87.0    2e-15   Nicotiana tomentosiformis
ref|XP_009589795.1|  PREDICTED: putative late blight resistance p...  86.3    4e-15   Nicotiana tomentosiformis
emb|CDP12770.1|  unnamed protein product                              86.3    4e-15   Coffea canephora [robusta coffee]
emb|CDP19634.1|  unnamed protein product                              86.7    4e-15   Coffea canephora [robusta coffee]
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...  86.3    4e-15   Sesamum indicum [beniseed]
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...  85.1    5e-15   Nicotiana sylvestris
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...  84.7    6e-15   Nicotiana sylvestris
emb|CDP18682.1|  unnamed protein product                              85.9    6e-15   Coffea canephora [robusta coffee]
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...  85.5    7e-15   
emb|CDP18680.1|  unnamed protein product                              85.5    1e-14   Coffea canephora [robusta coffee]
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  85.1    1e-14   Sesamum indicum [beniseed]
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...  85.1    1e-14   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              84.7    1e-14   Erythranthe guttata [common monkey flower]
emb|CDP10671.1|  unnamed protein product                              84.7    1e-14   Coffea canephora [robusta coffee]
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  80.1    2e-14   
gb|AEW48205.1|  disease resistance protein RGH2                       84.3    2e-14   Solanum fernandezianum
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...  84.3    2e-14   Nicotiana tomentosiformis
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...  84.0    2e-14   Sesamum indicum [beniseed]
ref|XP_010319214.1|  PREDICTED: putative late blight resistance p...  84.0    2e-14   Solanum lycopersicum
ref|XP_009782925.1|  PREDICTED: putative late blight resistance p...  83.6    3e-14   Nicotiana sylvestris
ref|XP_011087335.1|  PREDICTED: putative late blight resistance p...  83.6    3e-14   
gb|EYU17661.1|  hypothetical protein MIMGU_mgv1a025742mg              83.2    4e-14   Erythranthe guttata [common monkey flower]
emb|CDP17260.1|  unnamed protein product                              83.2    4e-14   Coffea canephora [robusta coffee]
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...  83.2    5e-14   
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...  79.7    6e-14   
emb|CDP05558.1|  unnamed protein product                              82.8    7e-14   Coffea canephora [robusta coffee]
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...  82.8    7e-14   Nicotiana sylvestris
ref|XP_009772629.1|  PREDICTED: late blight resistance protein R1...  82.4    7e-14   Nicotiana sylvestris
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...  82.4    7e-14   
emb|CDP18040.1|  unnamed protein product                              82.4    8e-14   Coffea canephora [robusta coffee]
ref|XP_006365681.1|  PREDICTED: putative late blight resistance p...  82.4    8e-14   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...  82.4    8e-14   Solanum lycopersicum
gb|EYU31552.1|  hypothetical protein MIMGU_mgv1a025226mg              82.4    9e-14   Erythranthe guttata [common monkey flower]
gb|EYU19036.1|  hypothetical protein MIMGU_mgv1a021264mg              82.0    9e-14   Erythranthe guttata [common monkey flower]
ref|XP_009776932.1|  PREDICTED: putative late blight resistance p...  77.8    9e-14   Nicotiana sylvestris
ref|XP_006367977.1|  PREDICTED: putative late blight resistance p...  79.3    9e-14   Solanum tuberosum [potatoes]
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...  82.4    9e-14   Solanum lycopersicum
emb|CDP11548.1|  unnamed protein product                              82.4    9e-14   Coffea canephora [robusta coffee]
emb|CDP12799.1|  unnamed protein product                              82.4    9e-14   Coffea canephora [robusta coffee]
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              82.0    9e-14   Erythranthe guttata [common monkey flower]
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...  82.0    9e-14   Sesamum indicum [beniseed]
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...  82.0    9e-14   Nicotiana sylvestris
emb|CDP00736.1|  unnamed protein product                              82.0    1e-13   Coffea canephora [robusta coffee]
emb|CDP12821.1|  unnamed protein product                              82.4    1e-13   Coffea canephora [robusta coffee]
ref|XP_006345615.1|  PREDICTED: putative late blight resistance p...  78.6    1e-13   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  82.0    1e-13   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...  82.0    1e-13   Solanum lycopersicum
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  82.0    1e-13   Solanum tuberosum [potatoes]
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  82.0    1e-13   
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  79.0    1e-13   Nicotiana sylvestris
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  81.6    1e-13   Sesamum indicum [beniseed]
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  82.0    1e-13   Nicotiana tomentosiformis
emb|CDP12774.1|  unnamed protein product                              82.0    1e-13   Coffea canephora [robusta coffee]
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...  81.6    1e-13   Sesamum indicum [beniseed]
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...  81.6    1e-13   Nicotiana sylvestris
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  81.6    1e-13   
emb|CDP16512.1|  unnamed protein product                              81.6    2e-13   Coffea canephora [robusta coffee]
ref|XP_009762295.1|  PREDICTED: putative late blight resistance p...  77.4    2e-13   Nicotiana sylvestris
ref|XP_010319426.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   Solanum lycopersicum
gb|AEW48197.1|  disease resistance protein RGH3                       80.9    2e-13   Solanum x edinense
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  80.5    3e-13   Solanum lycopersicum
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...  80.5    3e-13   Nicotiana sylvestris
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...  80.5    3e-13   Solanum tuberosum [potatoes]
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...  80.5    3e-13   Nicotiana tomentosiformis
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...  80.5    4e-13   Nicotiana sylvestris
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...  80.1    4e-13   Nicotiana sylvestris
emb|CDP08021.1|  unnamed protein product                              80.1    4e-13   Coffea canephora [robusta coffee]
gb|AEW48209.1|  disease resistance protein RGH5                       80.1    5e-13   Solanum huancabambense
gb|EYU24428.1|  hypothetical protein MIMGU_mgv1a001134mg              79.7    6e-13   Erythranthe guttata [common monkey flower]
emb|CDP08019.1|  unnamed protein product                              80.1    6e-13   Coffea canephora [robusta coffee]
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg              79.7    7e-13   Erythranthe guttata [common monkey flower]
emb|CDP11974.1|  unnamed protein product                              79.7    7e-13   Coffea canephora [robusta coffee]
ref|XP_009764213.1|  PREDICTED: putative late blight resistance p...  75.5    7e-13   Nicotiana sylvestris
ref|XP_006367044.1|  PREDICTED: putative late blight resistance p...  74.3    8e-13   
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...  79.3    8e-13   
gb|AEW48212.1|  disease resistance protein RGH1                       79.3    9e-13   Solanum leptophyes x Solanum sparsipilum
emb|CDP04753.1|  unnamed protein product                              79.3    1e-12   Coffea canephora [robusta coffee]
ref|XP_006346790.1|  PREDICTED: putative late blight resistance p...  79.0    1e-12   Solanum tuberosum [potatoes]
ref|XP_009800005.1|  PREDICTED: putative late blight resistance p...  79.0    1e-12   Nicotiana sylvestris
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...  79.0    1e-12   Sesamum indicum [beniseed]
emb|CDP00737.1|  unnamed protein product                              79.0    1e-12   Coffea canephora [robusta coffee]
emb|CDP16510.1|  unnamed protein product                              79.0    1e-12   Coffea canephora [robusta coffee]
ref|XP_011071886.1|  PREDICTED: uncharacterized protein LOC105157233  77.4    1e-12   Sesamum indicum [beniseed]
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...  79.0    1e-12   Solanum lycopersicum
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...  79.0    1e-12   Nicotiana sylvestris
gb|EYU33968.1|  hypothetical protein MIMGU_mgv1a026820mg              79.0    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_009777218.1|  PREDICTED: putative late blight resistance p...  78.6    1e-12   Nicotiana sylvestris
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...  78.6    1e-12   Nicotiana sylvestris
ref|XP_011072146.1|  PREDICTED: putative late blight resistance p...  78.6    2e-12   Sesamum indicum [beniseed]
ref|XP_011093987.1|  PREDICTED: putative late blight resistance p...  78.6    2e-12   Sesamum indicum [beniseed]
gb|AJW77762.1|  Pvr9-like protein 2                                   78.6    2e-12   Capsicum annuum
ref|XP_009785700.1|  PREDICTED: putative late blight resistance p...  77.8    2e-12   Nicotiana sylvestris
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg              78.2    2e-12   Erythranthe guttata [common monkey flower]
emb|CDP20153.1|  unnamed protein product                              78.6    2e-12   Coffea canephora [robusta coffee]
emb|CDP08396.1|  unnamed protein product                              77.8    2e-12   Coffea canephora [robusta coffee]
ref|XP_006365678.1|  PREDICTED: putative late blight resistance p...  77.8    2e-12   
ref|XP_004250409.1|  PREDICTED: putative late blight resistance p...  77.8    3e-12   Solanum lycopersicum
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  77.8    3e-12   Sesamum indicum [beniseed]
ref|XP_009625968.1|  PREDICTED: putative late blight resistance p...  77.0    3e-12   Nicotiana tomentosiformis
emb|CDP12798.1|  unnamed protein product                              77.8    3e-12   Coffea canephora [robusta coffee]
ref|XP_011072139.1|  PREDICTED: putative late blight resistance p...  77.8    3e-12   
emb|CDP20159.1|  unnamed protein product                              77.8    3e-12   Coffea canephora [robusta coffee]
emb|CDP16515.1|  unnamed protein product                              77.8    3e-12   Coffea canephora [robusta coffee]
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...  77.8    3e-12   Sesamum indicum [beniseed]
ref|XP_006365690.1|  PREDICTED: putative late blight resistance p...  77.4    3e-12   
gb|AAF76163.1|AF266747_1  RGC1                                        77.8    3e-12   Solanum tuberosum [potatoes]
ref|XP_009773003.1|  PREDICTED: protein CHUP1, chloroplastic-like     76.6    3e-12   Nicotiana sylvestris
emb|CDP11157.1|  unnamed protein product                              77.4    3e-12   Coffea canephora [robusta coffee]
ref|XP_010319247.1|  PREDICTED: putative late blight resistance p...  77.4    3e-12   
gb|EYU31597.1|  hypothetical protein MIMGU_mgv1a001843mg              77.4    3e-12   Erythranthe guttata [common monkey flower]
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...  77.4    4e-12   Sesamum indicum [beniseed]
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...  77.4    4e-12   Solanum tuberosum [potatoes]
gb|AAT40487.1|  putative disease resistance protein                   77.8    4e-12   Solanum demissum
emb|CDP17920.1|  unnamed protein product                              77.4    4e-12   Coffea canephora [robusta coffee]
emb|CDP11161.1|  unnamed protein product                              77.4    4e-12   Coffea canephora [robusta coffee]
emb|CDP15718.1|  unnamed protein product                              77.4    4e-12   Coffea canephora [robusta coffee]
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg              77.0    5e-12   Erythranthe guttata [common monkey flower]
emb|CDP08038.1|  unnamed protein product                              77.0    5e-12   Coffea canephora [robusta coffee]
ref|XP_004237148.1|  PREDICTED: putative late blight resistance p...  77.0    5e-12   Solanum lycopersicum
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...  77.0    5e-12   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...  77.0    5e-12   
gb|EYU29923.1|  hypothetical protein MIMGU_mgv1a026346mg              75.1    6e-12   Erythranthe guttata [common monkey flower]
ref|XP_006356446.1|  PREDICTED: putative late blight resistance p...  77.0    6e-12   Solanum tuberosum [potatoes]
emb|CDP21300.1|  unnamed protein product                              76.6    6e-12   Coffea canephora [robusta coffee]
emb|CDP04724.1|  unnamed protein product                              76.3    6e-12   Coffea canephora [robusta coffee]
emb|CDO99208.1|  unnamed protein product                              76.3    7e-12   Coffea canephora [robusta coffee]
ref|XP_010320562.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  76.6    7e-12   
emb|CDP05594.1|  unnamed protein product                              76.6    8e-12   Coffea canephora [robusta coffee]
emb|CDP19728.1|  unnamed protein product                              76.3    8e-12   Coffea canephora [robusta coffee]
ref|XP_011093989.1|  PREDICTED: putative late blight resistance p...  76.3    9e-12   Sesamum indicum [beniseed]
gb|EYU31596.1|  hypothetical protein MIMGU_mgv1a025161mg              76.3    9e-12   Erythranthe guttata [common monkey flower]
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg              76.3    1e-11   Erythranthe guttata [common monkey flower]
gb|AAV31175.1|  Putative disease resistance protein, identical        76.3    1e-11   Solanum tuberosum [potatoes]
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...  76.3    1e-11   Solanum tuberosum [potatoes]
emb|CDP17914.1|  unnamed protein product                              75.9    1e-11   Coffea canephora [robusta coffee]
gb|AAL17826.1|  GPA2-like NBS-LRR protein                             75.5    1e-11   Solanum nigrum
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...  75.9    1e-11   Nicotiana tomentosiformis
ref|XP_009799903.1|  PREDICTED: putative late blight resistance p...  75.9    1e-11   Nicotiana sylvestris
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  76.3    1e-11   Nicotiana sylvestris
gb|EYU21837.1|  hypothetical protein MIMGU_mgv1a021514mg              75.9    1e-11   Erythranthe guttata [common monkey flower]
emb|CDP11160.1|  unnamed protein product                              75.9    1e-11   Coffea canephora [robusta coffee]
ref|XP_010319246.1|  PREDICTED: putative late blight resistance p...  75.9    1e-11   
gb|EYU33970.1|  hypothetical protein MIMGU_mgv1a018989mg              75.9    1e-11   Erythranthe guttata [common monkey flower]
gb|EYU21831.1|  hypothetical protein MIMGU_mgv1a0261622mg             75.5    1e-11   Erythranthe guttata [common monkey flower]
gb|EYU31247.1|  hypothetical protein MIMGU_mgv1a017756mg              75.5    1e-11   Erythranthe guttata [common monkey flower]
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg              75.5    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_006345285.1|  PREDICTED: putative late blight resistance p...  75.5    2e-11   
ref|XP_006367913.1|  PREDICTED: putative late blight resistance p...  72.8    2e-11   Solanum tuberosum [potatoes]
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  75.1    2e-11   
emb|CDP11642.1|  unnamed protein product                              75.5    2e-11   Coffea canephora [robusta coffee]
ref|XP_009618258.1|  PREDICTED: late blight resistance protein R1...  75.5    2e-11   
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg              75.1    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...  75.5    2e-11   
ref|XP_009798711.1|  PREDICTED: putative late blight resistance p...  75.1    2e-11   Nicotiana sylvestris
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...  75.1    2e-11   
gb|AJW77760.1|  Pvr9                                                  75.1    2e-11   Capsicum annuum
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg              75.1    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_009603189.1|  PREDICTED: uncharacterized protein LOC104098223  73.6    2e-11   
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...  74.7    2e-11   Nicotiana sylvestris
emb|CDP08020.1|  unnamed protein product                              75.1    3e-11   Coffea canephora [robusta coffee]
emb|CDP05538.1|  unnamed protein product                              75.1    3e-11   Coffea canephora [robusta coffee]
emb|CDP07957.1|  unnamed protein product                              75.1    3e-11   Coffea canephora [robusta coffee]
emb|CDP00696.1|  unnamed protein product                              70.1    3e-11   Coffea canephora [robusta coffee]
ref|XP_006367912.1|  PREDICTED: putative late blight resistance p...  72.8    3e-11   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              74.7    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2              74.7    3e-11   Capsicum chacoense
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   Nicotiana tomentosiformis
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   Sesamum indicum [beniseed]
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   Nicotiana tomentosiformis
emb|CDP13440.1|  unnamed protein product                              74.7    3e-11   Coffea canephora [robusta coffee]
ref|XP_009624584.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   Nicotiana tomentosiformis
ref|XP_009772626.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   Nicotiana sylvestris
emb|CDP08428.1|  unnamed protein product                              74.7    3e-11   Coffea canephora [robusta coffee]
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   Nicotiana tomentosiformis
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   Sesamum indicum [beniseed]
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...  74.7    3e-11   Nicotiana tomentosiformis
emb|CDP19488.1|  unnamed protein product                              74.7    3e-11   Coffea canephora [robusta coffee]
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...  74.3    3e-11   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...  74.3    4e-11   Sesamum indicum [beniseed]
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...  74.3    4e-11   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...  74.3    4e-11   
emb|CDP12547.1|  unnamed protein product                              74.3    4e-11   Coffea canephora [robusta coffee]
gb|AAT39932.2|  NB-ARC domain containing protein                      74.3    4e-11   Solanum demissum
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...  74.3    4e-11   
emb|CDP17943.1|  unnamed protein product                              74.3    4e-11   Coffea canephora [robusta coffee]
ref|XP_009796668.1|  PREDICTED: putative late blight resistance p...  74.3    4e-11   Nicotiana sylvestris
ref|XP_009796670.1|  PREDICTED: putative late blight resistance p...  73.9    5e-11   Nicotiana sylvestris
ref|XP_011072559.1|  PREDICTED: putative late blight resistance p...  72.8    5e-11   
ref|XP_009796665.1|  PREDICTED: putative late blight resistance p...  73.9    5e-11   Nicotiana sylvestris
emb|CDP05514.1|  unnamed protein product                              73.9    5e-11   Coffea canephora [robusta coffee]
gb|AAT39951.2|  Disease resistance protein, putative                  74.3    5e-11   Solanum demissum
emb|CDP04755.1|  unnamed protein product                              73.9    5e-11   Coffea canephora [robusta coffee]
emb|CDP17263.1|  unnamed protein product                              73.9    5e-11   Coffea canephora [robusta coffee]
gb|EYU21842.1|  hypothetical protein MIMGU_mgv1a020462mg              73.9    5e-11   Erythranthe guttata [common monkey flower]
ref|XP_009796664.1|  PREDICTED: putative late blight resistance p...  73.9    5e-11   Nicotiana sylvestris
emb|CDP05534.1|  unnamed protein product                              73.6    5e-11   Coffea canephora [robusta coffee]
ref|XP_010319427.1|  PREDICTED: putative late blight resistance p...  72.4    6e-11   Solanum lycopersicum
ref|XP_009796671.1|  PREDICTED: putative late blight resistance p...  73.6    6e-11   Nicotiana sylvestris
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...  73.6    6e-11   Nicotiana sylvestris
ref|XP_006355133.1|  PREDICTED: putative late blight resistance p...  73.6    6e-11   Solanum tuberosum [potatoes]
gb|EYU31599.1|  hypothetical protein MIMGU_mgv1a025745mg              73.6    7e-11   Erythranthe guttata [common monkey flower]
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...  73.6    7e-11   Nicotiana sylvestris
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...  73.6    7e-11   Nicotiana sylvestris
emb|CDP11163.1|  unnamed protein product                              73.6    8e-11   Coffea canephora [robusta coffee]
emb|CDP16266.1|  unnamed protein product                              73.2    8e-11   Coffea canephora [robusta coffee]
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...  73.2    8e-11   
gb|AJW77761.1|  Pvr9-like protein 1                                   73.6    9e-11   Capsicum annuum
emb|CDP08024.1|  unnamed protein product                              73.2    9e-11   Coffea canephora [robusta coffee]
emb|CDP04756.1|  unnamed protein product                              73.2    1e-10   Coffea canephora [robusta coffee]
emb|CDP18676.1|  unnamed protein product                              73.2    1e-10   Coffea canephora [robusta coffee]
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  73.2    1e-10   Sesamum indicum [beniseed]
emb|CDP11186.1|  unnamed protein product                              73.2    1e-10   Coffea canephora [robusta coffee]
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1              72.8    1e-10   Sesamum indicum [beniseed]
emb|CDP12797.1|  unnamed protein product                              73.2    1e-10   Coffea canephora [robusta coffee]
gb|EYU21829.1|  hypothetical protein MIMGU_mgv1a001470mg              72.8    1e-10   Erythranthe guttata [common monkey flower]
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...  72.8    1e-10   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...  72.8    1e-10   Nicotiana tomentosiformis
gb|EYU21838.1|  hypothetical protein MIMGU_mgv1a001107mg              72.8    1e-10   Erythranthe guttata [common monkey flower]
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg              72.8    1e-10   Erythranthe guttata [common monkey flower]
ref|XP_009774731.1|  PREDICTED: putative late blight resistance p...  72.8    1e-10   Nicotiana sylvestris
emb|CDP21316.1|  unnamed protein product                              69.3    1e-10   Coffea canephora [robusta coffee]
ref|XP_009774730.1|  PREDICTED: putative late blight resistance p...  72.8    1e-10   Nicotiana sylvestris
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...  72.8    1e-10   Nicotiana tomentosiformis
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...  72.8    1e-10   Nicotiana tomentosiformis
ref|XP_009764457.1|  PREDICTED: putative late blight resistance p...  72.0    1e-10   Nicotiana sylvestris
ref|XP_011071867.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  72.4    1e-10   
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...  72.8    1e-10   Nicotiana sylvestris
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...  72.4    2e-10   Nicotiana sylvestris
emb|CDP17919.1|  unnamed protein product                              72.4    2e-10   Coffea canephora [robusta coffee]
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...  72.4    2e-10   Nicotiana sylvestris
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...  72.4    2e-10   
ref|XP_011072138.1|  PREDICTED: putative late blight resistance p...  71.6    2e-10   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1              72.0    2e-10   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
gb|AET22504.1|  hypothetical protein                                  72.0    2e-10   
gb|AEW48200.1|  disease resistance protein RGH7                       72.0    2e-10   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
ref|XP_009796331.1|  PREDICTED: late blight resistance protein R1...  71.6    2e-10   
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1              71.6    3e-10   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  71.6    3e-10   
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...  71.6    3e-10   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1              71.6    3e-10   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1              71.6    3e-10   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1              71.6    3e-10   
gb|EYU21846.1|  hypothetical protein MIMGU_mgv1a022576mg              70.9    3e-10   
ref|XP_010320708.1|  PREDICTED: putative late blight resistance p...  71.6    3e-10   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...  71.6    3e-10   
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...  72.0    3e-10   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg              71.6    3e-10   
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  71.6    3e-10   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  71.6    3e-10   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363  71.6    3e-10   
emb|CDP08032.1|  unnamed protein product                              70.9    3e-10   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501  71.6    3e-10   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  71.2    4e-10   
emb|CDP15581.1|  unnamed protein product                              71.2    4e-10   
emb|CDP04880.1|  unnamed protein product                              71.2    4e-10   
emb|CDP00693.1|  unnamed protein product                              67.8    4e-10   
emb|CDP05521.1|  unnamed protein product                              71.2    4e-10   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  71.2    4e-10   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  71.2    4e-10   
emb|CDP15268.1|  unnamed protein product                              71.2    4e-10   
ref|XP_009596953.1|  PREDICTED: putative late blight resistance p...  71.2    4e-10   
ref|XP_011072136.1|  PREDICTED: putative late blight resistance p...  71.2    4e-10   
ref|XP_010320671.1|  PREDICTED: uncharacterized protein LOC101257665  71.2    4e-10   
ref|XP_009761713.1|  PREDICTED: putative late blight resistance p...  69.7    5e-10   
emb|CDP08040.1|  unnamed protein product                              70.9    5e-10   
ref|XP_009761073.1|  PREDICTED: putative late blight resistance p...  70.9    5e-10   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  70.9    5e-10   
gb|EYU23523.1|  hypothetical protein MIMGU_mgv1a025044mg              70.5    6e-10   
ref|XP_009618066.1|  PREDICTED: putative late blight resistance p...  70.5    7e-10   
ref|XP_004238957.1|  PREDICTED: putative late blight resistance p...  70.5    7e-10   
emb|CDP21314.1|  unnamed protein product                              68.2    7e-10   
ref|XP_009603166.1|  PREDICTED: putative late blight resistance p...  70.5    7e-10   
gb|AEW48210.1|  disease resistance protein RGH5                       70.5    8e-10   
emb|CDP16115.1|  unnamed protein product                              70.5    8e-10   
ref|XP_006346788.1|  PREDICTED: putative late blight resistance p...  70.1    8e-10   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  70.1    9e-10   
ref|XP_009602412.1|  PREDICTED: putative late blight resistance p...  70.1    9e-10   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...  70.1    9e-10   
ref|XP_011072133.1|  PREDICTED: putative late blight resistance p...  70.1    9e-10   
ref|XP_009602410.1|  PREDICTED: putative late blight resistance p...  70.1    1e-09   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg              70.1    1e-09   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...  70.1    1e-09   
gb|ABY61746.1|  resistance protein PSH-RGH7                           70.1    1e-09   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...  69.7    1e-09   
ref|XP_006362537.1|  PREDICTED: putative late blight resistance p...  69.7    1e-09   
emb|CDP13141.1|  unnamed protein product                              69.7    1e-09   
gb|AEW48196.1|  disease resistance protein RGH7                       69.7    1e-09   
ref|XP_006362539.1|  PREDICTED: putative late blight resistance p...  69.7    1e-09   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...  69.7    1e-09   
gb|EYU22216.1|  hypothetical protein MIMGU_mgv1a019937mg              69.7    1e-09   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  69.7    1e-09   
ref|XP_009779606.1|  PREDICTED: putative late blight resistance p...  69.7    1e-09   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg              69.7    1e-09   
emb|CDP10323.1|  unnamed protein product                              69.3    1e-09   
emb|CDP00592.1|  unnamed protein product                              69.7    1e-09   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...  69.7    1e-09   
ref|XP_011072128.1|  PREDICTED: putative late blight resistance p...  69.3    2e-09   
gb|EYU20573.1|  hypothetical protein MIMGU_mgv1a000577mg              69.3    2e-09   
ref|XP_009613236.1|  PREDICTED: putative late blight resistance p...  68.9    2e-09   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              69.3    2e-09   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg              69.3    2e-09   
emb|CDP15598.1|  unnamed protein product                              69.3    2e-09   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...  69.3    2e-09   
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...  69.3    2e-09   
ref|XP_006365952.1|  PREDICTED: putative late blight resistance p...  66.6    2e-09   
ref|XP_011072143.1|  PREDICTED: putative late blight resistance p...  68.9    2e-09   
ref|XP_011084823.1|  PREDICTED: putative late blight resistance p...  68.6    3e-09   
emb|CDP19132.1|  unnamed protein product                              68.9    3e-09   
ref|XP_009785354.1|  PREDICTED: putative late blight resistance p...  67.8    3e-09   
emb|CDP00692.1|  unnamed protein product                              68.6    3e-09   
emb|CDP00687.1|  unnamed protein product                              67.8    3e-09   
emb|CDP21195.1|  unnamed protein product                              68.6    3e-09   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg              68.6    3e-09   
emb|CDP11618.1|  unnamed protein product                              68.6    3e-09   
ref|XP_004239469.1|  PREDICTED: putative late blight resistance p...  68.6    3e-09   
gb|EYU34208.1|  hypothetical protein MIMGU_mgv1a026654mg              68.2    3e-09   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...  68.6    3e-09   
ref|XP_006365693.1|  PREDICTED: putative late blight resistance p...  68.6    4e-09   
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...  68.6    4e-09   
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...  68.2    4e-09   
emb|CDP00690.1|  unnamed protein product                              68.2    4e-09   
ref|XP_009608834.1|  PREDICTED: late blight resistance protein R1...  68.2    4e-09   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...  68.2    4e-09   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...  68.2    4e-09   
ref|XP_009620237.1|  PREDICTED: putative late blight resistance p...  68.2    4e-09   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...  68.2    4e-09   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg              68.2    4e-09   
ref|XP_011072130.1|  PREDICTED: putative late blight resistance p...  68.2    4e-09   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...  68.2    4e-09   
gb|EYU21836.1|  hypothetical protein MIMGU_mgv1a023326mg              67.8    5e-09   
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...  67.8    5e-09   
gb|AEW48214.1|  disease resistance protein RGH4                       67.8    5e-09   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  67.8    6e-09   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2             67.8    6e-09   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg              67.8    6e-09   
emb|CDP15593.1|  unnamed protein product                              67.8    6e-09   
ref|XP_009796673.1|  PREDICTED: uncharacterized protein LOC104243211  65.9    7e-09   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...  67.4    7e-09   
gb|AEW48192.1|  disease resistance protein RGH3                       67.4    7e-09   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg              67.4    7e-09   
ref|XP_006360433.1|  PREDICTED: putative late blight resistance p...  66.6    8e-09   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg              67.0    9e-09   
ref|XP_009761661.1|  PREDICTED: late blight resistance protein R1...  67.0    9e-09   
gb|EYU39490.1|  hypothetical protein MIMGU_mgv1a0204861mg             66.6    9e-09   
ref|XP_009773709.1|  PREDICTED: putative late blight resistance p...  67.0    1e-08   
gb|EPS69440.1|  hypothetical protein M569_05326                       66.2    1e-08   
ref|XP_009783712.1|  PREDICTED: putative late blight resistance p...  63.5    1e-08   
ref|XP_009761982.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_006355211.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_010326937.1|  PREDICTED: putative late blight resistance p...  67.0    1e-08   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg              66.6    1e-08   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009616093.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009616094.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
emb|CDP11649.1|  unnamed protein product                              66.6    1e-08   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009616092.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
gb|ABY61745.1|  resistance protein PSH-RGH6                           66.6    1e-08   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_011072135.1|  PREDICTED: putative late blight resistance p...  66.2    1e-08   
ref|XP_009792722.1|  PREDICTED: putative late blight resistance p...  66.6    1e-08   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...  66.6    2e-08   
gb|ABI96212.1|  NBS-LRR resistance protein-like protein               66.6    2e-08   
gb|EYU17742.1|  hypothetical protein MIMGU_mgv1a023281mg              66.2    2e-08   
ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...  65.9    2e-08   
gb|AAT40519.2|  hypothetical protein SDM1_22t00007                    66.2    2e-08   
emb|CDP11825.1|  unnamed protein product                              66.2    2e-08   
ref|XP_011073308.1|  PREDICTED: uncharacterized protein LOC105158...  64.7    2e-08   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...  65.9    2e-08   
gb|AEW48191.1|  disease resistance protein RGH2                       65.9    2e-08   
gb|AEW48189.1|  disease resistance protein RGH9                       65.9    2e-08   
emb|CAD29726.1|  hero resistance protein 2 homologue                  65.9    2e-08   
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...  65.9    2e-08   
gb|AEW48186.1|  disease resistance protein RGH2                       65.9    2e-08   
gb|AEW48202.1|  disease resistance protein RGH4                       65.9    2e-08   
gb|AEW48195.1|  disease resistance protein RGH6                       65.9    3e-08   
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...  65.9    3e-08   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  65.9    3e-08   
gb|EYU17761.1|  hypothetical protein MIMGU_mgv1a000811mg              65.9    3e-08   
gb|AEW48194.1|  disease resistance protein RGH5                       65.5    3e-08   
gb|AEW48193.1|  disease resistance protein RGH4                       65.5    3e-08   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  65.5    3e-08   
emb|CDP08023.1|  unnamed protein product                              65.9    3e-08   
ref|XP_009800886.1|  PREDICTED: putative late blight resistance p...  65.9    3e-08   
ref|XP_009614428.1|  PREDICTED: putative late blight resistance p...  65.5    3e-08   
emb|CDP00758.1|  unnamed protein product                              65.5    3e-08   
ref|XP_009791923.1|  PREDICTED: putative late blight resistance p...  65.5    3e-08   
emb|CDP05441.1|  unnamed protein product                              65.5    3e-08   
gb|EYU21833.1|  hypothetical protein MIMGU_mgv1a009417mg              64.7    3e-08   
ref|XP_011071935.1|  PREDICTED: putative late blight resistance p...  65.5    3e-08   
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...  65.5    3e-08   
ref|XP_009592131.1|  PREDICTED: putative late blight resistance p...  65.5    3e-08   
emb|CDP05506.1|  unnamed protein product                              64.7    3e-08   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  65.5    3e-08   
emb|CDP10807.1|  unnamed protein product                              65.5    3e-08   
gb|AAC32253.1|  disease resistance gene homolog Mi-copy1              65.5    3e-08   
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  65.5    4e-08   
ref|XP_004236921.1|  PREDICTED: putative late blight resistance p...  65.5    4e-08   
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  65.5    4e-08   
gb|AEW48215.1|  disease resistance protein RGH7                       65.1    4e-08   
emb|CDP12800.1|  unnamed protein product                              65.5    4e-08   
gb|AEW48204.1|  disease resistance protein RGH1                       65.1    4e-08   
ref|XP_009614998.1|  PREDICTED: putative late blight resistance p...  65.5    4e-08   
ref|XP_004240499.1|  PREDICTED: putative late blight resistance p...  65.5    4e-08   
ref|XP_009803158.1|  PREDICTED: putative late blight resistance p...  65.1    4e-08   
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  65.5    4e-08   
ref|XP_009777378.1|  PREDICTED: late blight resistance protein R1...  65.1    4e-08   
ref|XP_009614999.1|  PREDICTED: putative late blight resistance p...  65.1    4e-08   
ref|NP_001234622.1|  plant resistance protein                         65.1    4e-08   
ref|XP_009777374.1|  PREDICTED: putative late blight resistance p...  65.1    4e-08   
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  65.1    4e-08   
emb|CDP11611.1|  unnamed protein product                              65.1    4e-08   
gb|EYU29928.1|  hypothetical protein MIMGU_mgv1a001694mg              65.1    4e-08   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...  65.1    4e-08   
ref|NP_001234836.1|  hero resistance protein 1 homologue              65.1    4e-08   
ref|XP_006365906.1|  PREDICTED: putative late blight resistance p...  65.1    4e-08   
ref|XP_009777376.1|  PREDICTED: putative late blight resistance p...  65.1    4e-08   
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg              65.1    4e-08   
gb|AEW48211.1|  disease resistance protein RGH1                       64.7    5e-08   
emb|CDP04885.1|  unnamed protein product                              65.1    5e-08   
ref|XP_009604667.1|  PREDICTED: putative late blight resistance p...  64.7    5e-08   
ref|XP_009604649.1|  PREDICTED: putative late blight resistance p...  64.7    5e-08   
gb|EYU17689.1|  hypothetical protein MIMGU_mgv1a024130mg              64.7    5e-08   
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...  64.7    5e-08   
gb|AAF76308.1|  Prf                                                   65.1    5e-08   
gb|AAF76312.1|AF220603_4  Prf                                         65.1    5e-08   
gb|AAC49408.1|  PRF                                                   65.1    5e-08   
ref|XP_010320926.1|  PREDICTED: putative late blight resistance p...  65.1    5e-08   
ref|XP_004239116.1|  PREDICTED: putative late blight resistance p...  64.7    5e-08   
emb|CDP18959.1|  unnamed protein product                              64.7    5e-08   
ref|XP_006340022.1|  PREDICTED: putative late blight resistance p...  64.7    6e-08   



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +LM+L+ RC     + + +   LP L+VL +    + G AW L ++E F+QL +L I+ +
Sbjct  748   SLMRLTLRCTYLPWEDMANIVTLPNLQVLKIKDNGFDGDAWRLSDEEIFNQLKFLLIDRT  807

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N L+RW+A + NFPKL+ LVL  C  LE+IP    EI  L+SIEL  C  S   S KEIQ
Sbjct  808   N-LKRWKAGSVNFPKLQHLVLKRCIYLEEIPKDIGEIYTLESIELLNCRTSAAKSVKEIQ  866

Query  642   REQHEQGNDNMVV  604
              EQ   GND + V
Sbjct  867   EEQESMGNDCLSV  879



>ref|XP_009609967.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=468

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 78/125 (62%), Gaps = 0/125 (0%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+     F  K I++ + LP LE L L      GG W L +++ F+ L  L I T+
Sbjct  343   SLKRLTLYEFRFPWKDISTLAMLPNLEELKLKYNAVKGGVWRLSDEDKFESLKLLLIATT  402

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
              F   WEAS+ NFP L+RLVL+ C  L++IP  F EI +L+SIEL+YC  +  DSA++I+
Sbjct  403   TFFHHWEASSDNFPNLKRLVLNNCHYLKQIPTDFGEICSLESIELHYCNTTAEDSARKIK  462

Query  642   REQHE  628
             +EQ +
Sbjct  463   QEQQD  467



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L++L+ RC     + + +   LP L+VL +    + G AW L +++ F+QL YL I+ +
Sbjct  748   SLVRLTLRCTYLPWEDMANIVMLPNLQVLKIKDNGFDGDAWRLSDEQIFNQLKYLLIDRT  807

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N ++ W+A + NFPKL+RLVL  C  LE+IP    E+  L+SIEL  C  S   S KEIQ
Sbjct  808   N-VKSWKAGSVNFPKLQRLVLKRCIYLEEIPKDIGEVYTLESIELLNCRTSAAKSVKEIQ  866

Query  642   REQHEQGNDNMVV  604
              EQ   GND + V
Sbjct  867   EEQESMGNDCLSV  879



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+      E + +N  SKLP LEVL L    + G  W+L ++++   L    +   
Sbjct  613   NLKKLTLCTTHLEWEDMNILSKLPNLEVLKLKDHAFRGHIWKLSDEDADGFLKLKFLLLE  672

Query  822   NF-LERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             +  LE+WEA++ +FP LE LVL  C  LE+IP  FAEI  L+ IEL+ C+ SV+ SA++I
Sbjct  673   HMHLEQWEATSYHFPSLEHLVLTHCHSLEQIPFDFAEIQTLQLIELHNCMRSVLVSAEQI  732

Query  645   QREQHEQGNDNMVV  604
             Q EQ   GND++++
Sbjct  733   QEEQQSFGNDDLII  746



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+ RC     + + +   LP L+VL +    + G  W L  +E+F QL +L I+ +
Sbjct  729   SLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRT  788

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N L+ W+A + NFPKL+RLVL  C  LE+IP    EI  L+SIEL+ C  SV  S KEIQ
Sbjct  789   N-LKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQ  847

Query  642   REQHEQGNDNMVV  604
              EQ    ND + V
Sbjct  848   EEQESMANDILSV  860



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+ RC     + + +   LP L+VL +    + G  W L  +E+F QL +L I+ +
Sbjct  745   SLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRT  804

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N L+ W+A + NFPKL+RLVL  C  LE+IP    EI  L+SIEL+ C  SV  S KEIQ
Sbjct  805   N-LKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQ  863

Query  642   REQHEQGNDNMVV  604
              EQ    ND + V
Sbjct  864   EEQESMANDILSV  876



>emb|CDP19489.1| unnamed protein product [Coffea canephora]
Length=1247

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 79/133 (59%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KLS  C       I++  KLPKLEVL L     +G  WE+ E E F  L  L++   
Sbjct  1115  NLKKLSLSCNKQPWVEISTIGKLPKLEVLKLLTDSVVGKEWEMTEGE-FPTLRILKLRDL  1173

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             +F  RW AS+ NFP+LE+LV+ WC  LE++P    E   L+ IE+  C  SV +S K+IQ
Sbjct  1174  DF-RRWTASSDNFPRLEKLVVHWCRELEEVPFCLGECQALEMIEVRGCRESVANSVKQIQ  1232

Query  642   REQHEQGNDNMVV  604
             +EQ + GN+ +++
Sbjct  1233  QEQRDMGNEALIL  1245



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+ RC     + + +   LP L+VL +    + G  W L  +E+F QL +L I+ +
Sbjct  745   SLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRT  804

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N L+ W+A + NFPKL+RLVL  C  LE+IP    EI  L+SIEL+ C  SV  S KEIQ
Sbjct  805   N-LKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQ  863

Query  642   REQHEQGNDNMVV  604
              EQ    ND + V
Sbjct  864   EEQESMANDILSV  876



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score = 94.7 bits (234),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 69/112 (62%), Gaps = 1/112 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LEVL +    + G  W L + E F+QL  L IN + +L+ W+A + NFPKL+RLVL 
Sbjct  447  LPNLEVLKIKYHGFYGAFWRLNDNEIFNQLKLLLINET-YLKHWDAGSVNFPKLQRLVLK  505

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             C  LE+IP  F EI  L+SIEL+ C  S   SAK IQ EQ   GND + V+
Sbjct  506  RCFDLEEIPKDFGEICTLESIELHKCKTSAAASAKNIQEEQESMGNDCLSVL  557



>ref|XP_006357457.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=985

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 1/129 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+  C S   K + +   LP LEVL +    ++G  W L ++E F QL +L I+ +
Sbjct  730   SLKRLTLSCTSLPWKDMANVITLPNLEVLKIKDNGFLGDEWMLNDEEIFKQLKFLLISWT  789

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               L+ W+A + NFPKL+RL L  C  LEKIP  F EI  L+SIEL+ C  S   S K+IQ
Sbjct  790   G-LKHWKAGSVNFPKLQRLFLKRCMNLEKIPQDFGEICTLESIELHKCSISAAKSGKDIQ  848

Query  642   REQHEQGND  616
              EQ   GN+
Sbjct  849   EEQESMGNE  857



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
              L KL+ R        +    KLPKLEVL L    + G  WE  + E F QL +L ++ +
Sbjct  729   TLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTD-ERFQQLKFLLLDGT  787

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W+AS+  FPKLE LVL  C  L +IP   AEIP L  IELY+C  S  DSA  I+
Sbjct  788   DLIH-WKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIR  846

Query  642   REQHEQGNDNMVV  604
              EQ   GND++VV
Sbjct  847   EEQISMGNDDLVV  859



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
              L KL+ R        +    KLPKLEVL L    + G  WE  + E F QL +L ++ +
Sbjct  729   TLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTD-ERFQQLKFLLLDGT  787

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W+AS+  FPKLE LVL  C  L +IP   AEIP L  IELY+C  S  DSA  I+
Sbjct  788   DLIH-WKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIR  846

Query  642   REQHEQGNDNMVV  604
              EQ   GND++VV
Sbjct  847   EEQISMGNDDLVV  859



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
              L KL+ R        +    KLPKLEVL L    + G  WE  + E F QL +L ++ +
Sbjct  729   TLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTD-ERFQQLKFLLLDGT  787

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W+AS+  FPKLE LVL  C  L +IP   AEIP L  IELY+C  S  DSA  I+
Sbjct  788   DLIH-WKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIR  846

Query  642   REQHEQGNDNMVV  604
              EQ   GND++VV
Sbjct  847   EEQISMGNDDLVV  859



>emb|CDP20519.1| unnamed protein product [Coffea canephora]
Length=1251

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  KLPKLEVL L    ++G  WE+ E E F +L  L+++      RW AS+ NFP+L
Sbjct  1125  ISTIGKLPKLEVLKLLYDSFVGEEWEMKEGE-FPKLRVLKLSHLWDFRRWTASSDNFPRL  1183

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
             E+LV+ WC  LE++P    E P L+ IE+  C  SV  S K+IQ+EQ + GN+ + ++ E
Sbjct  1184  EKLVVQWCRHLEEVPSCLGECPTLEMIEVRGCRESVASSVKQIQQEQRDGGNEVLRILIE  1243



>emb|CDP21622.1| unnamed protein product, partial [Coffea canephora]
Length=935

 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 78/136 (57%), Gaps = 1/136 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+  C       I++  KLPKLEVL L    ++G  WE+ E E F  L  L++   
Sbjct  791   NLKKLTLFCNKQPWSEISTIGKLPKLEVLKLLHDSFVGEEWEMKEGE-FPSLRVLKLRAL  849

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
                  W AS+ NFP LE+LV++WC  LE++P    E P L+ IE+  C  SV  S K+IQ
Sbjct  850   WDFRSWTASSDNFPHLEKLVVEWCRELEEVPFCLGECPTLEMIEVRGCRESVASSVKQIQ  909

Query  642   REQHEQGNDNMVVIEE  595
             +EQ + GN+ + ++ E
Sbjct  910   QEQIDMGNEVLKILIE  925



>ref|XP_009784309.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=330

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 77/125 (62%), Gaps = 1/125 (1%)
 Frame = -1

Query  978  CVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEA  799
            C SF    I++   LP LE L L      G  W L +++ F+ L  L + +  +LERWEA
Sbjct  198  CFSFPWADISTLVMLPNLEELKLKDYAVKGEVWRLRDEDKFESLKLL-VFSGLYLERWEA  256

Query  798  SASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
            S+ +FP L+RLVL  C +L++IP+ F EI  L+SIEL+ C  +  DSA  I++EQ + GN
Sbjct  257  SSDSFPNLKRLVLKKCFLLKEIPIDFGEICTLESIELHNCSIAAEDSATIIEQEQADMGN  316

Query  618  DNMVV  604
            +++ V
Sbjct  317  NSLKV  321



>ref|XP_006357456.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=874

 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  939  KLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVL  760
            KLP LEVL +    ++G  W+L ++E F+QL +L I+ +  L+ WEAS+ NFPKL+RL L
Sbjct  757  KLPNLEVLKIKDNGFLGDVWKLNDEEIFNQLKFLLISWTG-LKHWEASSVNFPKLQRLFL  815

Query  759  DWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
              C  LE+IP  F EI  L+SIEL+ C  S   S K+I+ EQ   GN+ + V+
Sbjct  816  KRCMNLEEIPQDFGEICTLESIELHDCSISAAKSGKDIKEEQESMGNECLCVL  868



>ref|XP_009786264.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=884

 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+ L +    + G  W+L ++E+F+QL +L I+T N L+ WEAS+ NFP+LERLVL 
Sbjct  767  LPNLQELKIKYNGFDGDVWKLNDEEAFNQLKFLLISTIN-LKHWEASSVNFPRLERLVLK  825

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEEH  592
             C  LE+IP    EI  L SIEL+ C  S   S  EIQ EQ   GN+ + VI ++
Sbjct  826  RCYYLEEIPQDLGEICTLASIELHECSISAAKSVNEIQEEQASMGNNCLSVITDN  880



>ref|XP_009786258.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786259.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786260.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786261.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786262.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786263.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=884

 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+ L +    + G  W+L ++E+F+QL +L I+T N L+ WEAS+ NFP+LERLVL 
Sbjct  767  LPNLQELKIKYNGFDGDVWKLNDEEAFNQLKFLLISTIN-LKHWEASSVNFPRLERLVLK  825

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEEH  592
             C  LE+IP    EI  L SIEL+ C  S   S  EIQ EQ   GN+ + VI ++
Sbjct  826  RCYYLEEIPQDLGEICTLASIELHECSISAAKSVNEIQEEQASMGNNCLSVITDN  880



>emb|CDP05499.1| unnamed protein product [Coffea canephora]
Length=866

 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+      + K ++    LP LEVL +    +    WE+++ E+F  L +L+++ +
Sbjct  727   NLKKLTLVGSYVDWKEMSIIGMLPNLEVLKIKDNFFNAPRWEVMD-EAFSHLKFLKLSNT  785

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + L++W AS+S+FP L++LVLD C  L++IP  F  I  L++IELYY   SV DSA++IQ
Sbjct  786   D-LQQWSASSSSFPCLQQLVLDGCPNLQEIPSSFRSIDTLEAIELYYSSQSVADSARQIQ  844

Query  642   REQHEQGNDNMVVI  601
               Q   GND + V+
Sbjct  845   DSQRYMGNDGLKVL  858



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+     F ++ + +   LP LEVL +    +    W L ++E F QL +L I+ +
Sbjct  717   SLKRLTLTNTLFPLEDMTNIVMLPNLEVLKIKDV-FENDEWRLNDEEIFSQLKFLLISVT  775

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
              FL  WEA + NFPKL+RLVL  C  LE+IP  F EI +L+SIELY C  S   S +E+Q
Sbjct  776   -FLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQ  834

Query  642   REQHEQGNDNMVVI  601
              EQ   GND + V+
Sbjct  835   EEQKSMGNDCLTVV  848



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+     F ++ + +   LP LEVL +    +    W L ++E F QL +L I+ +
Sbjct  717   SLKRLTLTNTLFPLEDMTNIVMLPNLEVLKIKDV-FENDEWRLNDEEIFSQLKFLLISVT  775

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
              FL  WEA + NFPKL+RLVL  C  LE+IP  F EI +L+SIELY C  S   S +E+Q
Sbjct  776   -FLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQ  834

Query  642   REQHEQGNDNMVVI  601
              EQ   GND + V+
Sbjct  835   EEQKSMGNDCLTVV  848



>gb|AEW48190.1| disease resistance protein RX4 [Solanum albicans]
Length=909

 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = -1

Query  1005  KNLMKLSXRC-VSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   S   K ++   KLPKLEVL+LS   +IG  WE++E E F  L +L ++
Sbjct  762   QNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVE-EGFPHLNFLFLD  820

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                ++  W AS+ +FP LERL+L  C  L+ IP  FA+I  L  I++ YC  SVV+SAK+
Sbjct  821   DV-YIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQ  879

Query  648   IQREQHEQGNDNMVVIEEHTLQ*F  577
             IQ++  +    ++ V   H  Q F
Sbjct  880   IQQDIQDNYGSSIEVHTRHLFQHF  903



>ref|XP_009597655.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=884

 Score = 91.7 bits (226),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 1/136 (1%)
 Frame = -1

Query  999  LMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN  820
            L +L+    S   + + +   LP L+ L +    + G  W+L ++E F+QL +L I+  N
Sbjct  746  LKRLTLSYTSLPWEDMANIVMLPNLQELKIKYNGFDGDVWKLNDEEVFNQLKFLLISAIN  805

Query  819  FLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
             L+ WEAS+ NFP+LERLVL  C  LE+IP    EI  L SIEL+ C  S   S  EIQ 
Sbjct  806  -LKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKSVNEIQE  864

Query  639  EQHEQGNDNMVVIEEH  592
            EQ   GND + VI ++
Sbjct  865  EQESMGNDCLSVITDN  880



>emb|CDP18675.1| unnamed protein product [Coffea canephora]
Length=1241

 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+  C       I++  KLPKLEVL L    ++G  WE+ E E F  L  L+++  
Sbjct  1102  NLKKLTLSCNKQPWSEISTIGKLPKLEVLKLLLYSFVGEEWEMKEGE-FLNLQVLKLSNL  1160

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
                 RW AS+ NFP+LE+LV+DWC  LE++P    E   L+ I++ +C  SV  S K+IQ
Sbjct  1161  LKFRRWTASSDNFPRLEKLVVDWCPNLEEVPSCLGECLTLEMIDVKWCGESVASSVKQIQ  1220

Query  642   REQHEQGNDNMVVI  601
             ++Q + GN+ + ++
Sbjct  1221  QDQIDMGNEVLKIL  1234



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score = 91.7 bits (226),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
              L KL+        + + +   LP L VL L +C +  G WE  E E F +L +L+I + 
Sbjct  763   TLQKLTLSGCVLSQQDMATVGSLPNLHVLKLRRCSFRRGKWETTEGE-FPRLKFLQIESE  821

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N L+ W   +S+FP LERLVL  C  L +IP G  EIP L+ IE+ +   S+VDSA  I+
Sbjct  822   N-LKHWVTDSSHFPNLERLVLHDCGELGEIPDGIGEIPTLELIEVPHWPKSLVDSAMRIK  880

Query  642   REQHEQGNDNMVV  604
              EQ E GND + V
Sbjct  881   EEQQESGNDFLQV  893



>ref|XP_009597654.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score = 91.7 bits (226),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 1/136 (1%)
 Frame = -1

Query  999  LMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN  820
            L +L+    S   + + +   LP L+ L +    + G  W+L ++E F+QL +L I+  N
Sbjct  746  LKRLTLSYTSLPWEDMANIVMLPNLQELKIKYNGFDGDVWKLNDEEVFNQLKFLLISAIN  805

Query  819  FLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
             L+ WEAS+ NFP+LERLVL  C  LE+IP    EI  L SIEL+ C  S   S  EIQ 
Sbjct  806  -LKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKSVNEIQE  864

Query  639  EQHEQGNDNMVVIEEH  592
            EQ   GND + VI ++
Sbjct  865  EQESMGNDCLSVITDN  880



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+     F  + + + + LP LEVL +    +    W L ++E F QL +L I+ +
Sbjct  718   SLKRLTLTNTLFPPEDMTNITMLPNLEVLKMKDV-FDSDEWRLNDEEIFSQLKFLLISVT  776

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
              FL  WEA + NFPKL+R+VL  C  LE+IP  F EI +L+SIELY C  S   S +E+Q
Sbjct  777   -FLRHWEAGSVNFPKLQRVVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQ  835

Query  642   REQHEQGNDNMVVI  601
              EQ   GND + V+
Sbjct  836   EEQESMGNDCLSVV  849



>emb|CDP20463.1| unnamed protein product [Coffea canephora]
Length=1160

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 76/133 (57%), Gaps = 1/133 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+ R        I++  KLPKLEVL L  C  +G  WE+ E E F  L  L+++  
Sbjct  1021  NLKKLTLRGTDQGWSEISTIGKLPKLEVLKLLYCYAVGEEWEMKEGE-FPSLRVLQLSNL  1079

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
                  W AS+ NFP+LE+LV+  C  L+++P    E P L+ IE+  C  SV  S K+IQ
Sbjct  1080  WKFRSWTASSDNFPRLEKLVVHSCRNLKEVPSCLGECPTLEMIEVSGCHESVASSVKQIQ  1139

Query  642   REQHEQGNDNMVV  604
             +EQ + GN+ + +
Sbjct  1140  QEQRDMGNEALKI  1152



>ref|XP_004243493.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Solanum lycopersicum]
Length=858

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 71/128 (55%), Gaps = 2/128 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KLS     F  + +   +KLP LEVL      W G  W+L E   F +L  L +   
Sbjct  723   NLTKLSLNSTFFPWEDMAVLAKLPNLEVLKADNAFW-GTDWKLDEDVVFPKLNCLAVRHG  781

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N LERWEA++ NFP LE L L W  +LE+IP    EI  LKSIE+  C  +V+ SAK+I+
Sbjct  782   N-LERWEATSDNFPMLEELYLSWLHLLEEIPESIGEIMTLKSIEIRGCNSAVITSAKQIR  840

Query  642   REQHEQGN  619
               Q   GN
Sbjct  841   ENQEIYGN  848



>ref|XP_006367921.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X6 [Solanum tuberosum]
Length=403

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 81/141 (57%), Gaps = 1/141 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLE-KESFDQLIYLEINT  826
             NL KL+    + + + +N   KLP LEVL L    + G  W+L +  E     +   +  
Sbjct  263   NLKKLTLCRTNLQWEDMNILRKLPNLEVLKLKDYAFRGLTWKLSDVDEDGFLKLKFLLLE  322

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             S  L +WEA++ +FP LE  VL  C  LEKIP  FAEI  L+ IEL+ C+ SV+ SA++I
Sbjct  323   SLHLMQWEATSYHFPSLEHFVLTNCRYLEKIPFDFAEIQTLQLIELHECMRSVLVSAEQI  382

Query  645   QREQHEQGNDNMVVIEEHTLQ  583
             Q EQ   GND++++   + L+
Sbjct  383   QEEQQSFGNDDLIIRANYILE  403



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 78/132 (59%), Gaps = 2/132 (2%)
 Frame = -1

Query  999  LMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN  820
            L+KL+    S   + +   S LPKLEVL L    + G  W+  E   F +L +L I ++N
Sbjct  769  LVKLTLSGTSLPWEDMVELSMLPKLEVLKLRNYAFSGSVWKSREG-GFPRLKFLLIGSTN  827

Query  819  FLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
             LE W+A  ++FP L++LVL  C+ L++IP G +E P L+ IEL+ C  S V SA+ +Q 
Sbjct  828  -LEIWDADGTHFPNLQQLVLRHCKFLKEIPYGISEAPLLEKIELHCCKDSAVISARHLQE  886

Query  639  EQHEQGNDNMVV  604
            EQ   GND + +
Sbjct  887  EQQSLGNDGLKI  898



>ref|XP_004241950.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
 ref|XP_010322858.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 78/134 (58%), Gaps = 1/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+  C S   + + +   LP LEVL +    ++G  W L ++E F QL +L I+ +
Sbjct  732   SLKRLTLSCTSLPWEDMANIITLPNLEVLKIKDNGFLGDVWMLNDEEIFKQLKFLLISWT  791

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               L+ W+A + NFPKL+RL L  C  LE+IP  F +I  L+SIEL+ C  S   S K IQ
Sbjct  792   G-LKHWKAGSVNFPKLQRLFLKRCMNLEEIPQDFGDICTLESIELHKCSISAATSGKNIQ  850

Query  642   REQHEQGNDNMVVI  601
              EQ   GN+ + V+
Sbjct  851   EEQESIGNECLSVL  864



>gb|AEW48201.1| disease resistance protein RGH9 [Solanum x edinense]
Length=838

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 87/146 (60%), Gaps = 8/146 (5%)
 Frame = -1

Query  1005  KNLMKLSXRC-VSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   S   K ++   KLPKLEVL+LS   +IG  WE++E E F  L +L ++
Sbjct  662   QNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVE-EGFPHLNFLFLD  720

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                ++  W AS+ +FP LERL+L  C  L+ IP  FA+I  L  I++ YC  SVV+SAK+
Sbjct  721   DV-YIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQ  779

Query  648   IQRE-QHEQGNDNMVVIEEHTLQ*FM  574
             IQ++ Q   G+     IE HT   F+
Sbjct  780   IQQDIQDNYGSS----IEVHTRHLFI  801



>emb|CDP19994.1| unnamed protein product [Coffea canephora]
Length=991

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 1/137 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  KLPKLEVL L    ++G  WE+ E E F +L  L+++  
Sbjct  856   NLKKLTLEVTDQPWSEISTIGKLPKLEVLKLLFYSFLGEEWEVKEGE-FPKLRVLKLSNL  914

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
                  W AS+ NFP+LE+LV++ C  LE++P    E P L+ IE+  C  SV  S K+IQ
Sbjct  915   WDFRSWTASSDNFPRLEKLVVERCLKLEEVPSCLGECPTLEMIEVRGCRESVASSVKQIQ  974

Query  642   REQHEQGNDNMVVIEEH  592
             +EQ + GN+ + +  EH
Sbjct  975   QEQRDMGNEALKISIEH  991



>emb|CAB56299.1| NBS-LRR protein [Solanum acaule]
Length=938

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 86/145 (59%), Gaps = 6/145 (4%)
 Frame = -1

Query  1005  KNLMKLSXRC-VSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   S   K ++   KLPKLEVL+LS   +IG  WE++E E F  L +L ++
Sbjct  762   QNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVE-EGFPHLNFLFLD  820

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                ++  W AS+ +FP LERL+L  C  L+ IP  FA+I  L  I++ YC  SVV+SAK+
Sbjct  821   DV-YIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQ  879

Query  648   IQREQHEQGNDNMVVIEEHTLQ*FM  574
             IQ++  +    +   IE HT   F+
Sbjct  880   IQQDIQDNYGSS---IEVHTRHLFI  901



>gb|AEW48216.1| disease resistance protein RX3 [Solanum leptophyes x Solanum 
sparsipilum]
Length=937

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 86/145 (59%), Gaps = 6/145 (4%)
 Frame = -1

Query  1005  KNLMKLSXRC-VSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   S   K ++   KLPKLEVL+LS   +IG  WE++E E F  L +L ++
Sbjct  762   QNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVE-EGFPHLKFLFLD  820

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                ++  W AS+ +FP LERL+L  C  L+ IP  FA+I  L  I++ YC  SVV+SAK+
Sbjct  821   DV-YIRYWRASSDHFPYLERLILRDCRNLDSIPGDFADITTLALIDIDYCQQSVVNSAKQ  879

Query  648   IQREQHEQGNDNMVVIEEHTLQ*FM  574
             IQ++  +    +   IE HT   F+
Sbjct  880   IQQDIQDNYGSS---IEVHTRNLFI  901



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 72/133 (54%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
              L KL+ R        +     LP+LEVL L    + G  WE  + E F QL +L ++ +
Sbjct  749   TLKKLTLRGCQLPWNQMTILCMLPELEVLKLKDYAFQGSEWESTD-ERFQQLKFLLLDGT  807

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W   +  FPKLE LVL  C  L +IP   AEIP L+ IELY+C  S   SA  IQ
Sbjct  808   DLIH-WIVDSIQFPKLESLVLKNCYCLSEIPDDVAEIPTLQFIELYHCSSSADVSANRIQ  866

Query  642   REQHEQGNDNMVV  604
              EQH  GND++VV
Sbjct  867   EEQHSMGNDDLVV  879



>ref|XP_009764269.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=903

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 4/134 (3%)
 Frame = -1

Query  1014  VSCKNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLE  835
             +S K L   S R +S E  T+   +KLP LEVL L   ++    W+L +++ F QL +L 
Sbjct  756   ISLKRLTIFSAR-LSCEDMTV--LAKLPNLEVLKLRWVEFRPSVWKLNDEDQFKQLKFLL  812

Query  834   INTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSA  655
             +  + ++++WEAS+ NFP L RLVL     L++IP+ FAEI  L+SIELY C  ++  SA
Sbjct  813   LVDNTYIKQWEASSVNFPNLRRLVLHQIRNLKRIPLAFAEICTLESIELYMCPWNLEKSA  872

Query  654   KEIQREQHE-QGND  616
             KEIQ E     GND
Sbjct  873   KEIQEEVSSIAGND  886



>gb|AEW48218.1| disease resistance protein RX6 [Solanum hondelmannii]
Length=937

 Score = 88.6 bits (218),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 87/146 (60%), Gaps = 8/146 (5%)
 Frame = -1

Query  1005  KNLMKLSXRC-VSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   S   K ++   KLPKLEVL+LS   +IG  WE++E E F  L +L ++
Sbjct  761   QNLKSLTFRGEFSMAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVE-EGFPHLKFLFLD  819

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                ++  W AS+ +FP LER++L  C  L+ IP  FA+I  L  I++ YC  SVV+SAK+
Sbjct  820   DV-YIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQ  878

Query  648   IQRE-QHEQGNDNMVVIEEHTLQ*FM  574
             IQ++ Q   G+     IE HT   F+
Sbjct  879   IQQDIQDNYGSS----IEVHTRHLFI  900



>ref|XP_006364072.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=584

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+      + + +N   KLP LEVL L    ++G  W+L +++    L    +   
Sbjct  444   NLKKLTLCRTHIQWEDMNILRKLPNLEVLKLKHHAFLGLIWKLSDEDEDGFLKLKFLLLE  503

Query  822   NF-LERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             N  L +WEA++ +FP LE LVL  C +LE++P  FAEI  L+ IEL+ C  SV+ SA++I
Sbjct  504   NMNLMQWEATSYHFPNLEHLVLTDCYLLEQMPFDFAEIQTLQLIELHKCKCSVLVSAEQI  563

Query  645   QREQHEQGNDNMVV  604
             Q EQ   GND++V+
Sbjct  564   QEEQQSLGNDDLVI  577



>gb|AEW48217.1| disease resistance protein RX5 [Solanum stenotomum]
Length=936

 Score = 88.6 bits (218),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 87/146 (60%), Gaps = 8/146 (5%)
 Frame = -1

Query  1005  KNLMKLSXRC-VSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   S   K ++   KLPKLEVL+LS   +IG  WE++E E F  L +L ++
Sbjct  760   QNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVE-EGFPHLKFLFLD  818

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                ++  W AS+ +FP LER++L  C  L+ IP  FA+I  L  I++ YC  SVV+SAK+
Sbjct  819   DV-YIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQ  877

Query  648   IQRE-QHEQGNDNMVVIEEHTLQ*FM  574
             IQ++ Q   G+     IE HT   F+
Sbjct  878   IQQDIQDNYGSS----IEVHTRHLFI  899



>emb|CAB50786.1| Rx protein [Solanum tuberosum]
Length=937

 Score = 88.2 bits (217),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 87/146 (60%), Gaps = 8/146 (5%)
 Frame = -1

Query  1005  KNLMKLSXRC-VSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   S   K ++   KLPKLEVL+LS   +IG  WE++E E F  L +L ++
Sbjct  761   QNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVE-EGFPHLKFLFLD  819

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                ++  W AS+ +FP LER++L  C  L+ IP  FA+I  L  I++ YC  SVV+SAK+
Sbjct  820   DV-YIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQ  878

Query  648   IQRE-QHEQGNDNMVVIEEHTLQ*FM  574
             IQ++ Q   G+     IE HT   F+
Sbjct  879   IQQDIQDNYGSS----IEVHTRHLFI  900



>ref|XP_006344326.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=1302

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 76/140 (54%), Gaps = 1/140 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL  L     S   + +   + LP LEVL      + G  W+L E   F +L YL I  +
Sbjct  315   NLKHLRLAETSLPWEDMAVLANLPNLEVLKADHA-FTGTDWDLNEDVVFQKLKYLRIKRA  373

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + LE WEA++ +FP LE+LVL   E LE IP  F EI  LK +++ YC P+V DSA+ I 
Sbjct  374   DDLEMWEAASDSFPMLEQLVLQHLEELEDIPQSFGEIMTLKLVQVKYCSPTVDDSARNIL  433

Query  642   REQHEQGNDNMVVIEEHTLQ  583
              +Q   GN  + +I   +LQ
Sbjct  434   EDQQSWGNYELQIIIVPSLQ  453


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 71/128 (55%), Gaps = 1/128 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL  L     S   + ++  + LP LEVL      + G  W L E   F +L YL I ++
Sbjct  1161  NLKHLRLAYTSLPWEEMDVLANLPNLEVLKADSA-FNGTDWTLNEDVVFQKLKYLRIWSA  1219

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + LERWEA++ NFP LE+LVL   E LE+IP    EI  LK +++  C P+V  SA+ I 
Sbjct  1220  DDLERWEATSDNFPMLEKLVLQHLEELEEIPQSVGEIMTLKLVQVENCNPAVDTSARNIL  1279

Query  642   REQHEQGN  619
             +EQ   GN
Sbjct  1280  QEQQGWGN  1287



>ref|XP_006364178.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=860

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 2/128 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KLS     F  + +   +KLP LEVL      W G  W+L E   F +L YL ++  
Sbjct  725   NLAKLSLNSTFFPWEDMAVLAKLPNLEVLKADNAFW-GTDWKLDEDVVFPELKYLGVHHG  783

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N LE WEA++ NFP LE L L W   LE+IP    EI  L+SIE+  C  +V+ SA++I+
Sbjct  784   N-LEIWEATSDNFPMLEELNLSWLHFLEEIPESIGEIMTLRSIEIKDCNSAVITSAEQIR  842

Query  642   REQHEQGN  619
               Q   GN
Sbjct  843   ENQEIYGN  850



>emb|CDP15705.1| unnamed protein product [Coffea canephora]
Length=1302

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+ +  S     I++  KLP LEVL L +  ++G  W + E E F  L  L+++T 
Sbjct  1129  NLKKLTLKWNSQPWSEISTIGKLPHLEVLKLLQDSFVGEEWVVKEGE-FPNLRVLQLSTL  1187

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             +   RW AS+ NF  LE+LV++WCE LE++P    E P L+ IE+ +C  S+++S ++I+
Sbjct  1188  DIC-RWTASSGNFSHLEKLVVNWCEELEEVPSCLGECPTLEMIEVKWCHESILNSVEQIR  1246

Query  642   REQHEQGNDNM-VVIEE  595
             +EQ + GN+ + +VIE+
Sbjct  1247  QEQMDGGNEVIKMVIED  1263



>ref|XP_009591230.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009591231.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=900

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL +    ++ G W L ++  F+QL +L I+ ++ LE+W+A + NFP+L+ LVL 
Sbjct  785  LPNLQVLKIKDNGFVDGRWRLNDEMIFNQLKFLLIHKTD-LEQWKAGSVNFPELQCLVLK  843

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             C  L+KIP    EI  L+SIEL+ C  S  +S K+IQ+EQ   GND + V+
Sbjct  844  ECISLKKIPQDIGEIYTLESIELHNCSTSAENSVKKIQKEQKSMGNDCLTVL  895



>ref|XP_009589795.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=903

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 81/134 (60%), Gaps = 4/134 (3%)
 Frame = -1

Query  1014  VSCKNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLE  835
             +S K L   S R +S E  T+   +KLP LEVL L   ++    W+L +++ F QL +L 
Sbjct  756   ISLKRLTIFSGR-LSCEDMTV--LAKLPNLEVLKLRWVEFRPSVWKLNDEDQFKQLKFLL  812

Query  834   INTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSA  655
             +  + ++++WEAS+  FP L RLVL     L++IP+ FAEI  L+SIELY C  ++  SA
Sbjct  813   LVDNTYIKQWEASSVYFPNLRRLVLHQIRNLKRIPLAFAEICTLESIELYMCSRNLEKSA  872

Query  654   KEIQREQHE-QGND  616
             +EIQ E     GND
Sbjct  873   REIQEEVSSVAGND  886



>emb|CDP12770.1| unnamed protein product [Coffea canephora]
Length=811

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            I++  KLPKLEVL L    ++G  WE+ E E F  L  L+++       W AS+ NFP+L
Sbjct  688  ISTIGKLPKLEVLKLLDGFFVGEEWEMKEGE-FPSLRVLQLSNLWKFRSWTASSDNFPRL  746

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGND  616
            ++LV+  CE LE++P    E P L+ IE+ +C  SV +S K+IQ+EQ + GN+
Sbjct  747  QKLVVHNCENLEEVPSCLGECPTLEMIEVKWCRTSVANSVKQIQQEQIDMGNE  799



>emb|CDP19634.1| unnamed protein product [Coffea canephora]
Length=1229

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  KLPKLEVL L    ++G  WE+ E E F +L  L+++    L  W AS+ NFP+L
Sbjct  1097  ISTIGKLPKLEVLKLFCYSFVGDEWEMKEGE-FPKLRVLKLSNLMDLRSWTASSDNFPRL  1155

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
             E+LV+  C  LE++P    + P L+ IE+  C  SV  S K+IQ+EQ + GN+ + ++ E
Sbjct  1156  EKLVVHGCVHLEEVPSCLGDCPTLEMIEVRGCRESVASSVKQIQQEQIDMGNEVLKILIE  1215



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 9/140 (6%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGA-------WELLEKESFDQLI  844
             +++KL+ R  +   + I S   LP L+VL +  CD+           WE  E E F  L 
Sbjct  716   SVIKLALRSCTITWEFIKSIGSLPNLQVLKMRICDFKTKEMQSSDEEWEPTEGE-FSSLQ  774

Query  843   YLEINTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVV  664
             +L +     + RW+A  ++FP+L  LV+  C  LE+IP    +IP L+ IEL  C PSVV
Sbjct  775   FLLLEKLKLV-RWKADKTHFPRLRHLVIRECSALEEIPRAIGDIPTLEIIELDECSPSVV  833

Query  663   DSAKEIQREQHEQGNDNMVV  604
              SA++IQ +Q E GND + V
Sbjct  834   ASARQIQEDQSENGNDGLEV  853



>ref|XP_009764013.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=412

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+ +   F ++ + +   LP LEVL +    +    W L + E F QL +L I+ +
Sbjct  274   SLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKDV-FYNDEWILNDDEIFSQLKFLLISVT  332

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + L  W+A + NFPKL+RLVL  C  LE+IP  F EI +L+SIELY C  S   S +E++
Sbjct  333   S-LRHWKAVSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSTAKSVEELR  391

Query  642   REQHEQGNDNMVVI  601
              EQ   GND + V+
Sbjct  392   EEQESMGNDCLSVV  405



>ref|XP_009764014.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=411

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L +L+ +   F ++ + +   LP LEVL +    +    W L + E F QL +L I+ +
Sbjct  274   SLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKDV-FYNDEWILNDDEIFSQLKFLLISVT  332

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + L  W+A + NFPKL+RLVL  C  LE+IP  F EI +L+SIELY C  S   S +E++
Sbjct  333   S-LRHWKAVSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSTAKSVEELR  391

Query  642   REQHEQGNDNMVVI  601
              EQ   GND + V+
Sbjct  392   EEQESMGNDCLSVV  405



>emb|CDP18682.1| unnamed protein product [Coffea canephora]
Length=1077

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++   LPKLEVL L     +G  WE+ E E F  L  L++        W AS+ NFP+L
Sbjct  936   ISTIGMLPKLEVLKLLDYSVVGEDWEMKEGE-FPSLRVLKLRALRDFRSWTASSDNFPRL  994

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNM-VVIE  598
             E+LV+  C++LE++P    E P L+ IE+ +C  SV  S K+IQ+ Q + GN+ + ++IE
Sbjct  995   EKLVVHNCQMLEEVPSCLGECPTLEMIEVTWCRESVASSVKQIQQAQKDMGNEFLKILIE  1054

Query  597   E  595
             E
Sbjct  1055  E  1055



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score = 85.5 bits (210),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 75/141 (53%), Gaps = 9/141 (6%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGA--------WELLEKESFDQL  847
             ++ KL+   ++     + +   LP LEVL + KC + G          W L E E F  L
Sbjct  588   SIRKLTLSKLTIHWGFMTTIGLLPNLEVLKIRKCTFKGQEMQPRDDEEWVLTEGE-FCSL  646

Query  846   IYLEINTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSV  667
              +L +     L  W+A  ++ P+L  L++  C  LE+IP G  EIP L+ IEL  C PSV
Sbjct  647   QFLLLEKLKNLVHWQADETHLPRLRHLLIRGCSALEEIPSGIGEIPTLEIIELDECSPSV  706

Query  666   VDSAKEIQREQHEQGNDNMVV  604
             V SAK+IQ +Q E GND + V
Sbjct  707   VASAKQIQEDQREYGNDGLEV  727



>emb|CDP18680.1| unnamed protein product [Coffea canephora]
Length=1268

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 78/137 (57%), Gaps = 1/137 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+   +      I++  KLPKLEVL L    ++G  WE+ E E F  L  L++   
Sbjct  1117  NLKKLTLSYIEQPWSEISTIGKLPKLEVLKLLDGSFVGEEWEMKEGE-FPSLRVLKLRGL  1175

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
                  W AS  NFP+LE+LV+  C +LE++P    E P L+ IE+  C  SV  S K+IQ
Sbjct  1176  RDFCSWTASFDNFPRLEKLVVHSCLMLEEVPSCLGECPALEVIEVSGCSESVASSVKQIQ  1235

Query  642   REQHEQGNDNMVVIEEH  592
             +EQ + GN+ + ++ E+
Sbjct  1236  QEQIDMGNEVLKILIEN  1252



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 2/115 (2%)
 Frame = -1

Query  948  SFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLER  769
            +  K+P LEVL L    + G  WE ++   F  L +L +  +N LE W+A+++++P L+ 
Sbjct  793  TVGKIPNLEVLKLKDRAFSGQVWEPIDG-GFLALKFLLLE-NNELEIWKATSTHYPSLQH  850

Query  768  LVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            LVL  C+ L +IP G  EIP L+ IELY C  S V SAK I  EQ   GND++ V
Sbjct  851  LVLRLCDALIEIPCGIGEIPTLQIIELYSCGHSAVRSAKRIHEEQQSIGNDDLEV  905



>ref|XP_011072560.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=903

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 74/135 (55%), Gaps = 2/135 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTIN-SFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +L KLS R    + + I      LP L+VL L K   IG  WE +E + F +L  LEI  
Sbjct  746   SLKKLSLRGCRLQWEDITRKIGPLPLLQVLKLHKDSVIGSEWETVEGQ-FRRLSVLEITD  804

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              + LE W    S+FP L RL L     L+KIP GFAEI  L+ IEL  C  S V S KEI
Sbjct  805   IDDLEYWTVDNSHFPCLHRLCLRHLRKLKKIPWGFAEIQTLELIELAMCSDSAVISVKEI  864

Query  645   QREQHEQGNDNMVVI  601
               +Q E GN+++ V+
Sbjct  865   AEQQEELGNEDLQVV  879



>gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Erythranthe 
guttata]
Length=727

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -1

Query  948  SFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLER  769
            +  K+P+LEVL +    + G  WE  ++        L   +   +E WEA++ +FP+L+ 
Sbjct  588  NIGKIPELEVLKVKDRAFAGRIWETADEGFLGLKFLLLEKSE--IEIWEATSDHFPRLQH  645

Query  768  LVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            LVL  C  LE+IP G   IP L+ IE+Y C  SVV SAK IQ EQ   GND++ V
Sbjct  646  LVLRLCGCLEEIPFGVGGIPTLQMIEIYSCAHSVVSSAKRIQEEQQSYGNDDLEV  700



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+        K +N  S LP LEVL L    ++G  WE  E E F +L YL I+ +
Sbjct  641   NLKKLTLSSSYLPWKDMNVLSMLPNLEVLKLKNNAFVGSDWEQYE-EGFSRLKYLLIDKT  699

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W A+++ FP L+ L L  C  L ++P+ FAEIP L+ I++Y      V S  +I+
Sbjct  700   DLVH-WRATSTQFPSLKHLRLFRCRCLREVPLDFAEIPYLQIIDVYGSY-DAVRSVMQIK  757

Query  642   REQHEQGNDNMVV  604
             +EQ   GND+++V
Sbjct  758   QEQESVGNDDLLV  770



>ref|XP_009603186.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=191

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            + +  +LP LEVL L    + G  W L E   F +L  L+IN  N +  WEAS+ + P+L
Sbjct  70   MTTLGQLPNLEVLRLKCFAFQGRNWNLNEG-GFKKLKLLQINRKNLV-LWEASSESLPRL  127

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            E L+L +C  LE IP    +IP +K IEL+ C  +   SA+E+  EQ   GN+ +VV
Sbjct  128  EFLILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQQSLGNEVLVV  184



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (59%), Gaps = 2/126 (2%)
 Frame = -1

Query  960  KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFP  781
            K ++   KLPKLEVL LS   +IG  WE++E E F  L +L ++   ++  W AS+ +FP
Sbjct  747  KDLSIVGKLPKLEVLKLSGHAFIGEGWEVVE-EGFPHLKFLFLDEV-YIRYWRASSDHFP  804

Query  780  KLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             LERL L  C  L+ IP  FA+I  L   ++  C  SVV+SAK+IQ++  +    ++ V 
Sbjct  805  YLERLFLRDCYFLDSIPRDFADITTLALTDISSCRQSVVNSAKQIQQDIQDNYGSSIEVH  864

Query  600  EEHTLQ  583
               TLQ
Sbjct  865  TRDTLQ  870



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL  L+      E   +   S LP LEVL L    + G  W L ++  F +L  L I+ 
Sbjct  738   ENLKSLTLVATHLEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNL-DEGGFKKLKLLHIHQ  796

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             +  +  W+A++ + P LE LVL +C  LE+IP    +IP LK I+L+YC  + V SA+EI
Sbjct  797   TRLV-HWQATSDSLPVLEYLVLMFCSQLEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEI  855

Query  645   QREQHEQGNDNMVV  604
             Q EQ   GN+ +VV
Sbjct  856   QEEQKSIGNEVLVV  869



>ref|XP_011072163.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=866

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 2/113 (2%)
 Frame = -1

Query  942  SKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLV  763
              LP LEVL+L  C + G  W  +E + F +L  LE++ SN LE W A   +FP LE+L 
Sbjct  745  GSLPNLEVLMLKGCGFKGSEWNPIEGQ-FPRLKVLELSMSN-LECWRAENVHFPNLEKLS  802

Query  762  LDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            L   + LE+IP G   I  L  IE+YYC  S+V+SA +I  EQ   GN+++ V
Sbjct  803  LRLMDDLEEIPSGIGYIATLGLIEVYYCSDSIVNSAMQILEEQRSNGNEDLHV  855



>ref|XP_010319214.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=882

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             + L +L  RC     + I+  SKLP+LEVL L     IG  W+  ++  F +L +L ++ 
Sbjct  717   QKLKELKLRCTYLPWECISIISKLPELEVLKLKSKSLIGNEWKATDQVGFPKLRFLLLDN  776

Query  825   SNFLERWE---ASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSA  655
                 E WE    S  +FP LERL++   + LE+IP GFA+   L+ IEL+YC PS+VD A
Sbjct  777   LPLTE-WENTTGSHDHFPSLERLIITNFKFLEEIPQGFADSKKLELIELHYCNPSLVDFA  835

Query  654   KEIQREQHE  628
             K +Q E  E
Sbjct  836   KNVQVEHEE  844



>ref|XP_009782925.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=795

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 79/135 (59%), Gaps = 6/135 (4%)
 Frame = -1

Query  981  RCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG--AWELLEKESFDQLIYLEINTSNFLER  808
            R   F  + I++   LP LE L L +  W+ G   W L  ++ F++L +L     +F   
Sbjct  662  RWFGFPWEDISTLVMLPYLEELKLKR--WVVGDEVWRLSNEDKFERLNFLLFCQLDF-RC  718

Query  807  WEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHE  628
            WEAS+ +FP L+RLVL+ C  LE+IP  F EI  L+SIEL+ C  S  DSA+ I++EQ +
Sbjct  719  WEASSDSFPNLKRLVLNHCPYLEEIPTDFGEICTLESIELHNCSTSAEDSARNIEQEQED  778

Query  627  QGNDNMVVIEEHTLQ  583
             GN N + +  H+ Q
Sbjct  779  MGN-NCLKVYIHSTQ  792



>ref|XP_011087335.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=794

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L++L L  C +    W + E E F QL  L +   N LE W A+   FP+LE LV+ 
Sbjct  678  LPNLQILKLRDCKFELELWVVSEAE-FCQLKCLIMEKLN-LEYWAANNICFPRLEHLVIR  735

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
             C  L++IP G   IP LK IE+Y C PS+VDSA+ IQ+EQ   GND + V
Sbjct  736  HCSHLDRIPHGIGGIPTLKLIEVYECNPSLVDSARMIQKEQESYGNDGLEV  786



>gb|EYU17661.1| hypothetical protein MIMGU_mgv1a025742mg, partial [Erythranthe 
guttata]
Length=726

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LEVL L +    G AW LL++  F +L  L+I + N+L  W A +S+FP LE+LVL+
Sbjct  592  LPNLEVLNLKERSIFGPAWNLLQEGGFLRLKSLKI-SWNYLLHWNADSSHFPALEKLVLE  650

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
               +L +IP    EIP L+SI+L+ C  S   SA +I  EQ   GND++ V
Sbjct  651  DLVLLHEIPSSIGEIPTLRSIDLHRCSDSAAFSAMKILEEQKSLGNDDLRV  701



>emb|CDP17260.1| unnamed protein product [Coffea canephora]
Length=1080

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  KLP LEVL L    +IG  WE+ E E F  L  L+++  + + RW AS+ NF  L
Sbjct  935   ISTIGKLPHLEVLKLLDDSFIGEEWEMKEGE-FPSLRVLKLSDLD-IRRWTASSGNFSHL  992

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
             E+LV+D C+ LE++P    E P L++IE+  C  SVV+S  +I++EQ + GN  + ++ E
Sbjct  993   EKLVVDNCDELEEVPSCLGECPTLETIEVTDCPESVVNSVNQIRQEQLDMGNAILKIVIE  1052

Query  594   H  592
             +
Sbjct  1053  N  1053



>ref|XP_011101340.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=908

 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L KL+   + F    ++  ++L  LEVL L    + G AWE  E E F +L +L I  +
Sbjct  764   SLKKLTLSGLRFPWGHMSDIAELRNLEVLKLRCYAFQGRAWETYEGEFF-RLKFLLIEDT  822

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + LE W     +FP LERL+L  C  L+++P    E+PNL+ +EL  C PS+V SAK I 
Sbjct  823   D-LEYWYVDYESFPSLERLILQHCYKLKEMPSEIGELPNLEKMELVDCHPSLVASAKRIA  881

Query  642   REQHEQGNDNMVV  604
              EQ   GND + V
Sbjct  882   EEQQSAGNDVLQV  894



>ref|XP_009603185.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 69/122 (57%), Gaps = 2/122 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            + +  +LP LEVL L    + G  W L E   F +L  L+IN  N +  WEAS+ + P+L
Sbjct  114  MTTLGQLPNLEVLRLKCFAFQGRNWNLNEG-GFKKLKLLQINRKNLV-LWEASSESLPRL  171

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
            E L+L +C  LE IP    +IP +K IEL+ C  +   SA+E+  EQ   GN+ +VV   
Sbjct  172  EFLILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQQSLGNEVLVVRAY  231

Query  594  HT  589
            +T
Sbjct  232  NT  233



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 75/133 (56%), Gaps = 5/133 (4%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+      +   +++   LP LEVL L    + G  WE L+   F  L  L++  S
Sbjct  748   NLKKLTLSDTLLDWSEMSTLGMLPNLEVLKLKDYAFKGSRWEPLDG-GFRLLRVLQLGRS  806

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W AS+ +FP+LER+VL  C  LE+IP GF E+  L+++ELY+  P+   SA+ I 
Sbjct  807   DLVH-WHASSHHFPRLERVVLKHCTHLEEIPCGFGEVSALQNMELYWPTPAAAASARLI-  864

Query  642   REQHEQGNDNMVV  604
               QH++  D  +V
Sbjct  865   --QHQKQQDQRMV  875



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+        +++ S  +LP LEVL L    + G  WE +E E F  L  L I  
Sbjct  785   ENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPKWEQVE-EGFCSLKLLLIEM  843

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             S+ LE W AS  +FP LE LVL  C  L+ IP    +IP L+ IEL     S + SAKEI
Sbjct  844   SD-LEHWSASNDHFPCLEHLVLKGCLHLDSIPHELGDIPTLQIIELENSSQSALLSAKEI  902

Query  645   QREQHEQGNDNMVV  604
             Q EQ   GND + V
Sbjct  903   QEEQQSYGNDALEV  916



>ref|XP_009772629.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=592

 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 84/136 (62%), Gaps = 4/136 (3%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIG-GAWELLEKESFDQLIYLEINT  826
             NL +LS   +    +  ++ ++L KLE L L+K D++G  +W++ + E F  LIYL + +
Sbjct  441   NLRQLSLLEICLTEEMASNIARLRKLESLKLTKTDFLGENSWDVTDVE-FPALIYLSLLS  499

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              +   R  AS  +FP LE+LV+  C  LE+IP+ FA+IP L+ IE+  CL S+ DSA +I
Sbjct  500   RDIRGR-NASEESFPMLEQLVIHGCRDLEEIPLSFADIPTLQLIEVEDCLNSIGDSAMDI  558

Query  645   QREQHEQGN-DNMVVI  601
             +RE  E    DN+ V+
Sbjct  559   KREVEETSRCDNLQVL  574



>ref|XP_006365680.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X1 [Solanum tuberosum]
Length=881

 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 2/128 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL         + +N  + LP LEVL L    + G  W++ E   F +L YL+I  S
Sbjct  726   NLKKLRLSYTRIPWEAMNLLANLPNLEVLKLDYA-FAGTDWKVDEDVVFHKLKYLQI-AS  783

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + LERWE  + NFP LE+L+L     LE+IP    EI  L  I+L +C   VV SAK+IQ
Sbjct  784   DCLERWEIGSDNFPMLEQLLLYGMNKLEEIPESIGEIMTLNLIQLDHCSSGVVISAKKIQ  843

Query  642   REQHEQGN  619
             +EQ   GN
Sbjct  844   QEQQSLGN  851



>emb|CDP18040.1| unnamed protein product [Coffea canephora]
Length=1243

 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  KLPKLEVL L     +G  WE+ E E F  L  L+++    L  W AS+ NFP L
Sbjct  1117  ISTIGKLPKLEVLKLLDDSVVGEEWEMKEGE-FPSLRVLKLSNLWNLRSWTASSDNFPCL  1175

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
             E+LV+  CE LE++P    E P L+ IE+  C  SV  S K++Q+EQ + GN+ + ++ E
Sbjct  1176  EKLVVRNCENLEEVPSCLGECPTLEMIEVKRCRESVASSVKQVQQEQIDMGNEVLKILIE  1235



>ref|XP_006365681.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X2 [Solanum tuberosum]
Length=705

 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 2/128 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL         + +N  + LP LEVL L    + G  W++ E   F +L YL+I  S
Sbjct  550   NLKKLRLSYTRIPWEAMNLLANLPNLEVLKLDYA-FAGTDWKVDEDVVFHKLKYLQI-AS  607

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + LERWE  + NFP LE+L+L     LE+IP    EI  L  I+L +C   VV SAK+IQ
Sbjct  608   DCLERWEIGSDNFPMLEQLLLYGMNKLEEIPESIGEIMTLNLIQLDHCSSGVVISAKKIQ  667

Query  642   REQHEQGN  619
             +EQ   GN
Sbjct  668   QEQQSLGN  675



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (55%), Gaps = 7/144 (5%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG-----AWELLEKESFDQLIYL  838
             NL KL+ +        +   SKLPKLEVL L    + G       WE+ +   F +L +L
Sbjct  734   NLKKLTLQGTHLLWSQLTIISKLPKLEVLQLKALLFFGDELGETVWEVSDM-GFPKLRFL  792

Query  837   EINTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDS  658
              +     L+ W AS  +FP LER+++  C  L++IP GF++   LK IEL+ C PS+V+ 
Sbjct  793   LVENKG-LKNWNASDDSFPCLERVIIKNCRFLQEIPKGFSDSMTLKRIELWGCTPSLVNF  851

Query  657   AKEIQREQHEQGNDNMVVIEEHTL  586
             AKEIQ EQ   GN+ + V    T+
Sbjct  852   AKEIQEEQEILGNNILQVYAYDTI  875



>gb|EYU31552.1| hypothetical protein MIMGU_mgv1a025226mg [Erythranthe guttata]
Length=1038

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L KL+          ++   +LPKLE L L    + G  W+  + E F +L +L+++  
Sbjct  901   SLKKLTLHDFKLSRDEMSMIGRLPKLEALKLLYTVFDGKEWKTNDDE-FRELKFLKLDAL  959

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               + RW  S  +FP+L+RLV+  C  L+K P    +IP L+ ++++ C  SV +SA ++Q
Sbjct  960   K-IRRWNTSDDHFPRLQRLVMHKCWKLKKFPRSLGDIPTLQVVDIHSCSKSVANSALDVQ  1018

Query  642   REQHEQGNDNMVVI  601
             REQ E GND + +I
Sbjct  1019  REQLEYGNDELKII  1032



>gb|EYU19036.1| hypothetical protein MIMGU_mgv1a021264mg, partial [Erythranthe 
guttata]
Length=768

 Score = 82.0 bits (201),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LEVL L+    +G  WE +E + F  L +L+I   + LE W   +++FP LE+LVL+
Sbjct  635  LPNLEVLNLNCKSVVGAEWETVEGQ-FCNLRFLQIYMCSDLEWWTTDSNHFPSLEQLVLE  693

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            + + L++IP    EIP L SIEL YC  S V SAKEI  EQ + GN  + V
Sbjct  694  YMDKLKEIPSCIGEIPTLGSIELNYCSKSAVISAKEILDEQEDLGNVGLRV  744



>ref|XP_009776932.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=159

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            + KLEVL L   +++G    L +++ F+QL +L +     + +WEA + NFP L++LVL 
Sbjct  30   IAKLEVLKLRDNEFVGQECRLSDEDEFNQLKFLLLAEPRLV-KWEAGSVNFPTLQKLVLR  88

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
             C  LE+IP+   EI  L++IEL  C  S  +SA EIQ EQ   GN
Sbjct  89   KCIRLEEIPIDIGEICTLEAIELICCSASAQNSATEIQDEQESMGN  134



>ref|XP_006367977.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=243

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  1005  KNLMKLS-XRCVSFEVKTINS-FSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEI  832
             ++L +LS  RC  F  + I+S F  LP LE L L  C      W L +K+ F + + L +
Sbjct  101   ESLRRLSLTRCSKFIWEEISSTFIMLPHLEELKLKYCRAEDDVWRLTDKDIF-RSLKLLL  159

Query  831   NTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAK  652
              +   L+ WEAS+ NFP L+RLVL  C+ L++IP  F EI  L+SIEL+ C  +  +SA+
Sbjct  160   LSELNLKGWEASSDNFPNLKRLVLKKCKDLQEIPTDFGEICTLESIELHDCSTTSEESAR  219

Query  651   EIQREQHEQGNDNMVV  604
              I++EQ + GN+ + V
Sbjct  220   NIEQEQEDMGNNILKV  235



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 66/114 (58%), Gaps = 1/114 (1%)
 Frame = -1

Query  960  KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFP  781
            + + S + LP LEVL L   ++ G AW L +++ F QL +L +     L  WEA + NFP
Sbjct  742  QDMASLAALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLAEPRLLN-WEAGSVNFP  800

Query  780  KLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
             L++LVL  C  LE+IP+   EI  L+ IEL  C  S  +SA EI+ EQ   GN
Sbjct  801  NLQKLVLRKCICLEEIPIDIGEICTLEMIELICCSSSAQNSANEIREEQESMGN  854



>emb|CDP11548.1| unnamed protein product, partial [Coffea canephora]
Length=947

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 2/129 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  KLP LEVL L    ++G  W + E E F +L  L+++  
Sbjct  752   NLKKLTLSSNGQPWSEISTIGKLPNLEVLKLLYHSFVGEEWVMKEGE-FPKLRVLKLSNL  810

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
              F   W A + NF  L++LVL WC  LEK+P    E   L+ IE+  CL SVVDS ++IQ
Sbjct  811   EF-RNWTAFSDNFSHLQKLVLHWCRKLEKVPSCLGECETLEMIEVEECLESVVDSVEQIQ  869

Query  642   REQHEQGND  616
             +EQ + GN+
Sbjct  870   QEQIDMGNE  878



>emb|CDP12799.1| unnamed protein product [Coffea canephora]
Length=1156

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = -1

Query  957   TINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPK  778
             +I+   KLP LEVL L    ++G  WE+ E E F  L +L++++ + + RW AS+ NF  
Sbjct  1039  SISRIGKLPNLEVLKLRYQAFVGEKWEVEEGE-FPNLRFLKLSSLD-IHRWTASSDNFSL  1096

Query  777   LERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             LE+LVL  C  LE++P    E P L+ IE+  C  S V++ K+IQ+EQ + GN+ + ++
Sbjct  1097  LEKLVLHDCVKLEEVPSCLGESPTLEMIEVSSCGKSTVNAIKQIQQEQMDMGNEALKIV  1155



>gb|EYU19026.1| hypothetical protein MIMGU_mgv1a020094mg [Erythranthe guttata]
Length=770

 Score = 82.0 bits (201),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 66/118 (56%), Gaps = 1/118 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL L    ++G  WE +E + F  L YL IN  + LE W   +S+FP+LE LVL 
Sbjct  642  LPNLQVLKLKASSFVGAEWETVEGQ-FCNLRYLLINMCSDLEWWTTDSSSFPRLEHLVLQ  700

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEEHTLQ  583
              + L +IP G  EIP L+SIEL  C    V SAK I  EQ + G    VV  +  L+
Sbjct  701  QLDKLNEIPSGIGEIPTLQSIELNLCHDDAVISAKSIFDEQEDLGLRVRVVARDSHLE  758



>ref|XP_011077104.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=898

 Score = 82.0 bits (201),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             + L KL+        + + +   LP L VL L +C + GG WE  E E F QL +L+I +
Sbjct  763   RMLKKLTLGGFMLSQQDMATIGSLPNLHVLKLRRCSFRGGKWETTEGE-FAQLKFLKIES  821

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             +N L+ W   +S+FP LERL+L  C  L +IP    EIP L+ IE+      + +SAK I
Sbjct  822   TN-LKHWVTDSSHFPTLERLLLYHCPELYEIPNVIGEIPTLELIEVKSWDEFLGNSAKRI  880

Query  645   QREQHEQGNDNMVV  604
             ++EQ + GN+ + V
Sbjct  881   KQEQEDSGNECLRV  894



>ref|XP_009794525.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794533.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794540.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794546.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009794554.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794561.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score = 82.0 bits (201),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL +    + G  W L ++  F+QL +L I  +N L++W+A + NFP+L+ LVL 
Sbjct  778  LPNLQVLKIKDNGFDGDVWRLNDEMIFNQLKFLLIYETN-LKQWKAGSVNFPELQCLVLK  836

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             C  L+ IP    EI  L+SIEL+ C  S   S K IQ+EQ   GND + V+
Sbjct  837  ECRSLKTIPQDIGEIYTLESIELHNCSTSAEKSVKNIQKEQKSMGNDCLTVL  888



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 71/122 (58%), Gaps = 2/122 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+        + + + S+LPKLEVL L  C ++G  WE  E E F  L  L I  S
Sbjct  691   NLRKLTLSWSYLPWEDMTNISRLPKLEVLKLRNCAFLGPEWEPPEDE-FLHLKQLLIENS  749

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + ++ W+AS  +FP L+RLVL  C  LE+IPV   EIP L+ +EL+ C  S   SAKEI 
Sbjct  750   DLVQ-WKASTIHFPSLDRLVLVNCRFLEEIPVEIGEIPTLRLLELHNCSKSAEISAKEIG  808

Query  642   RE  637
              +
Sbjct  809   EQ  810



>emb|CDP12821.1| unnamed protein product [Coffea canephora]
Length=1248

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  KLP LEVL L    ++G  WE+ E E F  L +LE++  
Sbjct  1068  NLRKLTLANNGQPWSKISAIGKLPSLEVLKLCCDSFVGEKWEMKEGE-FQNLRFLELSEL  1126

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             +F   W AS+ NF  LE+LVL  CE LE++P    E   L  IEL  C  SVV S K+IQ
Sbjct  1127  DF-RWWTASSDNFCCLEKLVLSSCESLEEVPSCLGEALTLDMIELEGCRASVVTSVKQIQ  1185

Query  642   REQHEQGNDNMVVIEE  595
              +Q + GN+++ ++++
Sbjct  1186  HQQMDMGNNDLKLMKD  1201



>ref|XP_006345615.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=202

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL K++        + ++  + LP LEVL      + G  W L E   F +L YL I  +
Sbjct  11    NLRKVTLSFTFIPWEVMDLLADLPNLEVLKGYDA-FKGTEWILNENVVFRKLKYLPILDA  69

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + L+RWEA + NFP LE+L+L    VL++IP    EI  LK IE+  C P+VV SA +IQ
Sbjct  70    D-LKRWEAHSDNFPMLEQLILHRFRVLQEIPDSIGEIMTLKFIEIKNCGPTVVSSANKIQ  128

Query  642   REQHEQGNDNMVV  604
             ++Q   GN ++ V
Sbjct  129   QDQESWGNYDLQV  141



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+        +++ S  +LP LEVL L    + G  WE +E E F  L  L+I  
Sbjct  788   ENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKPYAFTGTKWEQVE-EGFCSLKLLQIEM  846

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              + LE W AS  +FP LE LVL  C  L+ IP    +IP L+ IEL     S V SAKEI
Sbjct  847   FD-LEHWSASNDHFPVLEHLVLKCCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEI  905

Query  645   QREQHEQGNDNMVV  604
             Q EQ   GN+ + V
Sbjct  906   QEEQQNIGNETLEV  919



>ref|XP_004246080.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=871

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 7/122 (6%)
 Frame = -1

Query  972  SFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQL---IYLEINTSNFLERWE  802
            SF    I++   LP LE L L      G  W L +++ F  L   ++  IN    +E WE
Sbjct  746  SFRWTDISALVMLPNLEELKLKNYAANGYVWRLNDEDKFQSLELLLFCNIN----VEHWE  801

Query  801  ASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQG  622
            AS+ NFP L+RLVL  C  L++IP+ F EI +L+SIEL+ C     +SA++I++EQ + G
Sbjct  802  ASSDNFPNLKRLVLKECRKLKEIPIDFGEICSLESIELHNCSTLAEESARKIEQEQEDMG  861

Query  621  ND  616
            N+
Sbjct  862  NN  863



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+        +++ S  +LP LEVL L    + G  WE +E E F  L  L I  
Sbjct  780   ENLKKLTLSFTYLPWESMASLCRLPNLEVLKLKNYAFTGPKWEQVE-EGFGSLKLLLIEI  838

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             S+ ++ W AS  +FP LE LVL  C  L+ IP    +IP L+ IEL     S V SAKEI
Sbjct  839   SD-IKHWSASNDHFPVLEHLVLKSCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEI  897

Query  645   QREQHEQGNDNMVV  604
             Q EQ   GN+ + V
Sbjct  898   QEEQQSMGNETLEV  911



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+        +++ S  +LP LEVL L    + G  WE +E E F  L  L I  
Sbjct  821   ENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPKWEQVE-EGFCSLKLLLIEM  879

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             S+ LE+W AS  +FP LE LVL  C  L+ IP     IP L+ IEL     S V SAKEI
Sbjct  880   SD-LEQWSASNDHFPCLEHLVLKGCLHLDSIPRDLGFIPTLQIIELDNSSQSAVLSAKEI  938

Query  645   QREQHEQGNDNMVV  604
             Q EQ   GND + V
Sbjct  939   QEEQQSCGNDALQV  952



>ref|XP_009761168.1| PREDICTED: uncharacterized protein LOC104213363 [Nicotiana sylvestris]
Length=235

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 69/122 (57%), Gaps = 2/122 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            + +  +LP +EVL L    + G  W L E   F +L  L+IN +N +  WEAS+ + P+L
Sbjct  114  MTTLGQLPNVEVLRLKCFAFQGRNWNLNEG-GFKKLKLLQINETNLV-HWEASSESLPRL  171

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
            E L+L +C  LE IP    +IP LK  EL+ C  +   S++EI  EQ   GN+ +VV   
Sbjct  172  EFLILKYCYKLEDIPTEIGDIPTLKLTELHNCSQAAAPSSEEIGEEQQSLGNEVLVVRAY  231

Query  594  HT  589
            +T
Sbjct  232  NT  233



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = -1

Query  981  RCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWE  802
            RC   +   +N+  KL  LE+L L +C +    WE  E E F QL +L ++  + +  W 
Sbjct  724  RCTVLD-HHLNAIGKLLNLEILKLQECKFKSLRWEPNEGE-FCQLQFLRMDLVDLVN-WV  780

Query  801  ASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQG  622
               +NFP+L+ LV+  C  LE+IP+   +IP LK IE+    PSV+ SA+EIQ+ Q + G
Sbjct  781  VDDTNFPRLDHLVIRGCRHLEEIPLAIGDIPTLKVIEVDNSSPSVLASAREIQQAQLDSG  840

Query  621  ND  616
            ND
Sbjct  841  ND  842



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 72/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+        +++ S  +LP LEVL L    + G  WE +E E F  L  L I  
Sbjct  836   ENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPKWEQVE-EGFCSLKLLLIEM  894

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             S+ LE+W AS  +FP LE LVL  C  L+ IP     IP L+ IEL     S V SAKEI
Sbjct  895   SD-LEQWSASNDHFPCLEHLVLKGCLHLDSIPRDLGFIPTLQIIELDNSSQSAVLSAKEI  953

Query  645   QREQHEQGNDNMVV  604
             Q EQ   GND + V
Sbjct  954   QEEQQSCGNDALQV  967



>emb|CDP12774.1| unnamed protein product [Coffea canephora]
Length=1253

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+ R        I++  KLPKLEVL L +  ++G     +++E F +L  L+++  
Sbjct  1104  NLKKLTLRITKQPWSEISTIGKLPKLEVLKLCRNSFVGEE-WEMKEEEFPKLRVLKLSRL  1162

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
                  W AS+ NFP+LE+L++  C +LE++P    E P L+ IE+  C  SVV+S K+IQ
Sbjct  1163  WGFRSWTASSDNFPRLEKLIVHNCWMLEEVPSCLGECPTLEMIEVRGCFESVVNSVKQIQ  1222

Query  642   REQHEQGNDNMVVIEE  595
              EQ + GN+ + ++ E
Sbjct  1223  LEQIDMGNEILKILIE  1238



>ref|XP_011087334.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=821

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 73/131 (56%), Gaps = 4/131 (3%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L KL+ R        +N   KLP LE+L L  C ++   WE  E E F +L +L +   
Sbjct  695   SLKKLTLRDCGIRDPDMNRIGKLPNLEILKLQGCQFVSRKWEPDEGE-FHRLRFLLMENL  753

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N +  W A  S+F +L+ L +  C  LE IP+   +IP L+ IE++ C PSV++SA+ IQ
Sbjct  754   NLVN-WVADESHFRRLQHLFIQHCSDLEAIPLVIRDIPTLQVIEVHNCRPSVMNSARMIQ  812

Query  642   REQHEQGNDNM  610
              EQ E  ND +
Sbjct  813   EEQLE--NDGL  821



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 72/124 (58%), Gaps = 3/124 (2%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDW-IGGAWELLEKESFDQLIYLEIN  829
             KNL KLS       ++ +   SKLPKLE L L  C   IG  WE+ E E F QL +L ++
Sbjct  731   KNLKKLSFSKTHVNLEDLRILSKLPKLEALKLKFCSSNIGMEWEVTE-EGFPQLKFLLLS  789

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                 +  W AS+ +FP+LERL L  C  +  IP  F EI  L+ I++  C  SVV+SAK+
Sbjct  790   RLG-IRHWRASSDHFPRLERLFLVECANMISIPEDFVEITTLQLIDIRMCKESVVNSAKK  848

Query  648   IQRE  637
             IQ+E
Sbjct  849   IQQE  852



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 71/125 (57%), Gaps = 2/125 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+      +   I++   LP LEVL L    + G  WE L+   F  L  L I  +
Sbjct  748   NLKKLTLSDTFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWEPLDG-GFRLLRVLHIGRT  806

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N LE W AS  +FP+L+++ L  C  L +IP G  E+P+L+++EL++  P+   SA+ IQ
Sbjct  807   N-LEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVEVPSLQNMELFWPTPAAAASARFIQ  865

Query  642   REQHE  628
             +E+ +
Sbjct  866   QEKQK  870



>emb|CDP16512.1| unnamed protein product [Coffea canephora]
Length=907

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 81/136 (60%), Gaps = 2/136 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I+   +LP LEVL L    + G  WE+ E E F +L +L+++T 
Sbjct  755   NLRKLTLSKFRLPWNCISEIGRLPNLEVLKLLSKAFEGKVWEMKEGE-FLKLKFLKLDTL  813

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             +  E W++S+ + P+L+ L+L  C  L+++P GF +  +L+ IE+  C  SV +S + +Q
Sbjct  814   SIAE-WKSSSDHLPQLQHLILRNCRQLKEVPSGFGDSSSLEMIEVQLCTRSVEESVRLLQ  872

Query  642   REQHEQGNDNMVVIEE  595
             +EQHE GN+  V+++ 
Sbjct  873   KEQHEMGNELKVLVDR  888



>ref|XP_009762295.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=169

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 66/127 (52%), Gaps = 3/127 (2%)
 Frame = -1

Query  981  RCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG-AWELLEKESFDQLIYLEINTSNFLERW  805
             C  F    I+    LP LE L L      G   W L +++ F  L  L       LERW
Sbjct  37   HCFWFHWDDISILVMLPNLEELKLKVAVVTGDQVWRLSDEDKFQSLKLLFKGIH--LERW  94

Query  804  EASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ  625
            EAS+ +FP L RLVL  C  L++IP  F E   L+SIE + C     DSA+ I++EQ + 
Sbjct  95   EASSDSFPNLRRLVLKNCNYLKEIPTNFGEFCTLESIEFHNCSSLAEDSARNIEQEQEDM  154

Query  624  GNDNMVV  604
            GN+++ V
Sbjct  155  GNNSLKV  161



>ref|XP_010319426.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=310

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = -1

Query  951  NSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLE  772
            ++F  LP LE L L  C+     W + +K  F  L  L ++  N L+RWEAS+ NFP L+
Sbjct  184  STFIMLPNLEELKLKYCEADDDVWIMSDKVIFKSLKLLLLSDLN-LKRWEASSDNFPNLK  242

Query  771  RLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            RLVL  CE L++IP  F EI  L+SIEL+ C  +  DSA+ I++EQ + GN+ + V
Sbjct  243  RLVLKICEDLQEIPTDFGEICTLESIELHDCSATSEDSARNIEQEQEDMGNNMLKV  298



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 84/146 (58%), Gaps = 8/146 (5%)
 Frame = -1

Query  1005  KNLMKLSXRC-VSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   S   + ++   KLPKLEVL LS   + G  WE++E E F  L +L ++
Sbjct  768   QNLKSLTFRGEFSLAWRDLSIVGKLPKLEVLKLSGNAFKGKEWEVVE-EGFPHLKFLSLD  826

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                +++ W AS+ +FP LERL L  C  L+ IP  FA+I  L  I++  C  SV +SAK+
Sbjct  827   DV-YIQYWRASSDHFPYLERLFLKDCYSLDSIPRDFADITTLALIDISKCQQSVGNSAKQ  885

Query  648   IQRE-QHEQGNDNMVVIEEHTLQ*FM  574
             IQ++ Q   G+     IE HT + F+
Sbjct  886   IQQDIQDNYGSS----IEVHTRELFI  907



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 70/125 (56%), Gaps = 2/125 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+      +   I++   LP LEVL L    + G  WE L+   F  L  L I  +
Sbjct  748   NLKKLTLSDTFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWEPLDG-GFRLLRVLHIGRT  806

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N LE W AS  +FP+L+++ L  C  L +IP G  E+ +L++IEL++  P+   SA+ IQ
Sbjct  807   N-LEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVEVSSLQNIELFWPTPAAAASARIIQ  865

Query  642   REQHE  628
             +E+ E
Sbjct  866   QEKQE  870



>ref|XP_009789218.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789219.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789220.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=775

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL  L+      E   +   S LP LEVL L    + G  W L ++  F +L  L I+ 
Sbjct  629   ENLKSLTLVATHLEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNL-DEGGFKKLKLLHIHQ  687

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             +  +  W+A++ + P LE LVL +C  LE+IP    +IP LK I+L+YC  + V SA+EI
Sbjct  688   TRLV-HWQAASDSLPVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEI  746

Query  645   QREQHEQGNDNMVV  604
               EQ   GN+ +VV
Sbjct  747   LEEQKSIGNEVLVV  760



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 66/112 (59%), Gaps = 1/112 (1%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            + S + LP LEVL L   ++ G AW L +++ F QL +L ++    +  WEA + NFP L
Sbjct  748  MASLAALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLSEPRLVN-WEAGSVNFPNL  806

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
            ++LVL  C  LE+IP+   EI  L+ IEL  C  S  +SA EI+ EQ   GN
Sbjct  807  QKLVLRKCIRLEEIPLDIGEICTLEMIELICCSSSAQNSANEIREEQESMGN  858



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+        K ++    LP LEVL L     IG  WE  E   F QL +L ++ 
Sbjct  718   QNLKKLTFIFTYMPWKNMDIVGMLPNLEVLKLRSSACIGEEWEPSEN-GFHQLKFLLLHC  776

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             S+    W+A++ +FP LE LVL  C  L++IP+ FA+   L+SIE+  C  SVV SA++I
Sbjct  777   SD-PNYWKATSDHFPLLEHLVLRDCYHLQEIPLDFADSLTLQSIEIENCERSVVTSAEQI  835

Query  645   QREQHEQGNDNMVV  604
             Q EQ   G D+++V
Sbjct  836   QEEQRNLGVDDLIV  849



>ref|XP_009800104.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800105.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800106.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1741

 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  +LP LE+L L    + G  WE+ + E F +L YLE++  N + +W  S   FPKL
Sbjct  1609  ISTIGELPNLEILKLHLRAFEGNHWEVKDSE-FPELTYLELDDIN-IAQWSVSDDAFPKL  1666

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ  625
             + LVL  C+ LEKIP  F +  +L+SIE+ +C  SV +SA+EIQ  QHE+
Sbjct  1667  KCLVLTKCKRLEKIPSHFDDSVSLRSIEVNWCNLSVAESAQEIQTTQHEE  1716



>ref|XP_009773958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009773959.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=884

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL  L+      E   +   S LP LEVL L    + G  W L ++  F +L  L I+ 
Sbjct  738   ENLKSLTLVATHLEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNL-DEGGFKKLKLLHIHQ  796

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             +  +  W+A++ + P LE LVL +C  LE+IP    +IP LK I+L+YC  + V SA EI
Sbjct  797   TRLV-HWQAASDSLPVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSAGEI  855

Query  645   QREQHEQGNDNMVV  604
               EQ   GN+ +VV
Sbjct  856   LEEQKSIGNEVLVV  869



>emb|CDP08021.1| unnamed protein product [Coffea canephora]
Length=854

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 69/105 (66%), Gaps = 2/105 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            I++   LP LEVL L    ++G  W+++E E F +L +L ++T +  E W AS  + PKL
Sbjct  736  ISAIGTLPNLEVLKLLSGTFVGRTWDMMEDE-FQKLKFLSLDTLDIAE-WNASYDHLPKL  793

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
            ERLVL  C+ LEKIP   + I +L++IE+++C  SV +SA EI++
Sbjct  794  ERLVLRNCKGLEKIPEDLSNIASLETIEVHWCGQSVEESAIEIRK  838



>gb|AEW48209.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=908

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 2/126 (2%)
 Frame = -1

Query  960  KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFP  781
            K +    KLPKLEVL LS   + G  WE++E E F  L  L +    +++ W A + +FP
Sbjct  776  KDLGIVGKLPKLEVLKLSYNAFKGKEWEVVE-EGFPHLKSLFLYKV-YIQYWRARSDHFP  833

Query  780  KLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             LERL L  C  L+ IP  FA+I  L  I++ YC  SV +SAK+IQ++  +    ++ V 
Sbjct  834  YLERLFLGGCYSLDSIPRDFADITTLALIDISYCRQSVRNSAKQIQQDIQDNYGSSIEVH  893

Query  600  EEHTLQ  583
              H L+
Sbjct  894  TRHLLK  899



>gb|EYU24428.1| hypothetical protein MIMGU_mgv1a001134mg [Erythranthe guttata]
Length=880

 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 69/133 (52%), Gaps = 1/133 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L KLS R  S     +     LP LE LVL      G  W+ +E E F +L +LE+   
Sbjct  720   SLKKLSLRGCSLHWGDLTMIGSLPYLEGLVLGVNSVSGSEWDPVEGE-FLRLKFLELYYV  778

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               L+ W A + +FP LE+LVL     LE+IP+G  EIP L  IEL  C  S   SA +I 
Sbjct  779   TDLKHWNADSCHFPVLEKLVLTEINKLEEIPLGIGEIPTLGFIELVRCSESAAISAVKIL  838

Query  642   REQHEQGNDNMVV  604
              EQ   GN+ + V
Sbjct  839   EEQESLGNEGLFV  851



>emb|CDP08019.1| unnamed protein product [Coffea canephora]
Length=1758

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 70/109 (64%), Gaps = 2/109 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++ S LP LEVL L    ++G  W+++E E F +L +L + T +  E W AS  + P+L
Sbjct  1640  ISAISSLPNLEVLKLLSGAFMGRTWDMMEDE-FQKLKFLSLETLDIAE-WNASYDHLPRL  1697

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHE  628
             ERLVL  C+ LEKIP   ++I +L++IE+++C  SV +SA EI +   E
Sbjct  1698  ERLVLQHCKDLEKIPEDLSDITSLETIEVHWCGQSVEESAIEIGKATGE  1746


 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 70/122 (57%), Gaps = 3/122 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  +LP L+VL L    + G  W++  +E F  L +L ++  
Sbjct  1182  NLKKLTLSNFRLPWSHISTIGRLPNLKVLKLLSGAFEGKIWDV--EEEFQNLKFLRLDNL  1239

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N + +W AS  +FPKLERLVL  C+ LE+IP  F  I  L  IE+++C  S  +SAK+I+
Sbjct  1240  N-IAQWNASCDDFPKLERLVLQNCKDLEEIPEDFGNIYTLGMIEVHWCGRSAEESAKKIE  1298

Query  642   RE  637
              E
Sbjct  1299  EE  1300



>gb|EYU39515.1| hypothetical protein MIMGU_mgv1a023519mg [Erythranthe guttata]
Length=817

 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -1

Query  942  SKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLV  763
              LP L+VL L  C++    WE  E   F +L YL I  SN L+ W    S+FP+L  LV
Sbjct  700  GSLPNLQVLKLRDCNYCWNQWETSEG-GFLELKYLLICNSN-LKYWITETSHFPRLISLV  757

Query  762  LDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGND  616
            L     LE+IP G  EIP L+ IEL  C  ++ DSA+ IQ EQ + GND
Sbjct  758  LHNFRYLEEIPDGIGEIPTLELIELKNCRKTLADSAERIQEEQQDYGND  806



>emb|CDP11974.1| unnamed protein product [Coffea canephora]
Length=1481

 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  KLP LEVL L    + G  WE+ E E F  L YL+++  
Sbjct  1344  NLKKLTLSKFRLPWSQISTIGKLPHLEVLKLLSRAFDGQIWEMTEGE-FQSLKYLKLDNL  1402

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
              ++ +W+AS  + P L  LVL  C+ LE++P    +I  L+ IE+++C  S   S KEI+
Sbjct  1403  -WIAQWKASNDHLPCLRHLVLQRCKKLEEVPSSLGDIRTLERIEVHWCSQSAAVSVKEIE  1461

Query  642   REQHEQGNDNMVVI  601
              EQ + GN+ ++V+
Sbjct  1462  DEQRDIGNEELMVL  1475



>ref|XP_009764213.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764214.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764215.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764216.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764217.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=173

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (58%), Gaps = 9/126 (7%)
 Frame = -1

Query  942  SKLPKLEVLVLSKCDWIGG------AWELLEKESFDQLIYLEINTSNFLERWEASASNFP  781
            S LPKLEVL L K  +  G       WE+ E   F +L +L +    +L  W A+   FP
Sbjct  5    SMLPKLEVLKLKKNAFADGENVGEDVWEVTEM-GFPKLKFLLLEWL-YLHYWRATDDYFP  62

Query  780  KLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ-GNDNMVV  604
            +LER+++  C  +++IP GFA+   L+ IEL+ C  S+V+SAK IQ+EQ E  GND + V
Sbjct  63   RLERIIIRSCFFIKEIPEGFADSMTLQLIELHQCSSSLVNSAKRIQKEQLENLGNDMLKV  122

Query  603  IEEHTL  586
                T+
Sbjct  123  YAYDTI  128



>ref|XP_006367044.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=119

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LE L L  C      W L +K+ F + + L + +   L+ WEAS+ NFP L+RLVL 
Sbjct  2    LPHLEELKLKCCRAKDDVWRLSDKDIF-RSLKLLLLSELNLKGWEASSDNFPNLKRLVLK  60

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQG  622
             C+ L+KIP  F EI  L+SIEL+ C  +  DS + I++E+ + G
Sbjct  61   KCKDLQKIPTDFVEICTLESIELHDCTTTAEDSVRNIEQEREDMG  105



>ref|XP_006348578.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=915

 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 62/107 (58%), Gaps = 1/107 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LE L L         W L  +  F+ L +L  +  N L+ WEAS+ NFP L RLVL 
Sbjct  722  LPNLEELKLKDHAANDHVWRLSAETKFESLKFLLFHGLN-LKYWEASSDNFPNLRRLVLK  780

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGND  616
             C  L +IP+ F EI  L+SIELY C     +SA++I++EQ + GN+
Sbjct  781  KCTKLNEIPIDFGEICTLESIELYQCGVGAEESARKIEQEQEDMGNN  827


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  825  SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
            S  L  WEAS+ +FP L+RL L  C  L +IP  F EI   +SIELY C     +SA++I
Sbjct  844  SGILSIWEASSDSFPNLKRLALKKCNYLNEIPTDFGEICTFESIELYQCSIGAEESARKI  903

Query  645  QREQHEQGND  616
            ++EQ + GN+
Sbjct  904  EQEQEDMGNN  913



>gb|AEW48212.1| disease resistance protein RGH1 [Solanum leptophyes x Solanum 
sparsipilum]
 gb|AEW48213.1| disease resistance protein RGH2 [Solanum leptophyes x Solanum 
sparsipilum]
Length=905

 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 2/126 (2%)
 Frame = -1

Query  960  KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFP  781
            K ++   KLPKLEVL LS   + G  WE++E E F  L  L +    ++  W A + +FP
Sbjct  778  KDLSIVGKLPKLEVLKLSYNAFKGKEWEVVE-EGFPHLKSLFLYKV-YIRYWRARSDHFP  835

Query  780  KLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             LERL L  C  L+ IP  FA+I  L  I++ YC  SV +SAK+IQ++  +    ++ V 
Sbjct  836  YLERLFLGGCYSLDSIPRDFADITTLALIDISYCRQSVGNSAKQIQQDIQDNYGSSIEVH  895

Query  600  EEHTLQ  583
              H L+
Sbjct  896  TRHLLK  901



>emb|CDP04753.1| unnamed protein product [Coffea canephora]
Length=1258

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+          I++  KLP L+VL L    + G  W + E+  F  L  L++  
Sbjct  1116  RNLKKLTLSDNKQPWSEISTIGKLPNLQVLKLKHEAFAGEEW-VKEEGEFPSLRVLKLAR  1174

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              +F  RW A++ NFP+LE+LVL  C  LE++P    E P L++IE+  C  SVV S ++I
Sbjct  1175  LDF-RRWTAASDNFPRLEQLVLYNCRELEEVPSCLGECPTLEAIEVGRCGESVVSSVEKI  1233

Query  645   QREQHEQGNDNMVV  604
             Q EQ + GN+++ +
Sbjct  1234  QEEQMDMGNEDLKI  1247



>ref|XP_006346790.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=890

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (59%), Gaps = 11/146 (8%)
 Frame = -1

Query  1002  NLMKLS-XRCVSFEVKTINSFSK-LPKLEVLVL-------SKCDWIGGAWELLEKESFDQ  850
             +L +LS  +C  F+   ++S +  LP LEVL L       ++C  +   W + +K+ F  
Sbjct  738   SLRRLSLSQCCYFDWADLSSTAMMLPNLEVLKLIHYEPLSNECR-LSDEWRMSDKDVFKS  796

Query  849   LIYLEINTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPS  670
             L  L ++ +N L+ WEAS+ NFP L+RLVL  C  L++IP  F EI  L+S+EL+ C  +
Sbjct  797   LKLLLLSGTN-LKHWEASSDNFPILKRLVLKKCRHLQEIPADFGEICTLESVELHDCSAT  855

Query  669   VVDSAKEIQREQHEQGNDNMVVIEEH  592
               DSAK I+REQ + GN+ + V   H
Sbjct  856   AEDSAKNIEREQEDMGNNILKVYIIH  881



>ref|XP_009800005.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=731

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 4/135 (3%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIG-GAWELLEKESFDQLIYLEINT  826
             NL  LS R      +   + ++L KLE L LSK +++G   W+  + E F  L YL +  
Sbjct  583   NLRHLSIRGFCLTEEMALNITRLRKLERLKLSKTEFLGENCWDATDIE-FPALKYLSLLW  641

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              N +  W AS  +FP LE+LV+  C  LE+IP+ FA+IP L+ IE+  C+ SV DSA +I
Sbjct  642   CN-MRGWNASEESFPMLEKLVIQGCRDLEEIPLSFADIPTLQLIEVEDCMESVEDSAMDI  700

Query  645   QREQHEQ-GNDNMVV  604
             +RE  E  G D + V
Sbjct  701   KREIEENTGCDTLQV  715



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 2/132 (2%)
 Frame = -1

Query  999  LMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN  820
            L KL+     F  + + +   L  LEV+ L++C + G  WE +E E F +L +L+I  +N
Sbjct  741  LKKLTLSGCLFCWEDMTTVGSLQNLEVMKLTRCSFEGCKWETIEGE-FPRLKFLKIRWTN  799

Query  819  FLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
             L+ W   +S+FP LE L L  C+ L +IP    EIP LK IE+     S+V SAK+I+ 
Sbjct  800  -LQHWVTDSSHFPSLEHLQLFSCQRLGEIPDVLGEIPTLKIIEVNRSDRSLVKSAKQIKE  858

Query  639  EQHEQGNDNMVV  604
            EQ   GND + V
Sbjct  859  EQQSFGNDYLEV  870



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 2/108 (2%)
 Frame = -1

Query  960  KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFP  781
            K I   + LP LEVL L    + G  WE  E E+F +L +  I+++N LE WEAS+ NFP
Sbjct  891  KDIACIAMLPNLEVLKLKNYAFQGPDWEPTE-EAFRRLKHFLIDSTN-LENWEASSDNFP  948

Query  780  KLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
             LE LVL  C+ L+ IP G  EI  L+  EL+YC  S   SAK I+ E
Sbjct  949  CLEHLVLRGCKFLKGIPDGIEEINTLQRFELHYCSESAEISAKGIEVE  996



>emb|CDP16510.1| unnamed protein product [Coffea canephora]
Length=1418

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 75/136 (55%), Gaps = 2/136 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I+   KLP LEVL L    + G  WE+ E E F  L +L++++ 
Sbjct  1280  NLRKLTLSKFHLPWSYISEIGKLPNLEVLKLLSKAFEGEVWEMKEGE-FLNLKFLKLDSL  1338

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N  E W AS+ + P+L+ L+L  C  L+++P GF EI  L+ IE+  C  SV  S + +Q
Sbjct  1339  NLAE-WNASSDHLPQLQHLILRSCRQLKEVPSGFGEICTLEMIEVQLCTRSVGKSVRRLQ  1397

Query  642   REQHEQGNDNMVVIEE  595
              E  + GN+  V+I+ 
Sbjct  1398  TESLDMGNELKVLIDR  1413



>ref|XP_011071886.1| PREDICTED: uncharacterized protein LOC105157233 [Sesamum indicum]
Length=336

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNF  817
            + LS  C+ +E  T+   S LP LE L L      G  W  +E + F +L  L I  +N 
Sbjct  206  LTLSNCCIPWEEMTVFG-SVLPNLEKLKLYHSACKGSEWSPVEGQ-FPRLKVL-IIWNNI  262

Query  816  LERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
            L RW A + +FP LERL L   + LE+IP G  +IP L SI+LY C  S V+SAK+I  E
Sbjct  263  LVRWRAESIHFPNLERLHLSSMQCLEEIPSGIGDIPTLLSIDLYDCSDSCVNSAKQILEE  322

Query  636  QHEQGNDNM  610
            Q   GN+ +
Sbjct  323  QQSFGNETL  331



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 73/124 (59%), Gaps = 9/124 (7%)
 Frame = -1

Query  942  SKLPKLEVL--VLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLER  769
            ++LP LEVL  VL+ C   G  W       F QL  L I  +N+LE W+A+  NFP LER
Sbjct  785  AELPNLEVLKLVLNACH--GEEWNP-NVRVFTQLKVLLIQ-ANYLESWKATNDNFPVLER  840

Query  768  LVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNM---VVIE  598
            LVL  C  L++IP+ FA+I   + IEL  C P + +SA  IQ+EQ + GND +   ++  
Sbjct  841  LVLGSCSYLKEIPIEFADINTSQLIELDSCPPILAESAARIQQEQEDLGNDPIDVHIIPI  900

Query  597  EHTL  586
             HTL
Sbjct  901  RHTL  904



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 3/126 (2%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNF  817
            +KL   C+ +E   ++   +LP LEVL L      G  W  +    F +L  L I  +  
Sbjct  713  LKLDNTCLRWE--DMDIIGELPDLEVLKLMLNACCGQEWHPIAG-GFTRLKLLLIKHNYH  769

Query  816  LERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
            L+ W+A+  NFP LERLV+ +C  LE++P+ FA++ +L+ IEL YC   +  SA  IQ+E
Sbjct  770  LKYWKATNDNFPVLERLVITYCTELEEMPIEFADMDSLQLIELSYCTAQLEASAARIQQE  829

Query  636  QHEQGN  619
            Q + GN
Sbjct  830  QEDLGN  835



>gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial [Erythranthe 
guttata]
Length=880

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 62/112 (55%), Gaps = 0/112 (0%)
 Frame = -1

Query  945  FSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERL  766
               LP L+VL L    + G  WE +E   F  L +L I     L  W   +S+FP LE+L
Sbjct  752  IGSLPFLQVLKLETNAFCGDEWETIEGRQFCNLKFLLIEDCGELRYWRTESSHFPCLEQL  811

Query  765  VLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNM  610
             L   ++LE+IP    EIP L++I L YC  S V SAKEI  EQ E GN+++
Sbjct  812  SLRDLDILEEIPWDIGEIPTLETIVLKYCSHSAVISAKEIVEEQLENGNEDL  863



>ref|XP_009777218.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777219.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777220.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777221.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=791

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            ++S   LP LEVL L  C      W L + E F ++  L I  +  L+RWEA +  FP L
Sbjct  667  LSSLVVLPNLEVLKLKNCKRDDQVWSLKDDEEFARIKLLLIGNTK-LKRWEACSDCFPML  725

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHE-QGNDNMVV  604
            + LVL  C  LE IP  F     L+SIELY C  S  DSA+ I +E+ E +GND++ V
Sbjct  726  QSLVLKDCTELENIPEDFVNSCLLESIELYDCSTSAADSARSIAQEKQEMEGNDSLKV  783



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 71/126 (56%), Gaps = 3/126 (2%)
 Frame = -1

Query  960  KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASN--  787
            K +    KLPKLEVL L    ++G  W+  ++  F +L +L ++   +L  W  + SN  
Sbjct  750  KYMAVIGKLPKLEVLQLKDHAFVGNEWKATDQVRFHELKFLLLDCL-YLRNWRTTDSNDH  808

Query  786  FPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMV  607
            F  LER+++  C  L++IP GFA   NL+ IEL+ C PSVV  A++IQ +    G   + 
Sbjct  809  FSSLERVIIKGCNFLKEIPEGFAGSKNLELIELHKCTPSVVAIAQKIQEKHEYYGRCKLK  868

Query  606  VIEEHT  589
            VI+  T
Sbjct  869  VIDYDT  874



>ref|XP_011072146.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 67/115 (58%), Gaps = 1/115 (1%)
 Frame = -1

Query  960  KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFP  781
            K +   S LP LE LVL    + G  W  +E + F +L +L+I+ ++ LERW A   +FP
Sbjct  751  KMMTLGSLLPNLEKLVLKFNCFEGHEWNEVEGD-FPRLKFLDISHNDHLERWRAENIHFP  809

Query  780  KLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGND  616
             LE L LD  + LE+IP    +I  L SI L +C  SV++ AK+I  EQH  GN+
Sbjct  810  NLEILSLDDMQKLEEIPTILGDITTLHSIYLTHCTDSVINLAKQIVEEQHSYGNE  864



>ref|XP_011093987.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=821

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L KL+ +        ++    LP L++L LS C      W++ E E F QL YL I   
Sbjct  682   SLKKLALQHCVIHDPHMSRIGNLPNLQILKLSNCGIKNRKWKVNEGE-FCQLKYL-IMEH  739

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               ++ W A    FP+LE L++  C  L +IP G  +IP LK IE+   LP ++DS + IQ
Sbjct  740   LHMDFWAADDICFPRLEHLIIRHCAWLPEIPYGIGDIPTLKVIEVRQYLPPLLDSVRMIQ  799

Query  642   REQHEQGNDNMVV  604
             ++Q + GND + V
Sbjct  800   KKQEKNGNDGLEV  812



>gb|AJW77762.1| Pvr9-like protein 2 [Capsicum annuum]
Length=1307

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = -1

Query  957   TINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPK  778
             ++++ +KLP LE L L +    G  W + E+++F+ L YL + T   L +WE    +FP 
Sbjct  1182  SLSTIAKLPNLEELFLRRTIIHGEEWNMREEDTFENLKYLNL-TEVTLAKWEVGEESFPV  1240

Query  777   LERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIE  598
             +E+LVL  C +L++IP  F +I +LK I+L    P V DSAK+I++   + G D + V+ 
Sbjct  1241  IEKLVLRKCHMLKEIPPSFGDICSLKIIKLVES-PHVEDSAKKIKQYVEDMGGDELQVLG  1299

Query  597   EHTLQ*F  577
              H +  F
Sbjct  1300  RHNIPLF  1306



>ref|XP_009785700.1| PREDICTED: putative late blight resistance protein homolog R1B-11 
[Nicotiana sylvestris]
Length=433

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 74/133 (56%), Gaps = 1/133 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL  L      F  + + + + LP LE L  +   + G  W+L E   F +L YL+I  +
Sbjct  291   NLKHLRLTGTCFPWEDMVALANLPNLEKLK-AYSAFEGTNWKLNEDAVFHKLKYLKIVNA  349

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               LERWEA++ NFP LE+L+L   + LE+IP    EI  LK I++ +C  +   SA +IQ
Sbjct  350   INLERWEATSDNFPMLEQLLLSGLKKLEEIPQSIGEIMTLKFIKIEWCSSAADTSAMKIQ  409

Query  642   REQHEQGNDNMVV  604
              EQ   GND++ V
Sbjct  410   EEQTNCGNDSLEV  422



>gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata]
Length=898

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LEVL L    ++GG WE +E + F  L +L+I   + LE W   +++FP+LE+L L 
Sbjct  778  LPNLEVLKLKYKSFLGGEWETVEGQ-FCNLRFLQICEDSDLEWWTTDSTHFPRLEQLKLW  836

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
                L++IP    EIP L SIEL YC  S V SAKEI  EQ + GN
Sbjct  837  DLYKLKEIPSCIGEIPTLGSIELIYCSKSAVISAKEILDEQEDLGN  882



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          ++   +LP LEVL L    + G  W + E E F +L +L++++ 
Sbjct  1315  NLKKLTLSKFCLPWDCVSEIGRLPNLEVLKLLSRAFEGERWNMKEGE-FLKLKFLKLDSL  1373

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N + +W+ASA + PKL++LVL  C  LE++P GFA+IP L  IE+  C  S  +S + ++
Sbjct  1374  N-IAQWKASADHLPKLQQLVLRNCRHLEEVPSGFADIPTLVMIEMQLCRSSAEESVRILK  1432

Query  642   REQHEQGNDNMVVI  601
              EQ   G D++ V+
Sbjct  1433  EEQLGLGIDDLKVL  1446



>emb|CDP08396.1| unnamed protein product [Coffea canephora]
Length=649

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 76/132 (58%), Gaps = 1/132 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+     +    I++  KLP LEVL L K  ++G  WE+ E E F +L +LE++  
Sbjct  509   NLKKLTLSRNKWPWSEISTIGKLPNLEVLKLEKKSFMGEKWEMQEGE-FSKLRFLELSRL  567

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N       ++ NF  LE+LVL  C  LE++P+   E   ++ IE+ +C  S+V   ++IQ
Sbjct  568   NLCNWTAYNSDNFSHLEKLVLYSCLRLEEVPLCLGESSTIEMIEVEFCRKSLVSYVEQIQ  627

Query  642   REQHEQGNDNMV  607
             +EQ E GN +++
Sbjct  628   QEQMEMGNQDLI  639



>ref|XP_006365678.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
[Solanum tuberosum]
Length=620

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 2/128 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL +L+        + +N  + LP LEVL  +  D  G  W L E   F +L  L +++ 
Sbjct  467   NLKELTLSSTYIPWEAMNLLANLPNLEVLEYAAFD--GTDWRLNEDVVFRKLKRLLLHSC  524

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               L++WEA + NFP LE+L++   E LE+IP    +I  LK I++ YC   V  SA++IQ
Sbjct  525   RDLQKWEAGSDNFPMLEKLMMFRLEKLEEIPESIGDIMTLKLIQIKYCSSGVETSAEKIQ  584

Query  642   REQHEQGN  619
             +EQ   GN
Sbjct  585   QEQQSLGN  592



>ref|XP_004250409.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=843

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 73/129 (57%), Gaps = 3/129 (2%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNF  817
            +KL+   + +EV  +   + LP LEVL      + G  W+L E   F  L YL ++   +
Sbjct  709  LKLTHTYIPWEV--VELLANLPNLEVLKGYHA-FDGTYWKLDEDIVFHNLKYLLLSGCYY  765

Query  816  LERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
            L+RWEA  +NFPKLE+L+LD    +++IP    EI  LK I + +C   V  SA++IQ E
Sbjct  766  LKRWEAEPANFPKLEQLILDNFSAMKEIPESIGEIMTLKFIRVIWCSSGVEKSARKIQEE  825

Query  636  QHEQGNDNM  610
            Q   GN ++
Sbjct  826  QESFGNYDL  834



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LEVL L K    G  WE +E E F QL +L +   + ++ W A+ ++FP+L+RLV+ 
Sbjct  841  LPNLEVLKLRKNACQGIEWEPVE-EQFCQLKHLLLEEVDLVQ-WVANETHFPRLQRLVIR  898

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
             C  L++IP G  EIP L+ IEL  C  S V SA++IQ EQ   GN+ + V
Sbjct  899  SCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQEGLGNEELKV  949



>ref|XP_009625968.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=378

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 73/138 (53%), Gaps = 2/138 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+   +    K +N FSKLP L+VL L    ++G  WE+ E   F +L +L +   
Sbjct  212   NLTKLTLSGIRLSWKRMNIFSKLPNLKVLELKDHAFLGYEWEVTET-GFPKLKFLLLEYL  270

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
              F+  W ++   F  LE + +  C  LE+IP GFA+   L+ IEL+ C   +V  AK+IQ
Sbjct  271   -FIRYWRSTDDYFQCLEHVYIKDCRFLEEIPEGFADSVTLQLIELHQCCHPLVTFAKQIQ  329

Query  642   REQHEQGNDNMVVIEEHT  589
                 E GN+ + V    T
Sbjct  330   ETHEELGNNMLKVYASDT  347



>emb|CDP12798.1| unnamed protein product [Coffea canephora]
Length=1266

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 76/136 (56%), Gaps = 2/136 (1%)
 Frame = -1

Query  999   LMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN  820
             L KL+    +     I++  KLP LEVL L         WE+   E F  L +LE++  +
Sbjct  1130  LKKLTLSHTNMPWSEISTIGKLPSLEVLKLRNKAIDREKWEMKAGE-FLSLRFLELSQLD  1188

Query  819   FLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
              L  W A++ NF +LE+LV+  C  LE++P    E  NL+ IEL +C  S V S K+IQR
Sbjct  1189  -LRSWTATSDNFSRLEKLVVQSCWKLEEVPSCLGECLNLEMIELKWCRESAVTSVKQIQR  1247

Query  639   EQHEQGNDNMVVIEEH  592
             EQ + GN+ + +I E+
Sbjct  1248  EQMDAGNEGLRIILEN  1263



>ref|XP_011072139.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=825

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 75/129 (58%), Gaps = 3/129 (2%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNF  817
            ++LS  C+ +E  T+   S LP LE L L +  + G  W  +E + F +L  L I   N 
Sbjct  687  LRLSNCCIPWEKMTVFG-SILPNLEKLKLYRNAFKGPEWSPVEGQ-FPRLKVL-IIWYND  743

Query  816  LERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
            LERW A + +FP LERL L++ + LE+IP G  +IP L SI L  C  S V+SAK+I  E
Sbjct  744  LERWRAESLHFPNLERLHLEFMQCLEEIPWGIGDIPTLLSIHLEDCSDSSVNSAKQILEE  803

Query  636  QHEQGNDNM  610
            Q   GN+ +
Sbjct  804  QQSFGNETL  812



>emb|CDP20159.1| unnamed protein product [Coffea canephora]
Length=1261

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  KLP LEVL L +  ++G  W + E E F +L  L+++   F   W A + NF +L
Sbjct  1134  ISTIGKLPNLEVLKLLEDCFVGEEWVMKEGE-FPKLRVLKLSELEF-RNWTAFSDNFSRL  1191

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGND  616
             E+LVL  CE LEK+P    E   L+ IE+  C  SVVDS K+IQ+EQ + GN+
Sbjct  1192  EKLVLHSCEELEKVPSCLGECETLEMIEVKECPESVVDSVKQIQQEQIDMGNE  1244



>emb|CDP16515.1| unnamed protein product [Coffea canephora]
Length=815

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 71/117 (61%), Gaps = 2/117 (2%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LEVL L    + G  WE+ E E F +L  L++++ N  E W A + + P+LE L+L 
Sbjct  699  LPNLEVLKLLSKAFEGKVWEMKEGE-FLKLKILKLDSLNIAE-WNACSDHLPQLEHLILR  756

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEEHTL  586
             C  L+++P GF +   L+ IE+ +C  S+ +S K++Q EQH+ GN+  V+++   L
Sbjct  757  SCRELKEVPSGFGDSSTLEMIEVQFCTSSLEESVKQLQEEQHDMGNELKVLVDRSDL  813



>ref|XP_011075016.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Sesamum indicum]
Length=860

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 72/133 (54%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             ++ KL+ +        +N   KLP LE+L L  C +  G WE  + E F +L +L +   
Sbjct  726   SIKKLTLKGCRIRDHELNEIGKLPNLEILKLQYCYFESGNWEGEDGE-FCRLQFLLMKGL  784

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               +  W A  ++FP+LE LV+ +C  L++IP+   +IP LK +E+  C  S   SA+EI 
Sbjct  785   KLVN-WTADDTHFPRLEELVIQYCFELKEIPLAIGDIPTLKVMEVLRCGDSAKASAREIM  843

Query  642   REQHEQGNDNMVV  604
               Q + GND + V
Sbjct  844   EAQVDNGNDELQV  856



>ref|XP_006365690.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=573

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 3/129 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+        + +N  S LP LEVL      + G  W L E   F +L +L I + 
Sbjct  434   NLKKLTLSNTKIPWEVMNLLSNLPNLEVLK-GYYAFSGTDWTLNEDVVFRKLKHLLIRSK  492

Query  822   NFLERWEASAS-NFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             + L+RWEA+ S NFP LE+L+L+W   LE+IP    +I  LK I++  C  +V +SAK I
Sbjct  493   D-LQRWEAAGSDNFPMLEKLILNWLFELEEIPESIGDIMTLKLIQIVDCSSAVENSAKRI  551

Query  645   QREQHEQGN  619
             ++EQ   GN
Sbjct  552   RKEQQSFGN  560



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 78/140 (56%), Gaps = 6/140 (4%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEV-KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +NL  L+ R   F   K ++   KLPKLEVL LS   + G  WE++  E F  L +L ++
Sbjct  767   QNLKSLTFRGEFFLAWKDLSIVGKLPKLEVLKLSYNPFKGEEWEVV-AEGFPHLKFLFLD  825

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
                ++  W AS+ +FP LERL L  C  L+ IP  FA+I  L  I++  C  SV +SAK+
Sbjct  826   KV-YIRYWRASSDHFPYLERLFLRACYFLDSIPRDFADITTLALIDITRCQQSVGNSAKQ  884

Query  648   IQREQHEQGNDNMVVIEEHT  589
             IQ++  +    +   IE HT
Sbjct  885   IQQDIQDNYGSS---IEVHT  901



>ref|XP_009773003.1| PREDICTED: protein CHUP1, chloroplastic-like [Nicotiana sylvestris]
Length=358

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -1

Query  945  FSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERL  766
              +LP LE+L L      G  W L E   F +L  L I  +N ++ W+A++ + P LE L
Sbjct  4    LGRLPNLEMLRLKYFAIQGTNWNLSEG-GFKKLKLLHILMTNLVQ-WKATSDSLPNLECL  61

Query  765  VLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            V+  C  L++IP    +IP LK IEL++C  +VV SA+EI  EQ   GN+ +VV
Sbjct  62   VIRHCYKLKEIPAEIGDIPTLKLIELHHCSQAVVTSAEEILEEQQSMGNEVLVV  115



>emb|CDP11157.1| unnamed protein product [Coffea canephora]
Length=886

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 6/143 (4%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  +LP LEVL L    + G  W++ E+E F +L +L+++  
Sbjct  740   NLRKLTLSNFRLPWSHISTIGRLPNLEVLKLLLDAFEGLIWDM-EEEQFKELKFLKLDNL  798

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N + +W A+  + PKLERLVL  C+ LE+IP  FA I  LK IE+++C  S  +SAK I+
Sbjct  799   N-VSQWNATCDHLPKLERLVLQNCKDLEEIPDDFAAIGTLKLIEVHWCGQSAEESAKRIR  857

Query  642   REQHE----QGNDNMVVIEEHTL  586
              E  +      ND  ++++   L
Sbjct  858   EETGDIKVLISNDKCMIVDSAVL  880



>ref|XP_010319247.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=895

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 3/130 (2%)
 Frame = -1

Query  1002  NLMKLS-XRCVSFEVKTINS-FSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +L +LS  RC  F    ++S    LP LE L L  C  +   W L ++  F + + L + 
Sbjct  739   SLRRLSLTRCSDFLWTDVSSTVMMLPNLEELKLKNCQTLIDEWRLSDEHKF-RSLKLLLL  797

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
             + + L  WEA++ NFPKL+RLVL  C  L+ IP  F EI +L+SIELY C  +  +SA+E
Sbjct  798   SDSDLRYWEATSDNFPKLKRLVLKNCGDLQGIPADFGEICSLESIELYDCSTTAENSARE  857

Query  648   IQREQHEQGN  619
             I +EQ + GN
Sbjct  858   IVQEQEDMGN  867



>gb|EYU31597.1| hypothetical protein MIMGU_mgv1a001843mg [Erythranthe guttata]
Length=751

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL L    ++G  WE +E + F  L +L+I   + LERW   +++FP+LE+L L 
Sbjct  616  LPNLQVLKLKANSFVGTEWETVEGQ-FCNLKFLQICDCSDLERWTTESAHFPRLEQLDLR  674

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
              + LE+IP    EIP L+SI + YC  + V SA+ I  EQ E  N  + V
Sbjct  675  HLDRLEEIPSDIGEIPTLQSIRVQYCSKATVISARRILDEQEEFDNVGLRV  725



>ref|XP_011087308.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=774

 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 71/133 (53%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L KL+        + +     LP L+VL L    + G  WE  E E F +L YL I+  
Sbjct  619   DLKKLTLSGCRLSWEKMTVIGSLPNLQVLKLRDYAFEGSVWEPNEGE-FTKLKYLLID-R  676

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N LERW A  ++FP+L+ L L  C  LE IP    +I  L+ +EL+ C  SVV SA  IQ
Sbjct  677   NKLERWCADYTHFPQLQHLCLCHCFELEAIPTEVGDIGTLEMLELFRCRSSVVASAMLIQ  736

Query  642   REQHEQGNDNMVV  604
              EQ   GN+ ++V
Sbjct  737   EEQRNLGNEGLIV  749



>ref|XP_006348601.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1733

 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 3/118 (3%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I+   +LP LE+L L    + G  WE+ + E F +L YL ++  NF  +W  S   FP+L
Sbjct  1605  ISIIGELPNLEILKLLFRAFEGDRWEVKDAE-FPKLKYLILDNINF-SQWSISDDAFPEL  1662

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ-GNDNMVV  604
             E L L  CE LE+IP  F E  ++KSIE+  C  SV +SA EIQ  QHE+  ND   V
Sbjct  1663  ENLSLTKCERLEEIPSHFGEAVSIKSIEVNRCGSSVANSALEIQTTQHEEMANDAFTV  1720



>gb|AAT40487.1| putative disease resistance protein [Solanum demissum]
Length=2607

 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I+    L  LEVL L    + G  W + + E F QL YL++++ NF  +W  S  +FP L
Sbjct  2396  ISIVGTLCNLEVLKLLNKAFEGVQWNVNDTE-FPQLRYLKLDSLNF-AQWSISEDSFPSL  2453

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ-GNDNMVV  604
             ERLVL  C+ LEKIP    ++ +LKSIE+ +C  SV +SA+EIQ  QHE   ND   V
Sbjct  2454  ERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVANSAEEIQTTQHEDMANDAFTV  2511



>emb|CDP17920.1| unnamed protein product [Coffea canephora]
Length=1489

 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 72/122 (59%), Gaps = 3/122 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+      +   I++  +LP LEVL L    + G  W +  +E F  L +L ++  
Sbjct  1356  NLKKLTLSNFCLQWIRISTIGRLPNLEVLKLHSGAFEGKIWNV--EEEFKNLKFLSLDNL  1413

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N + +W AS  NFPKLERLVL  C+ LE+IP  F  I +L+ IE+++C  S  +SA++I+
Sbjct  1414  N-IAQWNASCHNFPKLERLVLQNCKDLEEIPEDFGMIGSLRMIEVHWCGKSAEESAEQIK  1472

Query  642   RE  637
              +
Sbjct  1473  ED  1474



>emb|CDP11161.1| unnamed protein product [Coffea canephora]
Length=871

 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 79/140 (56%), Gaps = 6/140 (4%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  +LP LEVL L    + G  W++ E+E F +L +L+++  
Sbjct  735   NLRKLTLSNFRLPWSHISTIGRLPNLEVLKLLLDAFKGLIWDM-EEEQFKELKFLKLDNL  793

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N  + W A+  + PKLERLVL  C+ LE+IP  FA+I  L+ IE+++C  SV +SA+ I 
Sbjct  794   NVCQ-WNATCDHLPKLERLVLQNCKGLEEIPYDFADIGTLEVIEVHWCRQSVEESAQRIA  852

Query  642   REQHEQGNDNMVVIEEHTLQ  583
                 E   D  V+I    L+
Sbjct  853   ----EATGDTKVLISGSYLR  868



>emb|CDP15718.1| unnamed protein product [Coffea canephora]
Length=905

 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            I++  KLP LEVL L    ++G  W + E E F +L  L+++   F   W A + NF +L
Sbjct  724  ISTIGKLPNLEVLKLLNNCFVGEEWVMKEGE-FPKLRVLKLSGLEF-HNWTAFSDNFFRL  781

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGND  616
            E+LVL  C  LEK+P    E   L+ I++ +C  SVVDS K+IQ+EQ + GN+
Sbjct  782  EKLVLHRCRKLEKVPSCLGECETLEMIQVKWCRESVVDSVKQIQQEQMDMGNE  834



>gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Erythranthe guttata]
Length=905

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (60%), Gaps = 1/107 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL L    ++G  WE +E + F  L +L+I   + LERW   +++FP+LE+L L 
Sbjct  776  LPNLQVLKLKANSFVGTEWETVEGQ-FCNLKFLQICDCSDLERWTTESAHFPRLEQLDLR  834

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGND  616
              + LE+IP    EIP L+SI + YC  + V SA+ I  EQ E  N+
Sbjct  835  HLDRLEEIPSDIGEIPTLQSIRVQYCSKTAVISARRILDEQEEFDNN  881



>emb|CDP08038.1| unnamed protein product [Coffea canephora]
Length=1468

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++   L  LE+L L    + G  WE+ E E F  L +L ++T 
Sbjct  1334  NLKKLTLSDFRLPWSHISAIGSLANLEILKLQSSAFEGQTWEMKEGE-FQSLRFLSLDTL  1392

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             + ++ W AS  + P+LERLVL  C  LE+IP+  AEI +L+ IE+ +C  SV +SAKEI
Sbjct  1393  DIVQ-WNASCDHLPRLERLVLQNCNDLEEIPLDLAEILSLQMIEVNFCAQSVEESAKEI  1450



>ref|XP_004237148.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=881

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 75/130 (58%), Gaps = 3/130 (2%)
 Frame = -1

Query  1002  NLMKLS-XRCVSFEVKTINSFS-KLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
             +L +LS  RC  F    ++S    LP LE L L  C  +   W L   E   + + L + 
Sbjct  741   SLRRLSLTRCSDFLWTDVSSTVLMLPNLEELKLKNCQTLIDEWRL-SDEDKFKSLKLLLL  799

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
             + + L+RWEA++ NFP L+RLVL  C  L++IP  F EI  L+SIEL+ C  +  DSA+E
Sbjct  800   SGSSLKRWEANSDNFPNLKRLVLKNCYRLQEIPADFGEIGTLESIELHNCSTTADDSARE  859

Query  648   IQREQHEQGN  619
             I +EQ + GN
Sbjct  860   IVQEQEDMGN  869



>ref|XP_006361240.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=859

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 75/139 (54%), Gaps = 7/139 (5%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG-----AWELLEKESFDQLIYL  838
             NL KL+ +        +   SKLP LEVL L      G      AWE+  K  F +L +L
Sbjct  700   NLKKLTLQGTRLLWSQLTVISKLPNLEVLKLKALKLFGNELGETAWEV-SKIEFPKLKFL  758

Query  837   EINTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDS  658
              I     LE W A   +FP LER+++  C  L+KIP GFA+   L+ IEL  C  S+V+ 
Sbjct  759   LIEKKG-LEYWTAEDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNF  817

Query  657   AKEIQREQHEQGNDNMVVI  601
             A+EIQ EQ ++  +N++ +
Sbjct  818   AREIQEEQQQRLGNNILQV  836



>ref|XP_006361239.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=992

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 75/139 (54%), Gaps = 7/139 (5%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG-----AWELLEKESFDQLIYL  838
             NL KL+ +        +   SKLP LEVL L      G      AWE+  K  F +L +L
Sbjct  833   NLKKLTLQGTRLLWSQLTVISKLPNLEVLKLKALKLFGNELGETAWEV-SKIEFPKLKFL  891

Query  837   EINTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDS  658
              I     LE W A   +FP LER+++  C  L+KIP GFA+   L+ IEL  C  S+V+ 
Sbjct  892   LIEKKG-LEYWTAEDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNF  950

Query  657   AKEIQREQHEQGNDNMVVI  601
             A+EIQ EQ ++  +N++ +
Sbjct  951   AREIQEEQQQRLGNNILQV  969



>gb|EYU29923.1| hypothetical protein MIMGU_mgv1a026346mg, partial [Erythranthe 
guttata]
Length=303

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 67/133 (50%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L KL+    + + + +     LP LEVL L      G  W  +E + F +L YL I  S
Sbjct  170   SLKKLTLSGSNLDWEELKGIGSLPNLEVLKLEYHSVRGSKWNPIEGQ-FLRLKYLRIAHS  228

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               L+ W A + +FP LE LVL     L +IP G  EIP L  I LY C  S   SA  I 
Sbjct  229   T-LKYWNAESFHFPALENLVLQKLHKLAEIPSGIGEIPTLGLIHLYDCSKSAAISAMGIL  287

Query  642   REQHEQGNDNMVV  604
              EQ  QGN+++ V
Sbjct  288   EEQQSQGNEDLRV  300



>ref|XP_006356446.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=1645

 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 69/114 (61%), Gaps = 3/114 (3%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I S  +LP L++L L    + G  WE+ + E F +L YLE+   N + +W  S   FP L
Sbjct  1517  ILSIGELPNLKILKLLLRTFEGDEWEVKDSE-FRELKYLELENLN-IAQWSVSEDAFPIL  1574

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ-GND  616
             ERLVL  C+ L+KIP  F +  +LKSIE+ +C   V +SAKEIQ  QH++  ND
Sbjct  1575  ERLVLTKCKRLKKIPSHFDDAVSLKSIEVNWCSLGVANSAKEIQAFQHDEIAND  1628



>emb|CDP21300.1| unnamed protein product [Coffea canephora]
Length=1433

 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 78/137 (57%), Gaps = 6/137 (4%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL +L+          I++  +LP LEVL L    + G  WE+ E+E F +L +L+++  
Sbjct  1301  NLRELTLSNFHLPWSHISTIGRLPNLEVLKLLLGAFEGLIWEM-EEEQFKELKFLKLDDL  1359

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N  + W A+  + PKLERLVL  C+ LE++P  FA+I  LK IE+++C  S  +SAK I+
Sbjct  1360  NICQ-WNATCDHLPKLERLVLQNCKDLEEVPNDFADIGTLKVIEVHWCGQSAEESAKGIR  1418

Query  642   REQHEQGNDNMVVIEEH  592
                 E   D  V+I  H
Sbjct  1419  ----EAVGDIEVIISSH  1431



>emb|CDP04724.1| unnamed protein product [Coffea canephora]
Length=613

 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 77/131 (59%), Gaps = 2/131 (2%)
 Frame = -1

Query  993  KLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFL  814
            KL+      + K ++    LP LE+L +    + G  WE  + E F  L +L+++ ++ L
Sbjct  477  KLTLIGSHIDWKGMSVIGMLPNLEILKIKDNFFNGPKWETGD-EGFCHLKFLKLSHTD-L  534

Query  813  ERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQ  634
            ++W AS+S+FP LE+LVL+ C  LE+IP    EI  L+ IE+Y+   SV DSA+ +Q  Q
Sbjct  535  QQWIASSSSFPCLEQLVLNGCLDLEEIPSSLEEIYTLEIIEVYHSCQSVADSARRLQEIQ  594

Query  633  HEQGNDNMVVI  601
               GND + V+
Sbjct  595  SYMGNDELKVL  605



>emb|CDO99208.1| unnamed protein product [Coffea canephora]
Length=542

 Score = 76.3 bits (186),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 82/139 (59%), Gaps = 3/139 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  KLP LEVL L    ++G  W + E E F +L +LE++  
Sbjct  403   NLKKLTLSGNCQPRSEISTIGKLPNLEVLKLRSESFVGEEWVVKEGE-FPKLRFLELSRL  461

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W A++ NF  LE+LV+  C  LE++P   AE   L+ IE+ +C  SV +S K+IQ
Sbjct  462   S-IRNWTATSDNFCHLEKLVVCNCLKLEEVPACLAECLTLEMIEVKWCRESVANSVKQIQ  520

Query  642   REQHEQGNDNM-VVIEEHT  589
             +EQ + GN+ + ++I+ +T
Sbjct  521   QEQMDSGNEVLKIIIKNYT  539



>ref|XP_010320562.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-4 [Solanum lycopersicum]
Length=1687

 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I+   +LP LE+L L    + G  WE+ + E F  L YL ++  N + +W  S   FPKL
Sbjct  1559  ISIVGELPNLEILRLLSRAFEGNEWEVNDSE-FRVLKYLNLDNIN-ISQWSLSNDAFPKL  1616

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ-GNDNMVV  604
             E LVL  C+ LE+IP  F +   LKSIE+  C  SV +SA EIQ  QHE   ND   V
Sbjct  1617  EHLVLTKCKQLEEIPSHFGDAVTLKSIEVNRCGRSVSNSALEIQTAQHEDMANDAFTV  1674



>emb|CDP05594.1| unnamed protein product [Coffea canephora]
Length=1250

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = -1

Query  957   TINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPK  778
              I++   L  LEVL L +  + G  W++ ++E F +L +LE++  + +  W+AS + FPK
Sbjct  1131  AISTIGGLLHLEVLKLREGAFRGQRWDVGDEE-FLELKFLELSNMDVV-LWKASYTPFPK  1188

Query  777   LERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIE  598
             LE+LV++ C  LE+IP  F+EI  LK I+L  C   V DSA++I +EQ + GN    V+ 
Sbjct  1189  LEQLVIEDCSDLEEIPFSFSEIEGLKLIQLRRCSYDVEDSAQQILQEQRDSGNPEFDVLI  1248

Query  597   EH  592
              H
Sbjct  1249  LH  1250



>emb|CDP19728.1| unnamed protein product [Coffea canephora]
Length=1099

 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 77/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I+   +LP LEVL L    + G  WE+ E E F +L +L++++ 
Sbjct  961   NLRKLTLSKFRLPWDCISDIGRLPNLEVLKLLSKAFDGKVWEMKEGE-FLKLKFLKLDSL  1019

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N L  W AS+ + P+L+ L+L  C  L+++P GF +   L+ IE+  C  S+ +S K ++
Sbjct  1020  N-LSEWNASSDHLPQLQHLILQSCWQLKEVPPGFGDSFTLEIIEVQMCTSSLEESVKRLE  1078

Query  642   REQHEQGNDNMVVIEE  595
              EQ E GN+  V+++ 
Sbjct  1079  EEQQEMGNELKVLVDH  1094



>ref|XP_011093989.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=701

 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 2/117 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            ++    LP L++L L  C      W++ E E F QL YL +  S  L+ W A    FP+L
Sbjct  578  MSRIGNLPNLQILKLRCCGIKNRKWKVNEGE-FCQLKYLMM-ASLHLDFWAADDICFPRL  635

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            E L++  C  L +IP G  +IP LK IE+   LP ++DS + IQ++Q + GND + V
Sbjct  636  EHLIIRRCSGLPEIPYGIGDIPTLKVIEVREYLPPLLDSVRMIQKKQEKNGNDGLEV  692



>gb|EYU31596.1| hypothetical protein MIMGU_mgv1a025161mg [Erythranthe guttata]
Length=754

 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 79/136 (58%), Gaps = 6/136 (4%)
 Frame = -1

Query  1002  NLMKLSXR--CVSFE-VKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEI  832
             +LMKL+    C+ +E +KT      LP L+VL L +  ++G  WE +E + F  L +L I
Sbjct  617   SLMKLTLHRTCLKWEDMKT--KIGLLPNLQVLKLKEYSFVGTEWETVEGQ-FRNLKFLLI  673

Query  831   NTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAK  652
                + LE W   +++FP+LE L L   + L++IP    EI  L+SI+L +C  S V SAK
Sbjct  674   YMCSDLEWWTTGSNHFPRLEHLHLQLLDKLKEIPSCIGEISTLQSIQLIWCSKSAVISAK  733

Query  651   EIQREQHEQGNDNMVV  604
             EI +EQ + GN  + V
Sbjct  734   EILKEQQDFGNVGLRV  749



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL L +  ++G  WE +E + F  L YL I +   LE W   +S+FP+LE L L 
Sbjct  736  LPNLQVLKLKEYSFVGTEWETVEGQ-FCNLRYLLIRSCRDLEWWTTDSSHFPRLEHLHLR  794

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            +   L++IP    EI  L+SIEL  C    V SAK+I +EQ + GN++  V
Sbjct  795  YLHKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQEDFGNEDFRV  845



>gb|AAV31175.1| Putative disease resistance protein, identical [Solanum tuberosum]
Length=842

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 78/134 (58%), Gaps = 6/134 (4%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNF  817
            +KLS  C+ +E  +I   SKLP LEVL L +  + G  W+  ++  F +L +L +     
Sbjct  657  LKLSRTCLPWEYMSI--ISKLPVLEVLQLKRYAFRGHKWKATDQIGFQKLRFLLLENL-M  713

Query  816  LERWE---ASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
            L++W     S  +FP LER+++  C  L++IP GFA+   L+ IEL+ C PS+V  A++I
Sbjct  714  LDKWTITTVSHDHFPSLERVLITDCIYLKEIPQGFADSKKLELIELHRCDPSLVAFAEKI  773

Query  645  QREQHEQGNDNMVV  604
            Q +  + G + + V
Sbjct  774  QEKHEDLGRNKLKV  787



>ref|XP_006350240.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=879

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 79/134 (59%), Gaps = 6/134 (4%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNF  817
            +KLS  C+ +E  +I   SKLP+LEVL L     +G  W+  ++    +L +L +   N 
Sbjct  739  LKLSRTCLPWEYMSI--ISKLPELEVLKLKYDALVGDEWKATDQIGLPKLRFLLLANLN-  795

Query  816  LERWEASAS---NFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
            LE+W  +A    +FP LE +++  C+ L++IP GFA+   L+ IEL+ C PS+V  A++I
Sbjct  796  LEKWRTTAGSHDHFPGLECVIITNCKFLKEIPQGFADSKKLELIELHKCDPSLVAFAEKI  855

Query  645  QREQHEQGNDNMVV  604
            Q +  + G + + V
Sbjct  856  QEKHEDLGRNKLKV  869



>emb|CDP17914.1| unnamed protein product [Coffea canephora]
Length=743

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 82/139 (59%), Gaps = 3/139 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  KLP LEVL L    ++G  W + E E F +L +LE++  
Sbjct  604   NLKKLTLSGNCQPRSEISTIGKLPNLEVLKLRSESFVGEEWVVKEGE-FPKLRFLELSRL  662

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W A++ NF  LE+LV+  C  LE++P   AE   L+ IE+ +C  SV +S K+IQ
Sbjct  663   S-IRNWTATSDNFCHLEKLVVCNCLKLEEVPACLAECLTLEMIEVKWCRESVANSVKQIQ  721

Query  642   REQHEQGNDNM-VVIEEHT  589
             +EQ + GN+ + ++I+ +T
Sbjct  722   QEQMDSGNEVLKIIIKNYT  740



>gb|AAL17826.1| GPA2-like NBS-LRR protein [Solanum nigrum]
Length=477

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = -1

Query  960  KTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFP  781
            K ++   KLPKL+VL LS   ++G  WE++E E F  L +L ++ S ++  W AS+ +FP
Sbjct  374  KNLSIVGKLPKLDVLKLSNTAFVGEKWEVVE-EGFPCLKFLLLD-SVYIRYWRASSDHFP  431

Query  780  KLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             LERL L  C  L+ IP  FA+I  L  I++  C  SV +SAK+IQ
Sbjct  432  CLERLFLKDCFALDSIPRDFADITTLALIDICKCRQSVGNSAKQIQ  477



>ref|XP_009624115.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=902

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 74/138 (54%), Gaps = 5/138 (4%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL  L+     F  K ++ F KLPKLE L L    ++   WE+ + E F +L +L +  
Sbjct  768   QNLKNLAFSGTFFRWKDLSIFGKLPKLESLKLGYDAFLDKEWEVFD-EVFPRLKFLLLED  826

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
                +  W AS  NFP LERL L  C  L+ IP  FA+I  L  I++  C  SV +SAK+I
Sbjct  827   LE-IRHWRASCDNFPFLERLFLKGCWYLDSIPQNFADITTLALIDIRRCAKSVENSAKQI  885

Query  645   QREQHEQGNDNMVVIEEH  592
             Q++  +   +  + IE H
Sbjct  886   QQDMQD---NYAISIEVH  900



>ref|XP_009799903.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=670

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 2/127 (2%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             ++L +L+  C  F    I+    LP LEVL L    + G  W +     F  L +L+I  
Sbjct  532   QSLKELALSCCGFSWDEISRIGSLPNLEVLNLLLSAFTGRKWTV-GVGGFVNLRFLKIEH  590

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             S+ ++ W  S  +FP LE+LVL WC+ LE+IP  F  +P+L+ IE + C PS   SA +I
Sbjct  591   SS-IKHWNMSVDSFPCLEQLVLRWCDKLEEIPSSFGCMPSLQRIEAHCCCPSATKSAVKI  649

Query  645   QREQHEQ  625
             +  Q + 
Sbjct  650   RNMQRDD  656



>ref|XP_009799885.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1B-16 [Nicotiana sylvestris]
Length=1826

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 72/118 (61%), Gaps = 3/118 (3%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++ ++LP L +L LS   + G  WE+ + + F +L YL+++    + +W  S   FPKL
Sbjct  1698  ISTIAELPNLVILKLSLRAFEGDHWEVKDSD-FPELKYLKLDNLK-VAQWSVSYDAFPKL  1755

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ-GNDNMVV  604
             E LVL  C+ LEKIP  F +  +LKSIE+ +C  SV +SA+EIQ  Q E   ND+  V
Sbjct  1756  EHLVLTKCKHLEKIPSHFDDAVSLKSIEVNWCNWSVANSAQEIQTTQREDMANDSFTV  1813



>gb|EYU21837.1| hypothetical protein MIMGU_mgv1a021514mg [Erythranthe guttata]
Length=745

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 73/122 (60%), Gaps = 5/122 (4%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL L +  ++G  WE +E + F  L +L I+  + LE W   +S+FP+LE L L 
Sbjct  611  LPNLQVLKLKEYSFVGTEWETVEGQ-FCNLKFLLIHMCSELEWWATDSSHFPRLEHLQLQ  669

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE----HT  589
            + + L++IP    EI  L+SI+L  C    V SAKEI +EQ + GN +  ++E+    HT
Sbjct  670  FLDKLKEIPSCIGEISTLQSIQLLRCSDEAVISAKEILKEQEDFGNVDFRLVEDSVKIHT  729

Query  588  LQ  583
            ++
Sbjct  730  VR  731



>emb|CDP11160.1| unnamed protein product [Coffea canephora]
Length=1430

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 2/120 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL +L+          I++   LP LEVL L    + G  WE+ E+E F +L +L+++  
Sbjct  1297  NLRELTLSNFHLPWSHISTIGGLPNLEVLKLRLGAFEGLIWEM-EEEQFKELKFLKLDDL  1355

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N   RW A+  + PKLERLVL  C+ LE+IP  FA+I  L+ IE+++C  S  +SAK I+
Sbjct  1356  NIC-RWNATCDHLPKLERLVLQNCKDLEEIPNDFADIGTLELIEVHWCRQSAEESAKGIR  1414



>ref|XP_010319246.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LE L L +C  +   W L   E   + + L + + + L+ WEA++ NFP L+RLVL 
Sbjct  762  LPNLEELKLKQCGDMLKTWRL-SDEDKFKSLKLLLLSGSSLKHWEATSDNFPNLKRLVLK  820

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
             C  L++IP  F EI  L+SIEL+ C  +  DSA+EI +EQ E GN
Sbjct  821  NCYRLQEIPADFGEIGTLESIELHNCSTTADDSAREIVQEQEEMGN  866



>gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Erythranthe guttata]
Length=895

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = -1

Query  942  SKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLV  763
              LP L+VL L    + G  WE +E + F  L +L I     L  W   +S+FP LE+L 
Sbjct  760  GSLPFLQVLKLESNAFCGDEWETIEGQ-FSNLKFLLIEGCGELRYWRTESSHFPCLEQLS  818

Query  762  LDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            L    +LE+IP    EIP L++I L YC  S V SAKEI  EQ E GN+++ V
Sbjct  819  LRDLYILEEIPWDIGEIPTLETIVLKYCSHSAVISAKEIVEEQLENGNEDLRV  871



>gb|EYU21831.1| hypothetical protein MIMGU_mgv1a0261622mg, partial [Erythranthe 
guttata]
Length=817

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL L K  ++G  WE +E + F  L YL I +   LE W   +++FP+LE L L+
Sbjct  713  LPNLQVLKLLKYSFVGTEWETVEGQ-FCNLRYLLIRSCRDLEWWTTDSNHFPRLEHLHLE  771

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
              + L++IP    EI  L+SI+L +C  S V SAK+I +EQ + GN
Sbjct  772  DLDKLKEIPSCIGEISTLQSIQLIWCSKSAVSSAKKILKEQEDFGN  817



>gb|EYU31247.1| hypothetical protein MIMGU_mgv1a017756mg [Erythranthe guttata]
Length=1064

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 73/131 (56%), Gaps = 2/131 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             +L KL+          ++   +LPKLE L L    + G  W+  + E F +L +L+++  
Sbjct  935   SLKKLTLHDFKLSRDEMSMIGRLPKLEALKLLYTVFDGKEWKTNDDE-FRELKFLKLDAL  993

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               + RW  S  +FP+L+RLV+  C  L+K P    +IP L+ ++++ C  SV +SA ++Q
Sbjct  994   K-IRRWNTSDDHFPRLQRLVMHKCWKLKKFPRSLGDIPTLQVVDIHSCSKSVANSALDVQ  1052

Query  642   REQHEQGNDNM  610
             REQ E G  ++
Sbjct  1053  REQLEYGKGSL  1063



>gb|EYU31598.1| hypothetical protein MIMGU_mgv1a018432mg [Erythranthe guttata]
Length=852

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 68/116 (59%), Gaps = 4/116 (3%)
 Frame = -1

Query  957  TINSFSK---LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASN  787
            ++N  +K   LP L+VL L    ++G  WE +E + F  L YL I+    LE W   +++
Sbjct  716  SLNDMTKIGLLPNLQVLKLKVNSFVGTDWETIEGQ-FCNLRYLLISLCRDLEWWTTDSNH  774

Query  786  FPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
            FP+LE L L +   L++IP    EI  L+SI+L +C  S V SAKEI +EQ + GN
Sbjct  775  FPRLEHLHLQFLRKLKEIPSCIGEISTLQSIQLIWCSKSAVKSAKEILKEQEDFGN  830



>ref|XP_006345285.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like, 
partial [Solanum tuberosum]
Length=873

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = -1

Query  963  VKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNF  784
            +K ++   KLPKLE L L    +IG  WE+ E E F +L +L +   +F   W AS+ +F
Sbjct  742  LKDLSIVGKLPKLESLKLEYDAFIGDEWEVAE-EGFPRLKFLLLRCLHF-RHWRASSDHF  799

Query  783  PKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
            P LERL++D C  L  IP  FA I  L  I++  C  +V +SAK+IQ++
Sbjct  800  PCLERLIIDACWKLHSIPQDFANITTLALIDIKICAQAVGNSAKQIQQD  848



>ref|XP_006367913.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
isoform X2 [Solanum tuberosum]
Length=232

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 79/136 (58%), Gaps = 3/136 (2%)
 Frame = -1

Query  1005  KNLMKLS-XRCVSFEVKTINS-FSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEI  832
             ++L +LS  RC  F  + I+S F  LP LE L L  C      W+L +K+ F  L  L +
Sbjct  76    ESLRRLSLTRCSKFIWEEISSTFIMLPHLEELKLKHCLADDDVWKLSDKDIFKSLKLLLL  135

Query  831   NTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAK  652
             +  N L+ WEA + NFP L+RLVL  C+ L++IP  F EI  L+ IEL+ C  +   S +
Sbjct  136   SDVN-LKCWEARSDNFPNLKRLVLKKCKHLQEIPTDFGEICTLELIELHDCTTTAEASVR  194

Query  651   EIQREQHEQGNDNMVV  604
             +I++EQ +  N+ + V
Sbjct  195   KIKQEQDDLDNNILKV  210



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP LEVL L K    G  WE +E E F QL +L +   + ++ W A+ ++FP L+RLV+ 
Sbjct  612  LPNLEVLKLRKNACQGVEWEPVE-EQFCQLKHLLLEEVDLVQ-WVANETHFPCLQRLVIR  669

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
             C  L++IP G  EIP L+ IEL  C  S V SA++IQ EQ   GN+ + V
Sbjct  670  SCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQEGLGNEELKV  720



>emb|CDP11642.1| unnamed protein product [Coffea canephora]
Length=1450

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++   L  LE+L L    +    WE+ E E F +L YL++++ N +  W AS  + P L
Sbjct  1332  ISTIGSLENLEILKLLSSTFEDTRWEMKEGE-FHKLKYLKLDSPNIVN-WVASCDDLPNL  1389

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
             ++LVL  CE L+++P+ F  IP L+ IE+  C  SV ++ + +Q+EQ E G +++ V+  
Sbjct  1390  QQLVLQKCENLKEVPIDFVRIPTLQLIEVQRCGDSVEEAIRRLQQEQFEYGIEDLKVLIN  1449

Query  594   H  592
             H
Sbjct  1450  H  1450



>ref|XP_009618258.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618266.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618270.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana tomentosiformis]
Length=1741

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  +LP LE+L L    + G  WE+ + E F +L YLE++  N + +W  S   FPKL
Sbjct  1609  ISTIGELPNLEILKLHLRAFEGNHWEVKDSE-FPELKYLELDDIN-IAQWSVSDDAFPKL  1666

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ  625
             + LVL  C+ LEKIP  F +  +L+SIE+ +C   V +SA+EIQ  QHE+
Sbjct  1667  KCLVLIKCKRLEKIPSHFDDSVSLRSIEVNWCNWFVANSAQEIQTTQHEE  1716



>gb|EYU33966.1| hypothetical protein MIMGU_mgv1a001110mg [Erythranthe guttata]
Length=887

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 69/126 (55%), Gaps = 2/126 (2%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNF  817
            + L   C+S+E  ++     LP L+VL L    + G  WE +E + F  L +L I     
Sbjct  739  LSLDRTCLSWEDMSV-KIGSLPLLQVLKLYTDAFKGDEWETVEGQ-FCNLKFLLIEGCGE  796

Query  816  LERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
            L  W   +S+FP LE+L L   + LE+IP G  EIP L++I L YC  S V SAKEI  E
Sbjct  797  LRCWRTESSHFPCLEQLFLRDLDELEEIPWGIGEIPTLETIVLKYCSDSAVFSAKEILDE  856

Query  636  QHEQGN  619
            Q E GN
Sbjct  857  QEEYGN  862



>ref|XP_006367243.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=1322

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 71/136 (52%), Gaps = 7/136 (5%)
 Frame = -1

Query  1014  VSCKNL--MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIY  841
             +S  NL  + LS  C+ +EV  +N  + LP LE L      + G  W++ E   F +L Y
Sbjct  1181  ISLPNLKELNLSNTCIPWEV--VNLLANLPNLEKLY-GHAAFDGTDWKVDEDVVFHKLKY  1237

Query  840   LEINTSNFLERWE--ASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSV  667
             L + T   LERWE  A + NFP LE L+L     LE+IP    E+  LK I +  C   V
Sbjct  1238  LRLYTCRDLERWELAAGSDNFPMLENLILFELPKLEEIPESIGEVMTLKFIRIVNCGSGV  1297

Query  666   VDSAKEIQREQHEQGN  619
               SAK+IQ EQ   GN
Sbjct  1298  KTSAKKIQEEQESLGN  1313


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 53/99 (54%), Gaps = 7/99 (7%)
 Frame = -1

Query  1014  VSCKNL--MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIY  841
             +S  NL  + LS  C+ +EV  +N  + LP LE L      + G  W++ E   F +L Y
Sbjct  708   ISLPNLKELNLSNTCIPWEV--VNLLANLPNLEKLY-GHAAFDGTDWKVDEDVVFHKLKY  764

Query  840   LEINTSNFLERWE--ASASNFPKLERLVLDWCEVLEKIP  730
             L + T   LERWE  A + NFP LE L+L     LE+IP
Sbjct  765   LRLYTCRDLERWELAAGSDNFPMLENLILFELPKLEEIP  803



>ref|XP_009798711.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=663

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 68/128 (53%), Gaps = 2/128 (2%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             + L KL+     F     N   +L  LEVL L +  +IG +W+  E   F QL  L I  
Sbjct  449   RTLRKLTLANTRFSWSEANKLGQLESLEVLKLKEDAFIGDSWQP-EIRGFSQLQVLWIEK  507

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             +  LE WEAS  NFP L  LVL  C+ L+ +P+G A+IPNL+ + L       V SAK++
Sbjct  508   ATKLETWEASNLNFPVLRHLVLISCDKLKAVPLGLADIPNLQEMRLENT-SKAVKSAKDV  566

Query  645   QREQHEQG  622
             Q  +  +G
Sbjct  567   QESKISKG  574



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 3/135 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG-AWELLEKESFDQLIYLEINT  826
             NL KL+  C     K +   S LPKL+VL L    ++    WE+ E + F +L +L +  
Sbjct  788   NLKKLTLCCTFLLWKDMTIVSMLPKLKVLQLRNNAFVPNIVWEVTEMQ-FPKLKFLLLEQ  846

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              N +  W A+   FP LER+++  C  L++IP  FA+   L+ IEL+ C PS+V+SA+ I
Sbjct  847   LN-IRYWRATDDCFPCLERIIIRNCRFLKEIPQEFADSMTLQLIELHQCSPSLVNSAELI  905

Query  645   QREQHEQGNDNMVVI  601
             Q+EQ E   +NM+ +
Sbjct  906   QKEQLESLGNNMLKV  920



>gb|AJW77760.1| Pvr9 [Capsicum annuum]
Length=1304

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -1

Query  957   TINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPK  778
             ++++ +KLP LE L L +    G  W + E+++F+ L YL + T   L +WE    +FP 
Sbjct  1179  SLSTIAKLPNLEELFLRRTIIHGEEWNMREEDTFENLKYLNL-TEVTLAKWEVGEESFPV  1237

Query  777   LERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             +E+LVL  C +L++IP  F +I +LK I+L    P V DSAK+I++   + G D + V+
Sbjct  1238  IEKLVLRKCHMLKEIPPSFGDICSLKIIKLVES-PHVEDSAKKIKQYVEDMGGDELQVL  1295



>gb|EYU17765.1| hypothetical protein MIMGU_mgv1a022339mg [Erythranthe guttata]
Length=839

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 4/137 (3%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELL---EKESFDQLIYLE  835
             KN+ K++     F  + + + + LP L VL L    + G  WE     E+  F +L  L 
Sbjct  690   KNIKKITLSGCGFPWENVKAIADLPNLLVLKLRWSAFCGAKWETTTCGEEIGFPKLKLLL  749

Query  834   INTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSA  655
             +   + +++WEA   +FP LERL++  C  LEKIP    +IP L+ I++  C P+VV SA
Sbjct  750   MEDLD-IQKWEAGNEHFPMLERLIIRHCYKLEKIPPEIGDIPLLEMIQVDDCNPAVVTSA  808

Query  654   KEIQREQHEQGNDNMVV  604
             + IQ ++   GND   +
Sbjct  809   RGIQDKKASWGNDKFRI  825



>ref|XP_009603189.1| PREDICTED: uncharacterized protein LOC104098223 [Nicotiana tomentosiformis]
Length=329

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 69/131 (53%), Gaps = 2/131 (2%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNF  817
            M L+        K I+   KLP LEVL L    + G  W L E   F +L  L I  +N 
Sbjct  1    MHLTLEATHLLWKDISFLGKLPNLEVLKLKYFAFQGSNWNLNEG-GFKKLKLLHIFMTNL  59

Query  816  LERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
            + RW+A++++ P LE LVL  C  LE+I +   +IP L+ IEL++C  S     +EI  E
Sbjct  60   V-RWKATSNSLPSLECLVLRHCYKLEEIAIEIGDIPTLELIELHHCSHSAATCVEEILEE  118

Query  636  QHEQGNDNMVV  604
            Q   GN+ +V 
Sbjct  119  QKGLGNEILVA  129



>ref|XP_009759015.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=921

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 72/126 (57%), Gaps = 2/126 (2%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+          ++   KLPKLEVL L+    IG AWE+++ E F  L  L +  
Sbjct  775   QNLKKLAFSRTFLRWNDLSIVGKLPKLEVLKLTYRACIGEAWEVVD-EGFPSLKLLLLED  833

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              +F E W AS  +FP LERL L+ C  L+ IP  FA+I  L  I++  C  SV +SAK+I
Sbjct  834   LDF-EYWRASCDHFPCLERLFLERCRFLDSIPQDFADIITLSLIDIRRCKESVGNSAKQI  892

Query  645   QREQHE  628
             Q++  +
Sbjct  893   QQDMQD  898



>emb|CDP08020.1| unnamed protein product [Coffea canephora]
Length=1459

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 71/125 (57%), Gaps = 3/125 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++  +LP LEVL L    ++G  W++ EK  F  L +L +++ 
Sbjct  1326  NLKKLTLSDFRLPWSHISTIGRLPNLEVLKLLSGAFVGKLWKVEEK--FQNLKFLSLDSL  1383

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N + +W AS  +FPKLERL+L  C+ LE+IP  FA I  L+ IE+++C      SA +I 
Sbjct  1384  N-IAQWNASCDDFPKLERLILQNCKDLEEIPAEFANIYTLEMIEVHWCSELAEKSAIKIG  1442

Query  642   REQHE  628
              E  E
Sbjct  1443  EETEE  1447



>emb|CDP05538.1| unnamed protein product [Coffea canephora]
Length=1220

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 3/134 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
              L KL+    S     I+   +LP LE+L L +  + G  W++ E   F +L +LE+   
Sbjct  1087  TLRKLTLGRFSVPWSAISVIGQLPNLEILKLRRNSFSGPRWDV-EDGEFQKLKFLELWQL  1145

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N ++ W  S+  FP+LE+L +  C  L++IP    +IP L+ +E+++C      SAK I 
Sbjct  1146  N-IQEWNVSSEPFPRLEQLTIRDCYSLQEIPSSIGDIPTLEKLEVHWCF-DAASSAKHIL  1203

Query  642   REQHEQGNDNMVVI  601
              EQ + GND + VI
Sbjct  1204  EEQRDMGNDLLEVI  1217



>emb|CDP07957.1| unnamed protein product [Coffea canephora]
Length=1275

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 2/131 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL           +++  KLP LEVL L    + G  W++ E+E F +L +L++ + 
Sbjct  1131  NLKKLKLSKFRLPWSAVSAIGKLPNLEVLKLLHASFEGKTWDMKEEE-FLKLKFLKLESL  1189

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + +  W AS  + P LE LV+  C  L +IP+   +IP L+ IEL  C  S   SA+ ++
Sbjct  1190  D-IAHWNASEDHLPCLETLVVKKCHALTEIPLCLGDIPTLQRIELQNCTRSAWISARTVK  1248

Query  642   REQHEQGNDNM  610
              +Q E GND  
Sbjct  1249  EKQKEMGNDQF  1259



>emb|CDP00696.1| unnamed protein product [Coffea canephora]
Length=116

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 2/100 (2%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP+LEVL L    + G  WE   K  F +L +L I  ++ +  WEA+  +FP+L+ LVL 
Sbjct  2    LPRLEVLKLKYFAFHGPKWEPKTK-GFCRLTHLLIENTDLVH-WEATVHHFPRLQYLVLK  59

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQRE  637
             C++LE+IPV   EI  L+ IEL++C  +    A+EIQ +
Sbjct  60   SCKLLEEIPVDVKEIGTLQRIELHHCNKTTEILAREIQEQ  99



>ref|XP_006367912.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
isoform X1 [Solanum tuberosum]
Length=269

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 79/136 (58%), Gaps = 3/136 (2%)
 Frame = -1

Query  1005  KNLMKLS-XRCVSFEVKTINS-FSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEI  832
             ++L +LS  RC  F  + I+S F  LP LE L L  C      W+L +K+ F  L  L +
Sbjct  113   ESLRRLSLTRCSKFIWEEISSTFIMLPHLEELKLKHCLADDDVWKLSDKDIFKSLKLLLL  172

Query  831   NTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAK  652
             +  N L+ WEA + NFP L+RLVL  C+ L++IP  F EI  L+ IEL+ C  +   S +
Sbjct  173   SDVN-LKCWEARSDNFPNLKRLVLKKCKHLQEIPTDFGEICTLELIELHDCTTTAEASVR  231

Query  651   EIQREQHEQGNDNMVV  604
             +I++EQ +  N+ + V
Sbjct  232   KIKQEQDDLDNNILKV  247



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 3/135 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG-AWELLEKESFDQLIYLEINT  826
             NL KL+  C     K +   S LPKLEVL L    ++    W++ E + F +L +L +  
Sbjct  790   NLKKLTLCCTFLLWKDMTIVSMLPKLEVLQLRNNAFVPNIGWKVTEMQ-FPKLKFLLLEQ  848

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              N ++ W A+   FP LER+++  C  L +IP  FA+   L+ IEL+ C PS+V+SA+ I
Sbjct  849   LN-IKYWRATDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELI  907

Query  645   QREQHEQGNDNMVVI  601
             Q+EQ E   +NM+ +
Sbjct  908   QKEQLESLGNNMLKV  922



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINS-FSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +L KL+      + + +N+    LP L+VL L +  ++G  WE +E + F  L +L I+ 
Sbjct  650   SLKKLTLMGTKLKWEDMNTKIGLLPNLQVLKLKEYSFVGTEWETVEGQ-FCNLKFLLIHM  708

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              + LE W   +S+FP+LE L L + + L++IP    EI  L+SI+L  C    V SAKEI
Sbjct  709   CSELEWWTTDSSHFPRLEHLQLQFLDKLKEIPSCIGEISTLQSIQLLRCSNEAVISAKEI  768

Query  645   QREQHEQGNDNMVVIE  598
              +EQ + GN +  ++E
Sbjct  769   LKEQEDFGNVDFRLVE  784



>ref|XP_009624582.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=843

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 3/135 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG-AWELLEKESFDQLIYLEINT  826
             NL KL+  C     K +   S LPKLEVL L    ++    W++ E + F +L +L +  
Sbjct  698   NLKKLTLCCTFLLWKDMTIVSMLPKLEVLQLRNNAFVPNIGWKVTEMQ-FPKLKFLLLEQ  756

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              N ++ W A+   FP LER+++  C  L +IP  FA+   L+ IEL+ C PS+V+SA+ I
Sbjct  757   LN-IKYWRATDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELI  815

Query  645   QREQHEQGNDNMVVI  601
             Q+EQ E   +NM+ +
Sbjct  816   QKEQLESLGNNMLKV  830



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            ++  ++LP LEVL L      G  W  +    F++L  L I  S FL+ W+A+  NFP L
Sbjct  775  LDIIAELPNLEVLKLMDDACCGEEWHPIVM-GFNRLKLLLIKYS-FLKFWKATNDNFPVL  832

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGND  616
            ERL++  C+ L++IP+ FA+I  L+ IEL  C P + +SA  IQ+EQ + GN+
Sbjct  833  ERLMIRSCKNLKEIPIEFADIHTLQLIELRECPPKLGESAARIQKEQEDLGNN  885



>ref|XP_009611920.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1665

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = -1

Query  957   TINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPK  778
              I++  +LP LE+L L   D+ G  WE+ + E F +L YL ++  N + +W      FP 
Sbjct  1543  AISTIGELPNLEILNLLFRDFEGNQWEVKDSE-FPKLKYLNLDNIN-ISQWSVYDDAFPM  1600

Query  777   LERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             +E LVL  CE LE+IP  F +  +LKSIE+  C  SV  SA EI+   H+   +N + +
Sbjct  1601  IEHLVLTKCERLEEIPSHFGDAISLKSIEVNRCCWSVAKSAVEIRTTHHDTMGNNALTV  1659



>ref|XP_011072558.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=742

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 71/135 (53%), Gaps = 2/135 (1%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINS-FSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +L KL+     F+ K IN+    LP L+ L L      GG W  +E + F  L +L++  
Sbjct  583   SLKKLTLWGGGFQWKQINAKIGSLPLLQGLKLYNDSVKGGIWNTVEGQ-FCSLRFLQMTC  641

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
                L RW   +S+FP L  L L     L+KIP  FAEI  L+ IELY C  S V SAK+I
Sbjct  642   IYKLNRWRVDSSHFPCLNILRLVELRKLQKIPSSFAEIQTLELIELYMCRDSAVLSAKDI  701

Query  645   QREQHEQGNDNMVVI  601
               +Q E GN +  V+
Sbjct  702   AEQQEEFGNHDFRVV  716



>ref|XP_009611917.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611918.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611919.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=1727

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = -1

Query  957   TINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPK  778
              I++  +LP LE+L L   D+ G  WE+ + E F +L YL ++  N + +W      FP 
Sbjct  1605  AISTIGELPNLEILNLLFRDFEGNQWEVKDSE-FPKLKYLNLDNIN-ISQWSVYDDAFPM  1662

Query  777   LERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             +E LVL  CE LE+IP  F +  +LKSIE+  C  SV  SA EI+   H+   +N + +
Sbjct  1663  IEHLVLTKCERLEEIPSHFGDAISLKSIEVNRCCWSVAKSAVEIRTTHHDTMGNNALTV  1721



>emb|CDP13440.1| unnamed protein product [Coffea canephora]
Length=735

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 71/122 (58%), Gaps = 2/122 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL KL+          I++   L +LEVL L    + G  WE+ E E F +L +L++++ 
Sbjct  606   NLKKLTLSNFRLPWDRISAIGGLEQLEVLNLVSRAFEGSEWEMNEGE-FLKLKFLKLDSL  664

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             N + RW ASA   P LE L L  C+ LE++P  FA+IPNL+ IE+ +C  S  +S ++I+
Sbjct  665   N-IARWTASAEPLPNLEHLALRNCKDLEEVPFEFADIPNLQKIEVQFCGQSTEESVRKIE  723

Query  642   RE  637
              E
Sbjct  724   EE  725



>ref|XP_009624584.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana tomentosiformis]
Length=723

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 3/135 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGG-AWELLEKESFDQLIYLEINT  826
             NL KL+  C     K +   S LPKLEVL L    ++    W++ E + F +L +L +  
Sbjct  578   NLKKLTLCCTFLLWKDMTIVSMLPKLEVLQLRNNAFVPNIGWKVTEMQ-FPKLKFLLLEQ  636

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
              N ++ W A+   FP LER+++  C  L +IP  FA+   L+ IEL+ C PS+V+SA+ I
Sbjct  637   LN-IKYWRATDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELI  695

Query  645   QREQHEQGNDNMVVI  601
             Q+EQ E   +NM+ +
Sbjct  696   QKEQLESLGNNMLKV  710



>ref|XP_009772626.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772627.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772628.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=791

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 78/135 (58%), Gaps = 3/135 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWEL-LEKESFDQLIYLEINT  826
             NL KL  R +    + +++ +KL KLE L + +   +G    L +    F  L +  I  
Sbjct  651   NLRKLCIRNIFLTEEIVSNIAKLQKLESLEVYRGYLVGNGQCLDVRYVEFPALKFFTIFV  710

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
               F+E W+AS  +FP LE+LV+  CE L++IP+ FA+IP L+ IE+  C+ SV DSA +I
Sbjct  711   L-FMEEWKASEESFPMLEKLVVLNCEDLDEIPLSFADIPTLQLIEVINCMESVEDSAMDI  769

Query  645   QREQHEQ-GNDNMVV  604
             +RE  E  G D + V
Sbjct  770   KREIEENTGCDTLQV  784



>emb|CDP08428.1| unnamed protein product [Coffea canephora]
Length=1275

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 2/120 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  KLP LEVL L    ++G  WE+ E E F  L +L+++  N +  W AS+ NF  L
Sbjct  1158  ISAIGKLPNLEVLKLRYNSFVGEKWEMEEGE-FRNLRFLKLSYLN-IRWWTASSDNFCCL  1215

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
             E+LVL  C  LE++P    E   L  IE+ +C  S V+  K+I +EQ + GN+ + ++ E
Sbjct  1216  EKLVLHACHWLEEVPSCLGETLTLDMIEIKWCHESAVNYVKQIVQEQMDMGNNGLKIVIE  1275



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 72/133 (54%), Gaps = 2/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             NL +L     + + + +   + LP LEVL  +   + G  W L E   F +L YL +   
Sbjct  705   NLKQLKLSYTTLQWEDMVVLANLPNLEVLK-AYSAFEGTYWRLNEDVVFQKLKYLRLQYG  763

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
             + LERWEA+  NFP LE+L+L     LE+IP    EI  LK I++  C  + V SAK+IQ
Sbjct  764   S-LERWEATNDNFPMLEQLLLYGFRKLEEIPQSIGEIMILKLIQIERCSAAAVTSAKKIQ  822

Query  642   REQHEQGNDNMVV  604
             +EQ   GN  + V
Sbjct  823   QEQESWGNYGLQV  835



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             ++L KL+    +   K ++    LP LEVL L +  + G  W+ +E+E F +L +L I  
Sbjct  745   QSLKKLTLDGSNLSWKGMSIIGSLPHLEVLKLKQYAFTGAVWKPVERE-FSRLKFLLIEK  803

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
                L RW A  ++FP LE L++  C  L+ IP G  +IP LK I++  C  S V S ++I
Sbjct  804   MR-LVRWIAENTHFPCLEHLIISACHDLQAIPSGIGDIPTLKMIDIDDCSSSAVTSVEQI  862

Query  645   QREQHEQGNDNMVV  604
               EQ +  N+ + V
Sbjct  863   LEEQRDMENNVLQV  876



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 13/130 (10%)
 Frame = -1

Query  996  MKLSXRCVSFEVKTINSFSKLPKLEVL----VLSKCDWIGGAWELLEKESFDQLIYLEIN  829
            ++L+  C+ +E   +N  S+LP LEVL    V+   +W   A        F QL  L I+
Sbjct  792  LELNGTCLRWE--DMNIISELPNLEVLKVLSVIHDNEWYPVAG------GFTQLKLLLID  843

Query  828  TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
            +++ L  W+A+  NFP LE LVL  C  L ++P+ FA I +L+ IELY C+P +  SA +
Sbjct  844  STS-LNYWKATDDNFPALECLVLRSCYFLAEMPIEFAYINSLQLIELYNCMPKLEASAAQ  902

Query  648  IQREQHEQGN  619
            IQ+EQ + GN
Sbjct  903  IQQEQEDIGN  912



>emb|CDP19488.1| unnamed protein product [Coffea canephora]
Length=1135

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  KLPKLEVL L +  +       +++  F  L  L++        W AS+ NFP+L
Sbjct  995   ISTIGKLPKLEVLKLLE-GFCAEEEWEMKEGEFPSLRVLKLRGLWDFRSWTASSDNFPRL  1053

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
             ++LV+ WC  LE++P    E P L+ IE+  C  SV +S K+IQ+EQ + GN+ + +
Sbjct  1054  QKLVVHWCRELEEVPPCLGECPTLEMIEVRECRESVANSVKQIQQEQIDMGNEALKI  1110



>ref|XP_010312513.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312514.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312515.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312516.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=881

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 3/129 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
             N+ KL         + +N  + LP LEV +  +  + G  W+L E   F +L YL I  +
Sbjct  735   NIKKLKLLGTYIPWEVVNLLAYLPNLEV-IEGEYAFSGTDWKLDEDVVFSKLKYLLIGEA  793

Query  822   NFLERWEASAS-NFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             + LERWEA+AS NFP LE+L+L     L++IP    +I  LK I++  C  SV +SAK I
Sbjct  794   D-LERWEAAASDNFPMLEKLILYGFNKLDEIPESIGDIMTLKLIKIDDCSSSVENSAKRI  852

Query  645   QREQHEQGN  619
             Q+EQ   GN
Sbjct  853   QQEQQSLGN  861



>ref|XP_011071971.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 73/136 (54%), Gaps = 2/136 (1%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             K L KL+        + +    +LP LEVL L +  + G  W+L E+  F +L +L +  
Sbjct  735   KTLTKLTLSGCGLHWEDMAIIEELPNLEVLKLREFAFQGPKWDL-EEMFFPELKFLLLEA  793

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
                L+ W AS  NFP LERL++  C  LEKIP   AEI  L+ I+L  C P+ V SA+EI
Sbjct  794   LQ-LQIWTASDDNFPSLERLIIRHCYELEKIPPEIAEIGPLRLIQLVDCSPTAVASAQEI  852

Query  645   QREQHEQGNDNMVVIE  598
             ++++     D  V I 
Sbjct  853   KKDKQRTKKDLEVRIH  868



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = -1

Query  999  LMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN  820
            L KL         + +N   +LP LE+L L +    G  W   EK  F QL  L I   N
Sbjct  773  LKKLKLYGTDLRWEDLNIIGELPNLEILKLKRYACRGEEWHPTEK-GFTQLKLLLIEY-N  830

Query  819  FLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
             L+ W +   NFP LERLV+  C  LE IP+ FA I +L+ IEL  C P +  SA  IQ 
Sbjct  831  DLKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQH  890

Query  639  EQHEQ  625
            EQ E 
Sbjct  891  EQEEN  895



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = -1

Query  999  LMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN  820
            L KL         + +N   +LP LE+L L +    G  W   EK  F QL  L I   N
Sbjct  773  LKKLKLYGTDLRWEDLNIIGELPNLEILKLKRYACRGEEWHPTEK-GFTQLKLLLIEY-N  830

Query  819  FLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
             L+ W +   NFP LERLV+  C  LE IP+ FA I +L+ IEL  C P +  SA  IQ 
Sbjct  831  DLKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQH  890

Query  639  EQHEQ  625
            EQ E 
Sbjct  891  EQEEN  895



>emb|CDP12547.1| unnamed protein product [Coffea canephora]
Length=1233

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 65/118 (55%), Gaps = 2/118 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  +LP L VL     D+    + + E E F  L +L I  S F ERW   A  FP L
Sbjct  1116  ISAIGQLPNLVVLKFRLIDFAKHTFYMKEGE-FSSLKFLRIYNSEF-ERWAVPAEPFPSL  1173

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             E LVL  C  L++IP  FAEI  L+ I++  C P+V  SA+ I  EQ + GN ++ +I
Sbjct  1174  ENLVLIDCTKLQEIPSSFAEISTLRMIKVRGCSPNVEKSAQTIFEEQKDMGNGDLQLI  1231



>gb|AAT39932.2| NB-ARC domain containing protein [Solanum demissum]
 gb|AAT39950.2| NB-ARC domain containing protein [Solanum demissum]
Length=884

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = -1

Query  981  RCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWE  802
            R +SF    +NSF KL K  VL L    + G  W + + E F +L YL++++ NF + W 
Sbjct  753  RDISF---ILNSF-KLVK--VLKLLNKAFEGVQWNVNDTE-FPELKYLKLDSFNFAQ-WS  804

Query  801  ASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ-  625
             S  +FP LERLVL  C+ LEKIP  F ++ +LKSIE+ +C  SV +SA+EIQ  Q E  
Sbjct  805  ISEDSFPSLERLVLTNCKRLEKIPSHFEDVVSLKSIEVNWCSWSVANSAEEIQTTQREDM  864

Query  624  GNDNMVVI  601
             ND   V 
Sbjct  865  ANDAFTVT  872



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = -1

Query  999  LMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN  820
            L KL         + +N   +LP LE+L L +    G  W   EK  F QL  L I   N
Sbjct  773  LKKLKLYGTDLRWEDLNIIGELPNLEILKLKRYACRGEEWHPTEK-GFTQLKLLLIEY-N  830

Query  819  FLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQR  640
             L+ W +   NFP LERLV+  C  LE IP+ FA I +L+ IEL  C P +  SA  IQ 
Sbjct  831  DLKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQH  890

Query  639  EQHEQ  625
            EQ E 
Sbjct  891  EQEEN  895



>emb|CDP17943.1| unnamed protein product [Coffea canephora]
Length=1143

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 3/122 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGA-WELLEKESFDQLIYLEINTSNFLERWEASASNFPK  778
             I++  KLP L+VL L    ++G   WE+ E E F  L  L++     L  W AS+ +F  
Sbjct  1020  ISTIGKLPNLQVLKLRNGSFVGSEEWEMKEGE-FPNLRVLKL-IGVALRSWTASSDSFLL  1077

Query  777   LERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIE  598
             LE+LV+  C  L+++P    E P L+ IE+ +C  SVV S K+IQ+EQ + GND + +I 
Sbjct  1078  LEKLVVHNCPRLKEVPSCLGECPTLEMIEVKWCDESVVRSVKQIQQEQMDMGNDVLEIII  1137

Query  597   EH  592
             E+
Sbjct  1138  EY  1139



>ref|XP_009796668.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009796669.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
Length=898

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = -1

Query  1008  CKNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
              + L KL+     F+ +      +L  LEVL L K  + G +W+L  +  F +L  L I+
Sbjct  742   ARTLKKLTLSDTRFDWREAIGLEQLECLEVLKL-KDAFTGKSWKL--EVGFSELQALSID  798

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
             T++F E WEAS  +FP+L  LVL +C+ LE +P  FA+IP+L+ + L       V SAKE
Sbjct  799   TTDF-ETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENT-SKAVRSAKE  856

Query  648   IQREQHE  628
             I+R++ E
Sbjct  857   IERKKQE  863



>ref|XP_009796670.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X4 [Nicotiana sylvestris]
Length=887

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = -1

Query  1008  CKNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
              + L KL+     F+ +      +L  LEVL L K  + G +W+L  +  F +L  L I+
Sbjct  742   ARTLKKLTLSDTRFDWREAIGLEQLECLEVLKL-KDAFTGKSWKL--EVGFSELQALSID  798

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
             T++F E WEAS  +FP+L  LVL +C+ LE +P  FA+IP+L+ + L       V SAKE
Sbjct  799   TTDF-ETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENT-SKAVRSAKE  856

Query  648   IQREQHE  628
             I+R++ E
Sbjct  857   IERKKQE  863



>ref|XP_011072559.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=318

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = -1

Query  951  NSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLE  772
             S   LP L+VL L +    G  WE +E   F  L  L I+    LE W++ +S+FP L 
Sbjct  175  TSIGLLPHLQVLRLLRESVTGHEWETVEGH-FCHLTSLIIDDIKDLEYWKSESSHFPCLN  233

Query  771  RLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            +L+L     L +IP+ F  I  L+ I LY C  S V SAKEI  +Q E GN++++V
Sbjct  234  QLLLRHLRTLNEIPLSFGGIQTLELIALYDCSDSAVISAKEIAEQQEELGNEDLLV  289



>ref|XP_009796665.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009796666.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=906

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = -1

Query  1008  CKNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
              + L KL+     F+ +      +L  LEVL L K  + G +W+L  +  F +L  L I+
Sbjct  742   ARTLKKLTLSDTRFDWREAIGLEQLECLEVLKL-KDAFTGKSWKL--EVGFSELQALSID  798

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
             T++F E WEAS  +FP+L  LVL +C+ LE +P  FA+IP+L+ + L       V SAKE
Sbjct  799   TTDF-ETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENT-SKAVRSAKE  856

Query  648   IQREQHE  628
             I+R++ E
Sbjct  857   IERKKQE  863



>emb|CDP05514.1| unnamed protein product [Coffea canephora]
Length=875

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 2/126 (2%)
 Frame = -1

Query  972  SFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASA  793
            S + K +++  +LP LEVL +    + G  WE    E F  L +L+++ +N L+RW AS+
Sbjct  746  SLDWKEMSTIGRLPNLEVLKVKNNFFNGQQWET-SDEGFHHLKFLKLSHTN-LQRWIASS  803

Query  792  SNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDN  613
            S+FP L  LVL  C VLE+IP    +I  L+ IE+ +   +  DS  +IQ  Q   GN  
Sbjct  804  SSFPCLGHLVLHRCLVLEEIPPSIGDIQTLQMIEVSHSSLAAADSVWQIQESQKSMGNFE  863

Query  612  MVVIEE  595
            + V  +
Sbjct  864  LKVFTQ  869



>gb|AAT39951.2| Disease resistance protein, putative [Solanum demissum]
Length=2544

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 69/118 (58%), Gaps = 3/118 (3%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I+    L  LEVL L    + G  W + + E F +L YL++++ NF  +W  S  +FP L
Sbjct  2416  ISIVGTLCNLEVLKLLNKAFEGIQWNVNDTE-FPELRYLKLDSLNF-AQWSISEDSFPSL  2473

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQ-GNDNMVV  604
             ERLVL  C+ LEKIP  F ++ +LKSIE+ +C  SV +SA EIQ  Q E   ND   V
Sbjct  2474  ERLVLTNCKRLEKIPSHFEDVVSLKSIEVNWCSWSVANSAGEIQTTQREDMANDAFTV  2531



>emb|CDP04755.1| unnamed protein product [Coffea canephora]
Length=679

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = -1

Query  954  INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
            I++  KLP LEVL L    ++G  WE+ E E F  L  L++   +F   W AS+ +F +L
Sbjct  554  ISTIGKLPNLEVLKLLHDSFVGEEWEMKE-EGFLALRVLKLIDLHF-RSWTASSESFRRL  611

Query  774  ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVIEE  595
            E+LV+  C+ LE++P    E   L+ IE+  C  SVV S K+IQ+EQ + G  ++ +I E
Sbjct  612  EKLVVHECQKLEEVPSYLGECATLEMIEVKGCGESVVSSVKQIQQEQMDMGIADLKIIIE  671

Query  594  H  592
            +
Sbjct  672  N  672



>emb|CDP17263.1| unnamed protein product [Coffea canephora]
Length=1255

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = -1

Query  954   INSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKL  775
             I++  KL  L VL L +  ++G  WE+ E E F  L +L+++  N +  W AS+ NF  L
Sbjct  1134  ISAIGKLHNLVVLKLCRVSFLGKKWEMEEGE-FSNLRFLKLSGLN-IRCWTASSDNFSCL  1191

Query  774   ERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVVI  601
             E+LVL  C  LE++P    E   L  IE+  C  S V+S K+IQ+EQ + GN  + +I
Sbjct  1192  EKLVLHQCYDLEEVPSCLGETLTLGMIEVKLCHESTVNSVKQIQQEQIDLGNKGLKII  1249



>gb|EYU21842.1| hypothetical protein MIMGU_mgv1a020462mg, partial [Erythranthe 
guttata]
Length=846

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 62/107 (58%), Gaps = 2/107 (2%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSN-FLERWEASASNFPKLERLVL  760
            LP L+VL L    +IG  WE +E + F  L +L I  S+  LE W   +S+FP+LERLVL
Sbjct  712  LPNLQVLKLKAKSFIGPEWETVEGQ-FCNLRFLGIYDSHCGLEWWTTDSSHFPRLERLVL  770

Query  759  DWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
             + +   +IP    EIP L+SI+L  C  S V SAK I  +Q E  N
Sbjct  771  HFLDNFVEIPSAIGEIPTLQSIQLNNCTDSAVISAKRILEDQEELQN  817



>ref|XP_009796664.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=916

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = -1

Query  1008  CKNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEIN  829
              + L KL+     F+ +      +L  LEVL L K  + G +W+L  +  F +L  L I+
Sbjct  742   ARTLKKLTLSDTRFDWREAIGLEQLECLEVLKL-KDAFTGKSWKL--EVGFSELQALSID  798

Query  828   TSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKE  649
             T++F E WEAS  +FP+L  LVL +C+ LE +P  FA+IP+L+ + L       V SAKE
Sbjct  799   TTDF-ETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENT-SKAVRSAKE  856

Query  648   IQREQHE  628
             I+R++ E
Sbjct  857   IERKKQE  863



>emb|CDP05534.1| unnamed protein product [Coffea canephora]
Length=691

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = -1

Query  1002  NLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTS  823
              L KL+        + I++  +LP LEVL L K  ++   W++ + E F +L +L+++  
Sbjct  557   TLRKLTLENFCLTREAISAIGQLPNLEVLKLRKSAFLDLKWDMEDGE-FIKLKFLQLSEV  615

Query  822   NFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQ  643
               +E+W A +  FP L+RLVL  C+ LE+I   F +IP L+ + +Y+C      SA++I 
Sbjct  616   Q-IEKWNACSEPFPSLQRLVLINCKGLEEILSIFGDIPTLRIMRMYWC-HKATSSAQQIF  673

Query  642   REQHEQGNDNMVV  604
              EQ + GND   V
Sbjct  674   EEQQDMGNDGFEV  686



>ref|XP_010319427.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=310

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 70/116 (60%), Gaps = 1/116 (1%)
 Frame = -1

Query  951  NSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLE  772
            ++F  LP LE L L  C     AW + +K+ F  L  L ++  N L+RWEAS+ NFP L+
Sbjct  184  STFIMLPNLEKLKLKYCGADDDAWIMSDKDIFKSLKLLLLSHLN-LKRWEASSDNFPNLK  242

Query  771  RLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGNDNMVV  604
            RLVL  C  L++IP  F EI  L+SIEL+ C  +   SA+ I++EQ +  N+ + V
Sbjct  243  RLVLKKCPDLQEIPTDFGEICTLESIELHDCSATSEVSARNIEQEQEDMENNILKV  298



>ref|XP_009796671.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
 ref|XP_009796672.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
Length=776

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 74/126 (59%), Gaps = 5/126 (4%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             + L KL+     F+ +      +L  LEVL L K  + G +W+L  +  F +L  L I+T
Sbjct  603   RTLKKLTLSDTRFDWREAIGLEQLECLEVLKL-KDAFTGKSWKL--EVGFSELQALSIDT  659

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
             ++F E WEAS  +FP+L  LVL +C+ LE +P  FA+IP+L+ + L       V SAKEI
Sbjct  660   TDF-ETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENT-SKAVRSAKEI  717

Query  645   QREQHE  628
             +R++ E
Sbjct  718   ERKKQE  723



>ref|XP_009803726.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=935

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 12/128 (9%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL KL+     F+ K ++   KLPKLE L L     IG  W+++ K+ F  L +L    
Sbjct  781   QNLKKLAFYGTCFQWKDLSIVGKLPKLEALKLGISACIGIEWKVV-KDGFPSLKFL----  835

Query  825   SNFLER-----WEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVD  661
                LER     W AS  +FP LERL L+ C  L+ IP  FA+I  L  I++ +C  SV +
Sbjct  836   --LLERLKVRYWRASCDHFPCLERLFLEHCWDLDSIPQDFADITTLALIDIRWCAESVGN  893

Query  660   SAKEIQRE  637
             SAK+IQ +
Sbjct  894   SAKQIQED  901



>ref|XP_006355133.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006355134.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
isoform X2 [Solanum tuberosum]
Length=1190

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 81/142 (57%), Gaps = 4/142 (3%)
 Frame = -1

Query  1014  VSCKNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLE  835
             +S  NL KL         + ++SFS+L  L+ L L+  ++    WE+   + F +L  L+
Sbjct  1050  ISASNLKKLKVSYYILGSQHLSSFSQLQNLQELELNFVEFADEEWEV--SDEFAELKVLK  1107

Query  834   INTSNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSA  655
             I   +  + W      FPKLE +VL  C++L +IP  FAE+ +LK IE+  C  SVV+SA
Sbjct  1108  IVNCSSFKEWTVYDDAFPKLEHMVLHCCQLLVEIPSWFAEVSSLKYIEVDNCNGSVVESA  1167

Query  654   KEIQREQ-HEQGNDNM-VVIEE  595
             + IQR +  E  ND++ +VI+E
Sbjct  1168  RIIQRTKVEEYANDDLELVIKE  1189



>gb|EYU31599.1| hypothetical protein MIMGU_mgv1a025745mg, partial [Erythranthe 
guttata]
Length=692

 Score = 73.6 bits (179),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  936  LPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINTSNFLERWEASASNFPKLERLVLD  757
            LP L+VL L    ++G  WE +E + F  L YL I +   LE W   +++FP+LE L L 
Sbjct  565  LPSLQVLKLKASSFVGTEWETIEGQ-FCNLRYLLIRSCRDLEWWTTDSNHFPRLEHLHLQ  623

Query  756  WCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEIQREQHEQGN  619
            + + L++IP    EI  L+SIEL  C    V SAK+I +EQ + GN
Sbjct  624  FLDKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQEDFGN  669



>ref|XP_009777040.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=902

 Score = 73.6 bits (179),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 75/138 (54%), Gaps = 5/138 (4%)
 Frame = -1

Query  1005  KNLMKLSXRCVSFEVKTINSFSKLPKLEVLVLSKCDWIGGAWELLEKESFDQLIYLEINT  826
             +NL  L+     F  K ++ F KLPKLE + L    +    WE+++ E F +L +L +  
Sbjct  768   QNLKNLAFSGTFFCWKDLSGFGKLPKLESIKLGYDAFQDKEWEIVD-EVFPRLKFLLLED  826

Query  825   SNFLERWEASASNFPKLERLVLDWCEVLEKIPVGFAEIPNLKSIELYYCLPSVVDSAKEI  646
                +  W AS  NFP LERL L  C  L+ IP  FA+I  L  I+++ C  SV +SAK+I
Sbjct  827   LE-IRHWRASCDNFPCLERLFLKGCWYLDSIPQDFADITTLALIDIWRCAKSVENSAKQI  885

Query  645   QREQHEQGNDNMVVIEEH  592
             Q++  +   +  + IE H
Sbjct  886   QQDMQD---NYAISIEVH  900



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2556976323508