BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5443

Length=1009
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009785957.1|  PREDICTED: uncharacterized protein LOC104234...    322   5e-99   Nicotiana sylvestris
ref|XP_009785963.1|  PREDICTED: uncharacterized protein LOC104234...    321   6e-99   Nicotiana sylvestris
ref|XP_009785950.1|  PREDICTED: uncharacterized protein LOC104234...    322   7e-99   Nicotiana sylvestris
ref|XP_009614041.1|  PREDICTED: uncharacterized protein LOC104107...    318   1e-97   Nicotiana tomentosiformis
ref|XP_009614040.1|  PREDICTED: uncharacterized protein LOC104107...    318   1e-97   Nicotiana tomentosiformis
ref|XP_009614044.1|  PREDICTED: uncharacterized protein LOC104107...    317   1e-97   Nicotiana tomentosiformis
ref|XP_009614043.1|  PREDICTED: uncharacterized protein LOC104107...    317   2e-97   Nicotiana tomentosiformis
emb|CDP17325.1|  unnamed protein product                                316   3e-96   Coffea canephora [robusta coffee]
ref|XP_006355598.1|  PREDICTED: signaling mucin HKR1-like               314   5e-96   Solanum tuberosum [potatoes]
gb|KDO78075.1|  hypothetical protein CISIN_1g0026401mg                  293   2e-94   Citrus sinensis [apfelsine]
gb|KDO78070.1|  hypothetical protein CISIN_1g0026401mg                  293   6e-94   Citrus sinensis [apfelsine]
ref|XP_007025176.1|  Uncharacterized protein TCM_029557                 301   1e-90   
ref|XP_006467531.1|  PREDICTED: uncharacterized protein LOC102630...    299   3e-90   
ref|XP_006467530.1|  PREDICTED: uncharacterized protein LOC102630...    300   4e-90   Citrus sinensis [apfelsine]
ref|XP_006377248.1|  hypothetical protein POPTR_0011s02850g             300   6e-90   
ref|XP_002317304.2|  kinase-related family protein                      300   6e-90   
ref|XP_006449625.1|  hypothetical protein CICLE_v10014224mg             298   2e-89   Citrus clementina [clementine]
ref|XP_006449624.1|  hypothetical protein CICLE_v10014224mg             297   2e-89   
emb|CBI30819.3|  unnamed protein product                                294   1e-88   Vitis vinifera
ref|XP_008225365.1|  PREDICTED: dentin sialophosphoprotein isofor...    295   2e-88   Prunus mume [ume]
ref|XP_008225366.1|  PREDICTED: dentin sialophosphoprotein isofor...    295   2e-88   Prunus mume [ume]
ref|XP_011005847.1|  PREDICTED: uncharacterized protein LOC105112...    295   2e-88   Populus euphratica
ref|XP_011005848.1|  PREDICTED: uncharacterized protein LOC105112...    295   2e-88   Populus euphratica
ref|XP_011005845.1|  PREDICTED: uncharacterized protein LOC105112...    294   3e-88   Populus euphratica
ref|XP_011045310.1|  PREDICTED: uncharacterized protein LOC105140...    294   3e-88   Populus euphratica
ref|XP_010655630.1|  PREDICTED: protein lingerer-like                   295   3e-88   Vitis vinifera
ref|XP_011005846.1|  PREDICTED: uncharacterized protein LOC105112...    294   4e-88   Populus euphratica
ref|XP_012091905.1|  PREDICTED: uncharacterized protein LOC105649755    294   4e-88   Jatropha curcas
ref|XP_011045309.1|  PREDICTED: uncharacterized protein LOC105140...    294   5e-88   Populus euphratica
ref|XP_011045308.1|  PREDICTED: uncharacterized protein LOC105140...    293   7e-88   Populus euphratica
gb|KHF99174.1|  hypothetical protein F383_17166                         293   1e-87   Gossypium arboreum [tree cotton]
gb|KJB69763.1|  hypothetical protein B456_011G041100                    291   4e-87   Gossypium raimondii
gb|KJB69765.1|  hypothetical protein B456_011G041100                    291   5e-87   Gossypium raimondii
ref|XP_004232971.1|  PREDICTED: uncharacterized protein LOC101252351    289   1e-86   Solanum lycopersicum
gb|KHN48057.1|  hypothetical protein glysoja_015527                     289   1e-86   Glycine soja [wild soybean]
ref|XP_007214618.1|  hypothetical protein PRUPE_ppa001304mg             289   2e-86   Prunus persica
ref|XP_011096496.1|  PREDICTED: uncharacterized protein LOC105175...    288   4e-86   Sesamum indicum [beniseed]
ref|XP_011096498.1|  PREDICTED: uncharacterized protein LOC105175...    288   5e-86   
ref|XP_006369885.1|  hypothetical protein POPTR_0001s34440g             288   8e-86   
gb|KHF99173.1|  hypothetical protein F383_17166                         284   4e-84   Gossypium arboreum [tree cotton]
ref|XP_009790935.1|  PREDICTED: uncharacterized protein LOC104238306    280   7e-83   Nicotiana sylvestris
ref|XP_004134562.1|  PREDICTED: uncharacterized protein LOC101211...    279   8e-83   Cucumis sativus [cucumbers]
ref|XP_011658276.1|  PREDICTED: uncharacterized protein LOC101211...    279   9e-83   Cucumis sativus [cucumbers]
ref|XP_008439672.1|  PREDICTED: probable GPI-anchored adhesin-lik...    279   1e-82   Cucumis melo [Oriental melon]
ref|XP_008439673.1|  PREDICTED: probable GPI-anchored adhesin-lik...    279   1e-82   Cucumis melo [Oriental melon]
ref|XP_006356118.1|  PREDICTED: cell wall protein AWA1-like             279   1e-82   Solanum tuberosum [potatoes]
gb|KGN49366.1|  hypothetical protein Csa_6G522110                       279   3e-82   Cucumis sativus [cucumbers]
ref|XP_011460396.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    278   3e-82   Fragaria vesca subsp. vesca
ref|XP_009618328.1|  PREDICTED: uncharacterized protein LOC104110...    275   4e-81   Nicotiana tomentosiformis
ref|XP_009618326.1|  PREDICTED: uncharacterized protein LOC104110...    275   4e-81   Nicotiana tomentosiformis
ref|XP_007159534.1|  hypothetical protein PHAVU_002G245500g             275   5e-81   Phaseolus vulgaris [French bean]
ref|XP_010317412.1|  PREDICTED: uncharacterized protein LOC101266...    274   7e-81   Solanum lycopersicum
ref|XP_004234052.1|  PREDICTED: uncharacterized protein LOC101266...    274   1e-80   Solanum lycopersicum
ref|XP_002519742.1|  conserved hypothetical protein                     273   1e-80   Ricinus communis
ref|XP_010275810.1|  PREDICTED: uncharacterized protein LOC104610...    273   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010275801.1|  PREDICTED: uncharacterized protein LOC104610...    273   3e-80   Nelumbo nucifera [Indian lotus]
gb|EYU28172.1|  hypothetical protein MIMGU_mgv1a001362mg                268   1e-78   Erythranthe guttata [common monkey flower]
ref|XP_006580202.1|  PREDICTED: uncharacterized serine-rich prote...    268   2e-78   Glycine max [soybeans]
ref|XP_010243690.1|  PREDICTED: uncharacterized protein LOC104587...    267   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010243689.1|  PREDICTED: uncharacterized protein LOC104587...    268   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_011085623.1|  PREDICTED: uncharacterized protein LOC105167549    267   3e-78   
gb|KHG18569.1|  Protein translocase subunit SecA                        267   4e-78   Gossypium arboreum [tree cotton]
gb|KJB57294.1|  hypothetical protein B456_009G157400                    264   5e-78   Gossypium raimondii
gb|KJB57297.1|  hypothetical protein B456_009G157400                    264   1e-77   Gossypium raimondii
gb|KJB57295.1|  hypothetical protein B456_009G157400                    265   2e-77   Gossypium raimondii
ref|XP_008358625.1|  PREDICTED: cell wall protein RBR3-like             250   8e-77   
ref|XP_003629905.1|  hypothetical protein MTR_8g088190                  260   1e-75   Medicago truncatula
ref|XP_008364175.1|  PREDICTED: uncharacterized protein LOC103427...    260   1e-75   
ref|XP_008364176.1|  PREDICTED: uncharacterized protein LOC103427...    260   1e-75   
ref|XP_008364174.1|  PREDICTED: uncharacterized protein LOC103427...    259   2e-75   
ref|XP_009353840.1|  PREDICTED: uncharacterized protein LOC103945...    258   7e-75   Pyrus x bretschneideri [bai li]
ref|XP_009353841.1|  PREDICTED: uncharacterized protein LOC103945...    258   8e-75   
ref|XP_009353842.1|  PREDICTED: uncharacterized protein LOC103945...    258   9e-75   Pyrus x bretschneideri [bai li]
ref|XP_009353838.1|  PREDICTED: uncharacterized protein LOC103945...    258   1e-74   
ref|XP_009353839.1|  PREDICTED: uncharacterized protein LOC103945...    258   1e-74   
ref|XP_004504230.1|  PREDICTED: serine/threonine-protein kinase p...    257   1e-74   Cicer arietinum [garbanzo]
ref|XP_008366008.1|  PREDICTED: protein lingerer-like                   254   2e-73   
ref|XP_010666705.1|  PREDICTED: uncharacterized protein LOC104883...    240   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666704.1|  PREDICTED: uncharacterized protein LOC104883...    239   4e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010056862.1|  PREDICTED: uncharacterized protein LOC104444...    238   2e-67   Eucalyptus grandis [rose gum]
ref|XP_010056861.1|  PREDICTED: uncharacterized protein LOC104444...    238   2e-67   Eucalyptus grandis [rose gum]
ref|XP_010056860.1|  PREDICTED: uncharacterized protein LOC104444...    238   2e-67   Eucalyptus grandis [rose gum]
ref|XP_006597650.1|  PREDICTED: cell wall protein AWA1-like isofo...    237   2e-67   
ref|XP_004486425.1|  PREDICTED: serine-rich adhesin for platelets...    237   3e-67   Cicer arietinum [garbanzo]
ref|XP_006597649.1|  PREDICTED: cell wall protein AWA1-like isofo...    237   3e-67   
gb|KHN14369.1|  hypothetical protein glysoja_012407                     236   5e-67   Glycine soja [wild soybean]
ref|XP_008797517.1|  PREDICTED: uncharacterized protein LOC103712...    231   9e-66   
ref|XP_008797516.1|  PREDICTED: uncharacterized protein LOC103712...    233   2e-65   Phoenix dactylifera
ref|XP_010926244.1|  PREDICTED: uncharacterized protein LOC105048593    231   6e-65   Elaeis guineensis
ref|XP_008349816.1|  PREDICTED: serine/threonine-protein kinase C...    214   4e-64   
ref|XP_010924304.1|  PREDICTED: signaling mucin HKR1-like               225   7e-63   Elaeis guineensis
ref|XP_010549430.1|  PREDICTED: uncharacterized protein LOC104820614    223   4e-62   Tarenaya hassleriana [spider flower]
ref|XP_007147529.1|  hypothetical protein PHAVU_006G132200g             222   9e-62   Phaseolus vulgaris [French bean]
ref|XP_006586817.1|  PREDICTED: cell wall protein AWA1-like isofo...    220   4e-61   Glycine max [soybeans]
ref|XP_003534759.1|  PREDICTED: cell wall protein AWA1-like isofo...    220   4e-61   Glycine max [soybeans]
ref|XP_008800693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    217   4e-60   
ref|XP_010538220.1|  PREDICTED: uncharacterized protein LOC104812...    216   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_010538221.1|  PREDICTED: uncharacterized protein LOC104812...    214   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_006415582.1|  hypothetical protein EUTSA_v10006794mg             206   4e-56   Eutrema salsugineum [saltwater cress]
ref|XP_006415581.1|  hypothetical protein EUTSA_v10006794mg             206   4e-56   Eutrema salsugineum [saltwater cress]
emb|CDX94662.1|  BnaC07g09960D                                          202   4e-55   
ref|XP_010539204.1|  PREDICTED: putative uncharacterized protein ...    202   5e-55   Tarenaya hassleriana [spider flower]
ref|XP_009410966.1|  PREDICTED: uncharacterized protein LOC103992...    201   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410964.1|  PREDICTED: uncharacterized protein LOC103992...    201   2e-54   
ref|XP_009410965.1|  PREDICTED: uncharacterized protein LOC103992...    201   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410962.1|  PREDICTED: uncharacterized protein LOC103992...    201   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU43283.1|  hypothetical protein MIMGU_mgv1a002920mg                197   7e-54   Erythranthe guttata [common monkey flower]
ref|XP_002893558.1|  hypothetical protein ARALYDRAFT_473146             196   9e-53   
ref|XP_006306766.1|  hypothetical protein CARUB_v10008305mg             195   2e-52   Capsella rubella
ref|XP_006306765.1|  hypothetical protein CARUB_v10008305mg             195   2e-52   Capsella rubella
ref|NP_174230.2|  Kinase-related protein                                194   6e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51735.1|AC068667_14  unknown protein; 25451-20507                 194   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478296.1|  PREDICTED: probable serine/threonine-protein...    193   1e-51   
ref|XP_010499452.1|  PREDICTED: RNA polymerase II degradation fac...    192   2e-51   
ref|XP_010540528.1|  PREDICTED: uncharacterized protein LOC104814266    192   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_010460715.1|  PREDICTED: putative uncharacterized protein ...    192   3e-51   
emb|CDY15632.1|  BnaA07g08030D                                          191   3e-51   Brassica napus [oilseed rape]
ref|NP_174229.2|  uncharacterized protein                               192   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460714.1|  PREDICTED: putative uncharacterized protein ...    191   3e-51   Camelina sativa [gold-of-pleasure]
gb|AAG51729.1|AC068667_8  unknown protein; 16040-11188                  191   4e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99817.1|  BnaC05g22390D                                          190   4e-51   
ref|XP_009102863.1|  PREDICTED: uncharacterized protein LOC103828...    188   2e-50   Brassica rapa
emb|CDY48333.1|  BnaA09g26880D                                          189   3e-50   Brassica napus [oilseed rape]
ref|XP_009102862.1|  PREDICTED: uncharacterized protein LOC103828...    189   3e-50   Brassica rapa
ref|XP_009102861.1|  PREDICTED: uncharacterized protein LOC103828...    189   3e-50   Brassica rapa
ref|XP_006646178.1|  PREDICTED: putative GPI-anchored protein PB1...    187   1e-49   
dbj|BAD72339.1|  TA9 protein-like                                       177   3e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115248.1|  PREDICTED: putative uncharacterized protein ...    182   8e-48   
ref|XP_009141365.1|  PREDICTED: RNA polymerase II degradation fac...    181   1e-47   Brassica rapa
gb|KJB57296.1|  hypothetical protein B456_009G157400                    179   5e-47   Gossypium raimondii
gb|AAL58943.1|AF462857_1  At1g29350/F15D2_27                            179   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043788.1|  Os01g0663800                                       179   1e-46   
ref|XP_009395691.1|  PREDICTED: mucin-17-like                           178   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX90188.1|  BnaA08g17960D                                          177   3e-46   
ref|XP_009109668.1|  PREDICTED: RNA polymerase II degradation fac...    177   4e-46   Brassica rapa
ref|XP_009109669.1|  PREDICTED: RNA polymerase II degradation fac...    177   5e-46   Brassica rapa
emb|CDY43334.1|  BnaC03g59060D                                          177   6e-46   Brassica napus [oilseed rape]
gb|EEC71225.1|  hypothetical protein OsI_03160                          174   2e-45   Oryza sativa Indica Group [Indian rice]
emb|CDY43685.1|  BnaA04g20060D                                          175   3e-45   Brassica napus [oilseed rape]
ref|XP_009394232.1|  PREDICTED: uncharacterized protein LOC103979756    174   8e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22963.1|  hypothetical protein glysoja_030633                     172   7e-44   Glycine soja [wild soybean]
emb|CDY61562.1|  BnaCnng37970D                                          169   2e-43   Brassica napus [oilseed rape]
ref|XP_009396491.1|  PREDICTED: uncharacterized protein LOC103981...    170   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396490.1|  PREDICTED: uncharacterized protein LOC103981...    170   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006410567.1|  hypothetical protein EUTSA_v10016218mg             169   5e-43   Eutrema salsugineum [saltwater cress]
ref|XP_006410569.1|  hypothetical protein EUTSA_v10016218mg             169   6e-43   
gb|EMT31975.1|  Retrovirus-related Pol polyprotein LINE-1               169   9e-43   
emb|CDJ26391.1|  unnamed protein product                                167   2e-42   Triticum aestivum [Canadian hard winter wheat]
gb|KFK36320.1|  hypothetical protein AALP_AA4G107400                    167   2e-42   Arabis alpina [alpine rockcress]
ref|NP_001130067.1|  uncharacterized protein LOC100191159               157   6e-42   
ref|XP_008648655.1|  PREDICTED: uncharacterized protein LOC103629266    158   7e-42   
ref|XP_010232108.1|  PREDICTED: uncharacterized protein LOC100846...    160   7e-40   Brachypodium distachyon [annual false brome]
ref|XP_004961191.1|  PREDICTED: flocculation protein FLO11-like i...    160   9e-40   Setaria italica
ref|XP_004961192.1|  PREDICTED: flocculation protein FLO11-like i...    160   9e-40   Setaria italica
ref|XP_006827353.1|  PREDICTED: uncharacterized protein LOC18422579     160   1e-39   Amborella trichopoda
ref|XP_003569505.1|  PREDICTED: uncharacterized protein LOC100846...    159   1e-39   Brachypodium distachyon [annual false brome]
ref|XP_004969440.1|  PREDICTED: putative GPI-anchored protein PB1...    159   2e-39   Setaria italica
ref|XP_004969439.1|  PREDICTED: putative GPI-anchored protein PB1...    159   2e-39   Setaria italica
gb|EMS47817.1|  hypothetical protein TRIUR3_20557                       159   3e-39   Triticum urartu
ref|XP_008671999.1|  PREDICTED: uncharacterized protein LOC100191...    158   3e-39   
tpg|DAA58234.1|  TPA: putative DUF1296 domain containing family p...    158   3e-39   
ref|XP_010413764.1|  PREDICTED: probable serine/threonine-protein...    156   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010413763.1|  PREDICTED: alpha-protein kinase 1-like isofo...    156   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008645740.1|  PREDICTED: uncharacterized protein LOC103627229    147   7e-38   
gb|AFW71654.1|  hypothetical protein ZEAMMB73_647126                    148   5e-37   
ref|XP_006654843.1|  PREDICTED: dentin sialophosphoprotein-like         150   2e-36   Oryza brachyantha
ref|XP_003567874.1|  PREDICTED: uncharacterized protein LOC100840916    148   8e-36   Brachypodium distachyon [annual false brome]
gb|ACF86865.1|  unknown                                                 146   1e-35   Zea mays [maize]
ref|NP_001141689.1|  uncharacterized protein LOC100273818               147   3e-35   Zea mays [maize]
ref|XP_008647566.1|  PREDICTED: uncharacterized protein LOC100273...    147   3e-35   Zea mays [maize]
ref|XP_008656717.1|  PREDICTED: uncharacterized protein LOC103636139    146   5e-35   
ref|XP_009132981.1|  PREDICTED: uncharacterized protein LOC103857526    145   5e-35   Brassica rapa
emb|CDX84653.1|  BnaA03g15770D                                          146   5e-35   
ref|XP_002881327.1|  hypothetical protein ARALYDRAFT_321144             145   7e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_002440322.1|  hypothetical protein SORBIDRAFT_09g029670          144   1e-34   
dbj|BAJ92311.1|  predicted protein                                      145   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS63247.1|  hypothetical protein TRIUR3_29233                       144   1e-34   Triticum urartu
dbj|BAJ85689.1|  predicted protein                                      144   4e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008229421.1|  PREDICTED: cell wall protein AWA1-like             140   4e-33   Prunus mume [ume]
ref|XP_002440264.1|  hypothetical protein SORBIDRAFT_09g028730          137   4e-32   
gb|EEC79757.1|  hypothetical protein OsI_21141                          136   1e-31   Oryza sativa Indica Group [Indian rice]
gb|AFW81250.1|  putative DUF1296 domain containing family protein       135   2e-31   
ref|XP_008654853.1|  PREDICTED: uncharacterized protein LOC100280...    135   3e-31   Zea mays [maize]
ref|XP_008654852.1|  PREDICTED: uncharacterized protein LOC100280...    135   3e-31   Zea mays [maize]
ref|XP_008654854.1|  PREDICTED: uncharacterized protein LOC100280...    135   3e-31   Zea mays [maize]
ref|XP_008654851.1|  PREDICTED: uncharacterized protein LOC100280...    135   3e-31   Zea mays [maize]
gb|AFW81251.1|  putative DUF1296 domain containing family protein       135   3e-31   
ref|NP_001146586.1|  uncharacterized protein LOC100280182               135   3e-31   Zea mays [maize]
gb|AFW81248.1|  putative DUF1296 domain containing family protein       135   4e-31   
ref|XP_007217053.1|  hypothetical protein PRUPE_ppa001198mg             134   8e-31   
ref|NP_001056433.1|  Os05g0581800                                       132   4e-30   
gb|AAT44198.1|  unknown protein                                         132   4e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64826.1|  hypothetical protein OsJ_19683                          131   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654800.1|  PREDICTED: uncharacterized protein LOC102700994    130   8e-30   Oryza brachyantha
emb|CBI20348.3|  unnamed protein product                                123   2e-29   Vitis vinifera
ref|NP_001056347.1|  Os05g0566900                                       127   9e-29   
gb|EEC79711.1|  hypothetical protein OsI_21014                          127   1e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_004961107.1|  PREDICTED: uncharacterized protein LOC101764...    126   3e-28   Setaria italica
ref|XP_004961106.1|  PREDICTED: uncharacterized protein LOC101764...    126   3e-28   Setaria italica
ref|XP_010230981.1|  PREDICTED: uncharacterized protein LOC100825...    124   2e-27   
ref|XP_003567822.1|  PREDICTED: uncharacterized protein LOC100825...    124   2e-27   
emb|CAN79286.1|  hypothetical protein VITISV_039797                     118   4e-27   Vitis vinifera
ref|XP_006410568.1|  hypothetical protein EUTSA_v10016218mg             122   6e-27   
ref|XP_007048866.1|  Uncharacterized protein TCM_001879                 122   7e-27   
emb|CDY37665.1|  BnaA04g20030D                                          118   1e-25   Brassica napus [oilseed rape]
ref|NP_001266740.1|  uncharacterized protein LOC101027201               115   2e-25   
emb|CAE00871.1|  TA9 protein                                            109   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655403.1|  PREDICTED: uncharacterized protein LOC101027...    116   6e-25   
ref|XP_008655402.1|  PREDICTED: uncharacterized protein LOC101027...    116   7e-25   
ref|XP_008650021.1|  PREDICTED: cell wall protein AWA1-like             115   2e-24   
ref|XP_010449498.1|  PREDICTED: uncharacterized protein LOC104731...    114   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010449499.1|  PREDICTED: uncharacterized protein LOC104731...    114   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010439898.1|  PREDICTED: uncharacterized protein LOC104723...    113   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010439897.1|  PREDICTED: uncharacterized protein LOC104723...    113   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_011467573.1|  PREDICTED: uncharacterized protein LOC101307...    111   3e-23   Fragaria vesca subsp. vesca
ref|XP_011467574.1|  PREDICTED: uncharacterized protein LOC101307...    110   4e-23   Fragaria vesca subsp. vesca
ref|XP_010102151.1|  hypothetical protein L484_021385                   111   4e-23   Morus notabilis
ref|XP_010434571.1|  PREDICTED: probable serine/threonine-protein...    110   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010434569.1|  PREDICTED: probable serine/threonine-protein...    110   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010559260.1|  PREDICTED: uncharacterized protein LOC104827...    109   9e-23   Tarenaya hassleriana [spider flower]
dbj|BAK03133.1|  predicted protein                                      108   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010559259.1|  PREDICTED: uncharacterized protein LOC104827...    109   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_010559258.1|  PREDICTED: uncharacterized protein LOC104827...    109   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_010559257.1|  PREDICTED: uncharacterized protein LOC104827...    109   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_009356619.1|  PREDICTED: uncharacterized protein LOC103947...    109   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_009356617.1|  PREDICTED: uncharacterized protein LOC103947...    109   1e-22   Pyrus x bretschneideri [bai li]
dbj|BAJ94362.1|  predicted protein                                      109   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008380341.1|  PREDICTED: probable GPI-anchored adhesin-lik...    108   2e-22   
ref|XP_002870069.1|  predicted protein                                  108   2e-22   Arabidopsis lyrata subsp. lyrata
emb|CDY61669.1|  BnaC01g40800D                                          107   4e-22   Brassica napus [oilseed rape]
ref|XP_009356618.1|  PREDICTED: uncharacterized protein LOC103947...    105   3e-21   Pyrus x bretschneideri [bai li]
gb|EMS61509.1|  hypothetical protein TRIUR3_20581                       103   1e-20   Triticum urartu
ref|XP_006282485.1|  hypothetical protein CARUB_v10006235mg             100   1e-19   
ref|XP_009131438.1|  PREDICTED: flocculation protein FLO11            96.7    2e-18   Brassica rapa
emb|CDX78828.1|  BnaA01g08950D                                        95.5    3e-18   
gb|KFK28493.1|  hypothetical protein AALP_AA7G003100                  95.5    4e-18   Arabis alpina [alpine rockcress]
gb|KFK28492.1|  hypothetical protein AALP_AA7G003100                  95.5    4e-18   Arabis alpina [alpine rockcress]
emb|CAB53656.1|  hypothetical protein                                 94.4    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193549.5|  uncharacterized protein                             94.4    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414144.1|  hypothetical protein EUTSA_v10027504mg           94.0    1e-17   
ref|XP_012087231.1|  PREDICTED: uncharacterized protein LOC105646039  89.0    5e-16   Jatropha curcas
ref|XP_008362365.1|  PREDICTED: uncharacterized protein LOC103426056  89.0    5e-16   
ref|XP_008342489.1|  PREDICTED: uncharacterized protein LOC103405294  89.0    6e-16   
emb|CDY11787.1|  BnaC03g57910D                                        87.0    2e-15   Brassica napus [oilseed rape]
gb|EMT27654.1|  hypothetical protein F775_52320                       85.1    9e-15   
ref|XP_009377414.1|  PREDICTED: uncharacterized protein LOC103966021  84.7    1e-14   Pyrus x bretschneideri [bai li]
gb|KDO60959.1|  hypothetical protein CISIN_1g0031902mg                84.3    2e-14   Citrus sinensis [apfelsine]
ref|XP_006484854.1|  PREDICTED: uncharacterized protein LOC102628...  84.3    2e-14   Citrus sinensis [apfelsine]
gb|KDO60960.1|  hypothetical protein CISIN_1g0031902mg                84.3    2e-14   Citrus sinensis [apfelsine]
ref|XP_006484855.1|  PREDICTED: uncharacterized protein LOC102628...  84.3    2e-14   
ref|XP_011026253.1|  PREDICTED: uncharacterized protein LOC105126...  82.4    8e-14   Populus euphratica
ref|XP_011026251.1|  PREDICTED: uncharacterized protein LOC105126...  82.4    8e-14   Populus euphratica
ref|XP_011026254.1|  PREDICTED: uncharacterized protein LOC105126...  82.0    8e-14   Populus euphratica
ref|XP_011026250.1|  PREDICTED: uncharacterized protein LOC105126...  82.4    8e-14   Populus euphratica
ref|XP_011026252.1|  PREDICTED: uncharacterized protein LOC105126...  82.0    9e-14   Populus euphratica
gb|AFW21569.1|  hypothetical protein ZEAMMB73_653125                  81.3    1e-13   
gb|EMT26879.1|  hypothetical protein F775_17961                       81.3    2e-13   
ref|XP_002300878.1|  hypothetical protein POPTR_0002s06020g           80.1    4e-13   
ref|XP_010469379.1|  PREDICTED: uncharacterized protein LOC104749442  66.6    1e-08   
gb|KJB69766.1|  hypothetical protein B456_011G041100                  65.5    3e-08   Gossypium raimondii
ref|XP_006405899.1|  hypothetical protein EUTSA_v10028301mg           63.9    8e-08   
ref|XP_008779718.1|  PREDICTED: uncharacterized protein LOC103699456  60.5    1e-07   
gb|KJB75412.1|  hypothetical protein B456_012G040900                  63.2    1e-07   Gossypium raimondii
ref|XP_006405898.1|  hypothetical protein EUTSA_v10028089mg           62.4    3e-07   
gb|KHG01632.1|  Segment polarity dishevelled DVL-3                    62.4    3e-07   Gossypium arboreum [tree cotton]
ref|XP_006447832.1|  hypothetical protein CICLE_v10014215mg           62.0    4e-07   Citrus clementina [clementine]
ref|XP_006447831.1|  hypothetical protein CICLE_v10014215mg           62.0    5e-07   Citrus clementina [clementine]
ref|XP_006437175.1|  hypothetical protein CICLE_v10033869mg           57.4    1e-05   
ref|XP_006389698.1|  hypothetical protein EUTSA_v10027613mg           56.2    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010547193.1|  PREDICTED: uncharacterized protein LOC104819...  55.8    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010547195.1|  PREDICTED: uncharacterized protein LOC104819...  55.8    4e-05   Tarenaya hassleriana [spider flower]
ref|XP_010547194.1|  PREDICTED: uncharacterized protein LOC104819...  55.8    4e-05   Tarenaya hassleriana [spider flower]
ref|XP_001776008.1|  predicted protein                                53.1    3e-04   



>ref|XP_009785957.1| PREDICTED: uncharacterized protein LOC104234138 isoform X2 [Nicotiana 
sylvestris]
Length=841

 Score =   322 bits (826),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHLAVHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAGNSTY QSLAAVLP
Sbjct  619   AVPQHLAVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGNSTYHQSLAAVLP  678

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A+V SGYG FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD 
Sbjct  679   QYKNSVSVSSLPQSASVASGYGGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDT  738

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  739   NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  798

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQ GISL+  HQQQNPRDG LG     +Q QPK S QQLWQNSY
Sbjct  799   -PNFYHSQAGISLE--HQQQNPRDGSLGA----SQGQPKQSQQQLWQNSY  841



>ref|XP_009785963.1| PREDICTED: uncharacterized protein LOC104234138 isoform X3 [Nicotiana 
sylvestris]
Length=780

 Score =   321 bits (822),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHLAVHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAGNSTY QSLAAVLP
Sbjct  558   AVPQHLAVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGNSTYHQSLAAVLP  617

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A+V SGYG FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD 
Sbjct  618   QYKNSVSVSSLPQSASVASGYGGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDT  677

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  678   NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  737

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQ GISL+  HQQQNPRDG LG     +Q QPK S QQLWQNSY
Sbjct  738   -PNFYHSQAGISLE--HQQQNPRDGSLGA----SQGQPKQSQQQLWQNSY  780



>ref|XP_009785950.1| PREDICTED: uncharacterized protein LOC104234138 isoform X1 [Nicotiana 
sylvestris]
Length=843

 Score =   322 bits (825),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHLAVHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAGNSTY QSLAAVLP
Sbjct  621   AVPQHLAVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGNSTYHQSLAAVLP  680

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A+V SGYG FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD 
Sbjct  681   QYKNSVSVSSLPQSASVASGYGGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDT  740

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  741   NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  800

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQ GISL+  HQQQNPRDG LG     +Q QPK S QQLWQNSY
Sbjct  801   -PNFYHSQAGISLE--HQQQNPRDGSLGA----SQGQPKQSQQQLWQNSY  843



>ref|XP_009614041.1| PREDICTED: uncharacterized protein LOC104107048 isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   318 bits (816),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHL VHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAG+STY QSLAAVLP
Sbjct  617   AVPQHLTVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGSSTYHQSLAAVLP  676

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A+V SGYG FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  677   QYKNSVSVSSLPQSASVASGYGGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDT  736

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  737   NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  796

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK S QQLWQNSY
Sbjct  797   -PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQSQQQLWQNSY  839



>ref|XP_009614040.1| PREDICTED: uncharacterized protein LOC104107048 isoform X1 [Nicotiana 
tomentosiformis]
Length=841

 Score =   318 bits (816),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHL VHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAG+STY QSLAAVLP
Sbjct  619   AVPQHLTVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGSSTYHQSLAAVLP  678

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A+V SGYG FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  679   QYKNSVSVSSLPQSASVASGYGGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDT  738

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  739   NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  798

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK S QQLWQNSY
Sbjct  799   -PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQSQQQLWQNSY  841



>ref|XP_009614044.1| PREDICTED: uncharacterized protein LOC104107048 isoform X4 [Nicotiana 
tomentosiformis]
Length=783

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHL VHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAG+STY QSLAAVLP
Sbjct  561   AVPQHLTVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGSSTYHQSLAAVLP  620

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A+V SGYG FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  621   QYKNSVSVSSLPQSASVASGYGGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDT  680

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  681   NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  740

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK S QQLWQNSY
Sbjct  741   -PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQSQQQLWQNSY  783



>ref|XP_009614043.1| PREDICTED: uncharacterized protein LOC104107048 isoform X3 [Nicotiana 
tomentosiformis]
Length=789

 Score =   317 bits (813),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHL VHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAG+STY QSLAAVLP
Sbjct  567   AVPQHLTVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGSSTYHQSLAAVLP  626

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A+V SGYG FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  627   QYKNSVSVSSLPQSASVASGYGGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDT  686

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  687   NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  746

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK S QQLWQNSY
Sbjct  747   -PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQSQQQLWQNSY  789



>emb|CDP17325.1| unnamed protein product [Coffea canephora]
Length=877

 Score =   316 bits (809),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 190/230 (83%), Gaps = 10/230 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA HPYSQPTLPLGPFAN+I YPF+ QSY YMP  FQQ FAGNSTY QSLAAVLP
Sbjct  657   ALPQHLAAHPYSQPTLPLGPFANMIGYPFLPQSYAYMP-SFQQAFAGNSTYHQSLAAVLP  715

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A V SGYGAFG++ T+PG+F +N  AAPS T+LG DD LS+QYKD+
Sbjct  716   QYKNSVSVSSLPQSAAVASGYGAFGSSTTVPGNFTMNQPAAPSGTNLGYDDVLSAQYKDS  775

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HL+SLQQ ++SGMWLHG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQNY SLGY
Sbjct  776   NHLISLQQSDSSGMWLHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQNYGSLGY  835

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQTG+SLD  HQQQNPRDG L    G +Q QPK  SQQ+WQNSY
Sbjct  836   -PNFYHSQTGMSLD--HQQQNPRDGSL----GGSQGQPK-QSQQIWQNSY  877



>ref|XP_006355598.1| PREDICTED: signaling mucin HKR1-like [Solanum tuberosum]
Length=836

 Score =   314 bits (805),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 185/226 (82%), Gaps = 8/226 (4%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             +PQHLAVHPY+QPTLPLGPF N+ISYPFM QSYTYMP  FQQPFAGNS Y QSLAAVLP 
Sbjct  614   VPQHLAVHPYNQPTLPLGPFGNMISYPFMPQSYTYMPSAFQQPFAGNSNYHQSLAAVLPQ  673

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YKNSVSVSSLP  A+V S YG FGNT +IPG+FP+NPSAAPS T+L  DD LSSQYKD +
Sbjct  674   YKNSVSVSSLPQPASVASAYGGFGNTASIPGNFPMNPSAAPSGTNLSYDDMLSSQYKDTN  733

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  470
             HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ SGFRQ QQP QN+ SLGY 
Sbjct  734   HLMSLQQSENSAMWLHGPGSRTMSAVPANTYYAFQGQNQQSSGFRQAQQPLQNHGSLGY-  792

Query  469   PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  332
             PNFYHSQ GISL+  HQQQNPRD   G  GG +Q QPKP SQQLWQ
Sbjct  793   PNFYHSQAGISLE--HQQQNPRD---GSLGGGSQGQPKP-SQQLWQ  832



>gb|KDO78075.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
Length=250

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 186/232 (80%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  833
             ALP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VL
Sbjct  27    ALPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVL  86

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYK  659
             P YKNSVSVSSLP  A V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYK
Sbjct  87    PQYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYK  145

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  479
             DN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  146   DNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGAL  205

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  206   GY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  250



>gb|KDO78070.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78071.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78072.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78073.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
Length=304

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 186/232 (80%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  833
             ALP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VL
Sbjct  81    ALPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVL  140

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYK  659
             P YKNSVSVSSLP  A V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYK
Sbjct  141   PQYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYK  199

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  479
             DN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  200   DNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGAL  259

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  260   GY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  304



>ref|XP_007025176.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
 gb|EOY27798.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
Length=872

 Score =   301 bits (771),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 182/230 (79%), Gaps = 9/230 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHL +HP+SQPTLPLG FAN+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  651   ALPQHLPMHPFSQPTLPLGHFANMIGYPFLPQSYTYMPSAFQQAFAGNSTYPQSLAAVLP  710

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A V S YG FG++ +IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  711   QYKNSVSVSSLPQSAAVASAYG-FGSSTSIPGGLPLNPPTAPTGTTIGYDDVLSSQYKDS  769

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQPSQ++ +LGY
Sbjct  770   NHLMSLQQNENSAMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPSQHFGALGY  829

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQTG+S+D  HQQQNPRDG L       Q QP   +QQLWQNSY
Sbjct  830   -PNFYHSQTGVSMD--HQQQNPRDGSL----SGTQGQPSKQTQQLWQNSY  872



>ref|XP_006467531.1| PREDICTED: uncharacterized protein LOC102630898 isoform X2 [Citrus 
sinensis]
Length=854

 Score =   299 bits (766),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 186/232 (80%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  833
             ALP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VL
Sbjct  631   ALPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVL  690

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYK  659
             P YKNSVSVSSLP  A V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYK
Sbjct  691   PQYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYK  749

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  479
             DN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  750   DNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGAL  809

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  810   GY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  854



>ref|XP_006467530.1| PREDICTED: uncharacterized protein LOC102630898 isoform X1 [Citrus 
sinensis]
Length=869

 Score =   300 bits (767),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 186/232 (80%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  833
             ALP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VL
Sbjct  646   ALPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVL  705

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYK  659
             P YKNSVSVSSLP  A V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYK
Sbjct  706   PQYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYK  764

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  479
             DN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  765   DNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGAL  824

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  825   GY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  869



>ref|XP_006377248.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
 gb|ERP55045.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
Length=894

 Score =   300 bits (767),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 184/231 (80%), Gaps = 9/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  671   ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQTFAGNNSYHQSLAAVLP  730

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A V SGYG FG++ +IP G+FPLN   AP+ T++G DD L SQYKD
Sbjct  731   QYKNSVSVSSLPQSAAVASGYG-FGSSTSIPAGNFPLNAPTAPAGTTIGYDDILGSQYKD  789

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               HLMSLQQ ENS MWLHG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  790   ASHLMSLQQNENSAMWLHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALG  849

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  850   Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  894



>ref|XP_002317304.2| kinase-related family protein [Populus trichocarpa]
 gb|EEE97916.2| kinase-related family protein [Populus trichocarpa]
Length=909

 Score =   300 bits (767),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 184/231 (80%), Gaps = 9/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  686   ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQTFAGNNSYHQSLAAVLP  745

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLN-PSAAPSTSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A V SGYG FG++ +IP G+FPLN P+A   T++G DD L SQYKD
Sbjct  746   QYKNSVSVSSLPQSAAVASGYG-FGSSTSIPAGNFPLNAPTAPAGTTIGYDDILGSQYKD  804

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               HLMSLQQ ENS MWLHG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  805   ASHLMSLQQNENSAMWLHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALG  864

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  865   Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  909



>ref|XP_006449625.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62865.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=878

 Score =   298 bits (763),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 185/231 (80%), Gaps = 11/231 (5%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VLP  830
             LP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VLP
Sbjct  656   LPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVLP  715

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYKD
Sbjct  716   QYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKD  774

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             N+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  775   NNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALG  834

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  835   Y-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  878



>ref|XP_006449624.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62864.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=863

 Score =   297 bits (761),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 185/231 (80%), Gaps = 11/231 (5%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VLP  830
             LP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VLP
Sbjct  641   LPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVLP  700

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYKD
Sbjct  701   QYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKD  759

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             N+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  760   NNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALG  819

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  820   Y-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  863



>emb|CBI30819.3| unnamed protein product [Vitis vinifera]
Length=799

 Score =   294 bits (753),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 183/232 (79%), Gaps = 10/232 (4%)
 Frame = -1

Query  1009  ALPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  833
             ALPQHL  VHPYSQP LPLG FAN+I YPF+ QSYTYMP  +QQ FAGNSTY QSLAAVL
Sbjct  575   ALPQHLPPVHPYSQPGLPLGHFANMIGYPFLPQSYTYMPSAYQQAFAGNSTYHQSLAAVL  634

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKD  656
             P YKNSVSVSSLP  A + SGYGAFG++ +IPG+F LN P+AA  T++G DD ++SQYKD
Sbjct  635   PQYKNSVSVSSLPQSAAIASGYGAFGSSTSIPGNFSLNPPTAAAGTTIGYDDVINSQYKD  694

Query  655   NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  479
              +HL+SLQQ  ENS MW+HG GSRTMSA PANTYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  695   GNHLISLQQQNENSAMWVHGPGSRTMSAVPANTYYSFQGQNQQPGGFRQGQQPSQHFGAL  754

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+WQN+Y
Sbjct  755   GY-PNFYHSQAGISLE--HQQQNPRDGSL----SGSQGQASKQSQQIWQNNY  799



>ref|XP_008225365.1| PREDICTED: dentin sialophosphoprotein isoform X1 [Prunus mume]
Length=861

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 187/232 (81%), Gaps = 10/232 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  637   ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQTFAGNSTYHQSLAAVLP  696

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A +PSGYG FG++  IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  697   QYKNSVSVSSLPQSANIPSGYG-FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKD  755

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SL  479
             N HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +L
Sbjct  756   NSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGAL  815

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQQLWQN+Y
Sbjct  816   GYPPNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQQLWQNTY  861



>ref|XP_008225366.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Prunus mume]
Length=860

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 187/232 (81%), Gaps = 10/232 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  636   ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQTFAGNSTYHQSLAAVLP  695

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A +PSGYG FG++  IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  696   QYKNSVSVSSLPQSANIPSGYG-FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKD  754

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SL  479
             N HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +L
Sbjct  755   NSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGAL  814

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQQLWQN+Y
Sbjct  815   GYPPNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQQLWQNTY  860



>ref|XP_011005847.1| PREDICTED: uncharacterized protein LOC105112008 isoform X3 [Populus 
euphratica]
Length=869

 Score =   295 bits (754),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 185/231 (80%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVH YSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F+GN+TY QSLAAVLP
Sbjct  647   ALPQHLAVHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAFQQTFSGNNTYHQSLAAVLP  706

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A VPSGYG +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  707   QYKNSVSVSSLPQSAAVPSGYG-YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  765

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  766   ASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPG  825

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  826   Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNSY  869



>ref|XP_011005848.1| PREDICTED: uncharacterized protein LOC105112008 isoform X4 [Populus 
euphratica]
Length=868

 Score =   295 bits (754),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 185/231 (80%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVH YSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F+GN+TY QSLAAVLP
Sbjct  646   ALPQHLAVHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAFQQTFSGNNTYHQSLAAVLP  705

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A VPSGYG +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  706   QYKNSVSVSSLPQSAAVPSGYG-YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  764

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  765   ASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPG  824

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  825   Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNSY  868



>ref|XP_011005845.1| PREDICTED: uncharacterized protein LOC105112008 isoform X1 [Populus 
euphratica]
Length=875

 Score =   294 bits (753),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 185/231 (80%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVH YSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F+GN+TY QSLAAVLP
Sbjct  653   ALPQHLAVHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAFQQTFSGNNTYHQSLAAVLP  712

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A VPSGYG +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  713   QYKNSVSVSSLPQSAAVPSGYG-YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  771

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  772   ASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPG  831

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  832   Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNSY  875



>ref|XP_011045310.1| PREDICTED: uncharacterized protein LOC105140253 isoform X3 [Populus 
euphratica]
Length=841

 Score =   294 bits (752),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 183/231 (79%), Gaps = 9/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  618   ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQAFAGNNSYHQSLAAVLP  677

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLN-PSAAPSTSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A V SGYG FG++ ++P G+FPLN P+A   T+LG DD L SQYKD
Sbjct  678   QYKNSVSVSSLPQSAAVASGYG-FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKD  736

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  737   ASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALG  796

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  797   Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  841



>ref|XP_010655630.1| PREDICTED: protein lingerer-like [Vitis vinifera]
Length=886

 Score =   295 bits (754),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 183/232 (79%), Gaps = 10/232 (4%)
 Frame = -1

Query  1009  ALPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  833
             ALPQHL  VHPYSQP LPLG FAN+I YPF+ QSYTYMP  +QQ FAGNSTY QSLAAVL
Sbjct  662   ALPQHLPPVHPYSQPGLPLGHFANMIGYPFLPQSYTYMPSAYQQAFAGNSTYHQSLAAVL  721

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKD  656
             P YKNSVSVSSLP  A + SGYGAFG++ +IPG+F LN P+AA  T++G DD ++SQYKD
Sbjct  722   PQYKNSVSVSSLPQSAAIASGYGAFGSSTSIPGNFSLNPPTAAAGTTIGYDDVINSQYKD  781

Query  655   NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  479
              +HL+SLQQ  ENS MW+HG GSRTMSA PANTYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  782   GNHLISLQQQNENSAMWVHGPGSRTMSAVPANTYYSFQGQNQQPGGFRQGQQPSQHFGAL  841

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+WQN+Y
Sbjct  842   GY-PNFYHSQAGISLE--HQQQNPRDGSL----SGSQGQASKQSQQIWQNNY  886



>ref|XP_011005846.1| PREDICTED: uncharacterized protein LOC105112008 isoform X2 [Populus 
euphratica]
Length=874

 Score =   294 bits (753),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 185/231 (80%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVH YSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F+GN+TY QSLAAVLP
Sbjct  652   ALPQHLAVHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAFQQTFSGNNTYHQSLAAVLP  711

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A VPSGYG +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  712   QYKNSVSVSSLPQSAAVPSGYG-YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  770

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  771   ASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPG  830

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  831   Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNSY  874



>ref|XP_012091905.1| PREDICTED: uncharacterized protein LOC105649755 [Jatropha curcas]
 gb|KDP21205.1| hypothetical protein JCGZ_21676 [Jatropha curcas]
Length=866

 Score =   294 bits (753),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 183/230 (80%), Gaps = 10/230 (4%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQHLAVHPYSQPTLPLGPF N+I YPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP 
Sbjct  645   LPQHLAVHPYSQPTLPLGPFTNMIGYPFLPQSYTYMPSAFQQTFAGNNTYHQSLAAVLPQ  704

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKDN  653
             YKNSVSVSSLP  A V S YG FG++ +IP G+FPLNP AAP  T+LG DD LSSQYKD 
Sbjct  705   YKNSVSVSSLPQSAAVASAYG-FGSSTSIPAGNFPLNPPAAPGGTTLGYDDVLSSQYKDG  763

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQ SQ++ +LGY
Sbjct  764   NHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQLSQHFGALGY  823

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PN+YHSQTGISL+  HQQQN RD  L    G +Q QP   +QQLWQNSY
Sbjct  824   -PNYYHSQTGISLE--HQQQNSRDASL----GGSQGQPSKQTQQLWQNSY  866



>ref|XP_011045309.1| PREDICTED: uncharacterized protein LOC105140253 isoform X2 [Populus 
euphratica]
Length=871

 Score =   294 bits (752),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 183/231 (79%), Gaps = 9/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  648   ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQAFAGNNSYHQSLAAVLP  707

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLN-PSAAPSTSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A V SGYG FG++ ++P G+FPLN P+A   T+LG DD L SQYKD
Sbjct  708   QYKNSVSVSSLPQSAAVASGYG-FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKD  766

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  767   ASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALG  826

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  827   Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  871



>ref|XP_011045308.1| PREDICTED: uncharacterized protein LOC105140253 isoform X1 [Populus 
euphratica]
Length=872

 Score =   293 bits (751),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 183/231 (79%), Gaps = 9/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  649   ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQAFAGNNSYHQSLAAVLP  708

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLN-PSAAPSTSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A V SGYG FG++ ++P G+FPLN P+A   T+LG DD L SQYKD
Sbjct  709   QYKNSVSVSSLPQSAAVASGYG-FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKD  767

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  768   ASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALG  827

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  828   Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  872



>gb|KHF99174.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=869

 Score =   293 bits (750),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 184/232 (79%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GN+ Y QSLAA+LP
Sbjct  646   ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFTGNNNYPQSLAAMLP  705

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A +PSGYG FG++  IPG  PLNP  AP+ T++G +D LSSQYKDN
Sbjct  706   QYKNSVSVSSLPQSAAIPSGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYEDVLSSQYKDN  764

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP-SQNYASLG  476
             +HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQP SQ++ SLG
Sbjct  765   NHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLG  824

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ-PKPSSQQLWQNSY  323
             Y PNFYHSQTG+SLD   QQQNPRDG L      +Q Q P   +QQLWQN+Y
Sbjct  825   Y-PNFYHSQTGVSLD--PQQQNPRDGSL----SGSQGQPPSKQTQQLWQNNY  869



>gb|KJB69763.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=869

 Score =   291 bits (745),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 182/232 (78%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+ QPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GNS Y QSLAA+LP
Sbjct  646   ALPQHLAMHPFPQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFTGNSNYPQSLAAMLP  705

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A +PSGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKDN
Sbjct  706   QYKNSVSVSSLPQSAAIPSGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDVLSSQYKDN  764

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ-PSQNYASLG  476
             +HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQ PSQ++ SLG
Sbjct  765   NHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLG  824

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ-PKPSSQQLWQNSY  323
             Y PNFYHSQ G+SLD   QQQNPRDG L      +Q Q P   +QQLWQN+Y
Sbjct  825   Y-PNFYHSQMGVSLD--PQQQNPRDGSL----SGSQGQPPSKQTQQLWQNNY  869



>gb|KJB69765.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=867

 Score =   291 bits (745),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 182/232 (78%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+ QPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GNS Y QSLAA+LP
Sbjct  644   ALPQHLAMHPFPQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFTGNSNYPQSLAAMLP  703

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A +PSGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKDN
Sbjct  704   QYKNSVSVSSLPQSAAIPSGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDVLSSQYKDN  762

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ-PSQNYASLG  476
             +HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQ PSQ++ SLG
Sbjct  763   NHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLG  822

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ-PKPSSQQLWQNSY  323
             Y PNFYHSQ G+SLD   QQQNPRDG L      +Q Q P   +QQLWQN+Y
Sbjct  823   Y-PNFYHSQMGVSLD--PQQQNPRDGSL----SGSQGQPPSKQTQQLWQNNY  867



>ref|XP_004232971.1| PREDICTED: uncharacterized protein LOC101252351 [Solanum lycopersicum]
Length=833

 Score =   289 bits (740),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 179/226 (79%), Gaps = 11/226 (5%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             +PQHLAVHPY+QP  PLGPFAN+I YPF+ QSYTYMP  FQQPFAGNS Y QSLAAVLP 
Sbjct  614   VPQHLAVHPYNQP--PLGPFANMIGYPFLPQSYTYMPSAFQQPFAGNSNYHQSLAAVLPQ  671

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YKNSVSVSSLP  A+V S YG FGNT +IPG+FP+NP AAPS T+L  DD LSSQYKD +
Sbjct  672   YKNSVSVSSLPQPASVASAYGGFGNTASIPGNFPMNPPAAPSGTNLSYDDVLSSQYKDTN  731

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  470
             HLMSLQQ ENS MW HG GSRTMSA PANTYY  Q QNQQ SGFRQ QQP QN+ SLGY 
Sbjct  732   HLMSLQQSENSAMW-HGPGSRTMSAVPANTYYGFQGQNQQSSGFRQAQQPLQNHGSLGY-  789

Query  469   PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  332
             PNFYHSQ GISL+  HQQQNPRD   G  GG +Q QPK   QQLWQ
Sbjct  790   PNFYHSQAGISLE--HQQQNPRD---GSLGGGSQGQPK-QFQQLWQ  829



>gb|KHN48057.1| hypothetical protein glysoja_015527 [Glycine soja]
Length=817

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 184/232 (79%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG FAN+I Y F+ QSYTYMP  FQQ F GNSTY QSLAA+LP
Sbjct  594   ALPQHLAVHPYSQPTLPLGHFANMIGYQFLPQSYTYMPSAFQQAFPGNSTYHQSLAAMLP  653

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKD  656
              YKNS+SVSSLP  A V SGYG FG++ +IP G++PLNP AAP ST++G DD ++SQYKD
Sbjct  654   QYKNSISVSSLPQSAAVASGYG-FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQYKD  712

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS-QNYASL  479
             N+H++SLQQ ENS MW+HG  SRTMSA PANTYY+ Q QNQQP GFRQ QQPS Q++ SL
Sbjct  713   NNHMISLQQNENSPMWVHGPSSRTMSAIPANTYYSFQGQNQQPGGFRQNQQPSQQHFGSL  772

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQTGISL+  HQQQNPR+  L      +Q QP   S Q+WQNSY
Sbjct  773   GY-PNFYHSQTGISLE--HQQQNPREASL----AGSQTQPPKQSPQIWQNSY  817



>ref|XP_007214618.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
 gb|EMJ15817.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
Length=859

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 186/232 (80%), Gaps = 11/232 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  636   ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQTFAGNSTYHQSLAAVLP  695

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A +P GYG FG++  IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  696   QYKNSVSVSSLPQSANIPPGYG-FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKD  754

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SL  479
             N HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +L
Sbjct  755   NSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGAL  814

Query  478   GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             GY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQQLWQN+Y
Sbjct  815   GY-PNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQQLWQNTY  859



>ref|XP_011096496.1| PREDICTED: uncharacterized protein LOC105175670 isoform X1 [Sesamum 
indicum]
Length=843

 Score =   288 bits (737),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 177/230 (77%), Gaps = 12/230 (5%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQHLAVHPYSQPTLPLGPF N+I YPF+ QSYTYMP  FQQ F+GNSTY QSLAA+LP 
Sbjct  624   LPQHLAVHPYSQPTLPLGPFTNMIGYPFLPQSYTYMPSAFQQTFSGNSTYHQSLAALLPQ  683

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YKN+VS SSLP  A + SGYGAFGNT TIPG+FP+NP A PS T+L  DD L+SQYKD+ 
Sbjct  684   YKNNVSASSLPQSAAIASGYGAFGNTPTIPGNFPMNPPAGPSGTTLSYDDVLNSQYKDSS  743

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNYASLGY  473
             HL+SLQQ EN  +WLHG  SRTMSA PA+TYYN      Q   G RQ QQPSQNY SLGY
Sbjct  744   HLVSLQQNENPALWLHGANSRTMSAVPASTYYNYQGQNQQTGGGMRQAQQPSQNYGSLGY  803

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQTGI+LD   QQQNPRD PL    G +Q QPK S  Q+WQNSY
Sbjct  804   -PNFYHSQTGIALD---QQQNPRDAPL----GGSQGQPKQS--QIWQNSY  843



>ref|XP_011096498.1| PREDICTED: uncharacterized protein LOC105175670 isoform X2 [Sesamum 
indicum]
Length=842

 Score =   288 bits (737),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 177/230 (77%), Gaps = 12/230 (5%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQHLAVHPYSQPTLPLGPF N+I YPF+ QSYTYMP  FQQ F+GNSTY QSLAA+LP 
Sbjct  623   LPQHLAVHPYSQPTLPLGPFTNMIGYPFLPQSYTYMPSAFQQTFSGNSTYHQSLAALLPQ  682

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YKN+VS SSLP  A + SGYGAFGNT TIPG+FP+NP A PS T+L  DD L+SQYKD+ 
Sbjct  683   YKNNVSASSLPQSAAIASGYGAFGNTPTIPGNFPMNPPAGPSGTTLSYDDVLNSQYKDSS  742

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNYASLGY  473
             HL+SLQQ EN  +WLHG  SRTMSA PA+TYYN      Q   G RQ QQPSQNY SLGY
Sbjct  743   HLVSLQQNENPALWLHGANSRTMSAVPASTYYNYQGQNQQTGGGMRQAQQPSQNYGSLGY  802

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQTGI+LD   QQQNPRD PL    G +Q QPK S  Q+WQNSY
Sbjct  803   -PNFYHSQTGIALD---QQQNPRDAPL----GGSQGQPKQS--QIWQNSY  842



>ref|XP_006369885.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
 gb|ERP66454.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
Length=867

 Score =   288 bits (736),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 184/231 (80%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+H YSQPTLPLG FAN+ISYPF+ QSYTYMP  +QQ F+GN+TY QSLAAVLP
Sbjct  645   ALPQHLAMHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAYQQTFSGNNTYHQSLAAVLP  704

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A VPSGYG +G++ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  705   QYKNSVSVSSLPQSAAVPSGYG-YGSSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  763

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
               HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  764   ASHLISLQQNENSAMWMHGPGSRTMSAVPASTYYNFQGQNQQPGVFRQGQQPSQHFGAPG  823

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQN Y
Sbjct  824   Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNGY  867



>gb|KHF99173.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=891

 Score =   284 bits (726),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GN+ Y QSLAA+LP
Sbjct  646   ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFTGNNNYPQSLAAMLP  705

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A +PSGYG FG++  IPG  PLNP  AP+ T++G +D LSSQYKDN
Sbjct  706   QYKNSVSVSSLPQSAAIPSGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYEDVLSSQYKDN  764

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP-SQNYASLG  476
             +HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQP SQ++ SLG
Sbjct  765   NHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLG  824

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPL  392
             Y PNFYHSQTG+SLD   QQQNPRDG L
Sbjct  825   Y-PNFYHSQTGVSLD--PQQQNPRDGSL  849



>ref|XP_009790935.1| PREDICTED: uncharacterized protein LOC104238306 [Nicotiana sylvestris]
Length=852

 Score =   280 bits (715),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 177/231 (77%), Gaps = 6/231 (3%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHL VHPY+Q T+PLGPFAN+ISYPFMHQ+Y +MP  FQQ F GNSTY QSLAA+LP
Sbjct  626   AVPQHLTVHPYAQQTVPLGPFANMISYPFMHQNYPFMPSAFQQAFPGNSTYHQSLAAMLP  685

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNS SV SLP  A++PSGYGAFGNT  IPG+F +NP+AAPS T+L  DD LSSQYKD 
Sbjct  686   QYKNSASVDSLPQSASIPSGYGAFGNTTAIPGNFTINPAAAPSGTNLSYDDVLSSQYKDT  745

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLG  476
             +HLMSLQQ ENS +W HG GSRTMSA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SL 
Sbjct  746   NHLMSLQQSENSALWHHGLGSRTMSAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLA  805

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
               P+FY+SQ GISLD   QQQN RD         +Q QPK S QQ+WQN Y
Sbjct  806   GYPHFYNSQAGISLD-QQQQQNLRDA---ASLAGSQGQPKQSQQQIWQNGY  852



>ref|XP_004134562.1| PREDICTED: uncharacterized protein LOC101211388 isoform X2 [Cucumis 
sativus]
Length=845

 Score =   279 bits (714),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 181/231 (78%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  623   AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  682

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNS+SVSSLP  A + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  683   QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  741

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  742   SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  801

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  802   Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  845



>ref|XP_011658276.1| PREDICTED: uncharacterized protein LOC101211388 isoform X1 [Cucumis 
sativus]
Length=846

 Score =   279 bits (714),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 181/231 (78%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  624   AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  683

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNS+SVSSLP  A + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  684   QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  742

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  743   SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  802

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  803   Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  846



>ref|XP_008439672.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Cucumis melo]
Length=847

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 181/231 (78%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  625   AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  684

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNS+SVSSLP  A + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  685   QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  743

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  744   SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  803

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  804   Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  847



>ref|XP_008439673.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
Length=846

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 181/231 (78%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  624   AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  683

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNS+SVSSLP  A + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  684   QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  742

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  743   SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  802

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  803   Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  846



>ref|XP_006356118.1| PREDICTED: cell wall protein AWA1-like [Solanum tuberosum]
Length=845

 Score =   279 bits (713),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 176/229 (77%), Gaps = 6/229 (3%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             +PQHL VH YSQ  +P+ PF N+ISYPF+HQ+Y+YMP  FQQ + GNS+Y QSLAA+LP 
Sbjct  622   VPQHLTVHQYSQQAVPIAPFGNMISYPFVHQNYSYMPSAFQQAYPGNSSYHQSLAAMLPQ  681

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YKN+VS SSLP  A +PSGYGAFGNT  IPG+FP+NP AAPS T+L  DD LS+Q+KD +
Sbjct  682   YKNTVSASSLPQSAAIPSGYGAFGNTTNIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTN  741

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  470
             HLMSLQQ ENS +WLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  
Sbjct  742   HLMSLQQNENSALWLHGPGSRTMSAVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGY  801

Query  469   PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             P+FY+SQ GISLD   QQQN RDG L      +Q QPK S QQLWQN Y
Sbjct  802   PHFYNSQAGISLD-QQQQQNLRDGSL----SGSQGQPKQSQQQLWQNGY  845



>gb|KGN49366.1| hypothetical protein Csa_6G522110 [Cucumis sativus]
Length=905

 Score =   279 bits (714),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 181/231 (78%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  683   AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  742

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNS+SVSSLP  A + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  743   QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  801

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  802   SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  861

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  862   Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  905



>ref|XP_011460396.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101310004 
[Fragaria vesca subsp. vesca]
Length=841

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 183/233 (79%), Gaps = 12/233 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHL +HPYSQP+LPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  617   ALPQHL-MHPYSQPSLPLGHFSNMIGYPFLPQSYTYMPSAFQQAFAGNSTYHQSLAAVLP  675

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A VPSGYG FG++ +IP G+FPLNP +AP+ T++G DD +SSQYKD
Sbjct  676   QYKNSVSVSSLPQSANVPSGYG-FGSSTSIPGGNFPLNPPSAPTGTTIGYDDVISSQYKD  734

Query  655   NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  479
             ++HLMSLQQ  +NSGMW+HG GSR M A PA+ YY+ Q QNQQ +GFRQ QQPSQ +A  
Sbjct  735   SNHLMSLQQQNDNSGMWVHGPGSRAMPAVPASNYYSFQGQNQQHAGFRQTQQPSQQFAGA  794

Query  478   GYN-PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
               N PNFYHSQTG+SLD  HQQQ+ RD  L    G +Q QP   SQQLWQNSY
Sbjct  795   ALNYPNFYHSQTGMSLD--HQQQSSRDASL----GGSQGQPSKQSQQLWQNSY  841



>ref|XP_009618328.1| PREDICTED: uncharacterized protein LOC104110515 isoform X2 [Nicotiana 
tomentosiformis]
Length=845

 Score =   275 bits (703),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHL VHPY+QPT+PLGPFAN+ISYPFMHQ+Y YMP  FQQ F GNSTY QSLAA+LP
Sbjct  619   AVPQHLTVHPYAQPTVPLGPFANMISYPFMHQNYPYMPSAFQQAFPGNSTYHQSLAAMLP  678

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNS SV SLP  A++PSGYGAFGNT  IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  679   QYKNSASVDSLPQSASIPSGYGAFGNTTAIPGNFPINPAAAPSGTNLSYDDVLSSQYKDT  738

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLG  476
             +HLMSLQQ ENS +W HG GSRT+SA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SLG
Sbjct  739   NHLMSLQQSENSALWHHGLGSRTISAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLG  798

Query  475   YNPNFYHSQTGIS  437
               P+FY+SQ GIS
Sbjct  799   GYPHFYNSQAGIS  811



>ref|XP_009618326.1| PREDICTED: uncharacterized protein LOC104110515 isoform X1 [Nicotiana 
tomentosiformis]
Length=852

 Score =   275 bits (703),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQHL VHPY+QPT+PLGPFAN+ISYPFMHQ+Y YMP  FQQ F GNSTY QSLAA+LP
Sbjct  626   AVPQHLTVHPYAQPTVPLGPFANMISYPFMHQNYPYMPSAFQQAFPGNSTYHQSLAAMLP  685

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNS SV SLP  A++PSGYGAFGNT  IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  686   QYKNSASVDSLPQSASIPSGYGAFGNTTAIPGNFPINPAAAPSGTNLSYDDVLSSQYKDT  745

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLG  476
             +HLMSLQQ ENS +W HG GSRT+SA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SLG
Sbjct  746   NHLMSLQQSENSALWHHGLGSRTISAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLG  805

Query  475   YNPNFYHSQTGIS  437
               P+FY+SQ GIS
Sbjct  806   GYPHFYNSQAGIS  818



>ref|XP_007159534.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
 gb|ESW31528.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
Length=847

 Score =   275 bits (702),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 182/229 (79%), Gaps = 11/229 (5%)
 Frame = -1

Query  1000 QHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYK  821
            QHLA+HPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAA+LP YK
Sbjct  627  QHLALHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQAFAGNNTYHQSLAAMLPQYK  686

Query  820  NSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKDNHH  647
            NS+SVSSLP  A V SGYG FG++ +IP G++PLNP AAP ST++G DD ++SQYKDN+H
Sbjct  687  NSISVSSLPQSAAVASGYG-FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQYKDNNH  745

Query  646  LMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQV-QQPSQNYASLGYN  470
            ++SLQQ ENS MW+HG  SRTMSA P +TYY+ Q QNQQ  GFRQ  QQPSQ++ SLGY 
Sbjct  746  MISLQQNENSPMWVHGPSSRTMSAVPPSTYYSFQGQNQQAGGFRQSPQQPSQHFGSLGY-  804

Query  469  PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
            PNFYHSQ+G+SL+  H QQNPR+  L    G +Q QP   + Q+WQNSY
Sbjct  805  PNFYHSQSGVSLE--HPQQNPREATL----GGSQSQPPKQTPQIWQNSY  847



>ref|XP_010317412.1| PREDICTED: uncharacterized protein LOC101266097 isoform X2 [Solanum 
lycopersicum]
Length=822

 Score =   274 bits (700),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 176/229 (77%), Gaps = 6/229 (3%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             +PQHL VH YSQ  +P+ P+ N+ISYPF+ Q+Y+Y+P  FQQ + GNS+Y QSLAA+LP 
Sbjct  599   VPQHLTVHQYSQQAVPIAPYGNMISYPFVPQNYSYIPSAFQQAYPGNSSYHQSLAAMLPQ  658

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YKN+VS SSLP  AT+PSGYGAFGNT +IPG+FP+NP AAPS T+L  DD LS+Q+KD +
Sbjct  659   YKNTVSASSLPQSATIPSGYGAFGNTTSIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTN  718

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  470
             HLMSLQQ ENS +WLHGHGSRTM   PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  
Sbjct  719   HLMSLQQNENSALWLHGHGSRTMPTVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGY  778

Query  469   PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             P+FY+SQ GISLD   QQ+N RDG L      +Q QPK S QQLWQN Y
Sbjct  779   PHFYNSQAGISLD-QQQQENLRDGSL----SGSQGQPKQSQQQLWQNGY  822



>ref|XP_004234052.1| PREDICTED: uncharacterized protein LOC101266097 isoform X1 [Solanum 
lycopersicum]
Length=843

 Score =   274 bits (700),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 176/229 (77%), Gaps = 6/229 (3%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             +PQHL VH YSQ  +P+ P+ N+ISYPF+ Q+Y+Y+P  FQQ + GNS+Y QSLAA+LP 
Sbjct  620   VPQHLTVHQYSQQAVPIAPYGNMISYPFVPQNYSYIPSAFQQAYPGNSSYHQSLAAMLPQ  679

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YKN+VS SSLP  AT+PSGYGAFGNT +IPG+FP+NP AAPS T+L  DD LS+Q+KD +
Sbjct  680   YKNTVSASSLPQSATIPSGYGAFGNTTSIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTN  739

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  470
             HLMSLQQ ENS +WLHGHGSRTM   PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  
Sbjct  740   HLMSLQQNENSALWLHGHGSRTMPTVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGY  799

Query  469   PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             P+FY+SQ GISLD   QQ+N RDG L      +Q QPK S QQLWQN Y
Sbjct  800   PHFYNSQAGISLD-QQQQENLRDGSL----SGSQGQPKQSQQQLWQNGY  843



>ref|XP_002519742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42715.1| conserved hypothetical protein [Ricinus communis]
Length=849

 Score =   273 bits (699),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 177/230 (77%), Gaps = 18/230 (8%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             AL QHLAVHPYSQPTLPLGPFAN+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  637   ALQQHLAVHPYSQPTLPLGPFANMIGYPFLPQSYTYMPSAFQQTFAGNSTYHQSLAAVLP  696

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNH  650
              YKNSVSV+SLP  A V S YG FG++ ++P         A  T++G DDGLSSQYKD +
Sbjct  697   QYKNSVSVTSLPQSAAVASAYG-FGSSTSVP---------AGGTTIGYDDGLSSQYKDGN  746

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS-QNYASLGY  473
             HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP+G+RQ QQ S Q++ +LGY
Sbjct  747   HLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPAGYRQGQQLSQQHFGALGY  806

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PN+YHSQTGISL+   QQQN R+G L    G +Q QP   +QQLWQNSY
Sbjct  807   -PNYYHSQTGISLE--LQQQNSREGSL----GGSQGQPSKQTQQLWQNSY  849



>ref|XP_010275810.1| PREDICTED: uncharacterized protein LOC104610735 isoform X2 [Nelumbo 
nucifera]
Length=889

 Score =   273 bits (699),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 176/238 (74%), Gaps = 16/238 (7%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
             ALPQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP  FQQ +AGNS Y QS AAV  
Sbjct  659   ALPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSAFQQAYAGNSAYHQSPAAVHS  718

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDG  677
                   LP YKNSVSVSSLP  A V SGYG FGN+  IPG+FPLNPS+ P ST++G DD 
Sbjct  719   AGVKYTLPQYKNSVSVSSLPQSAAVASGYGGFGNSTNIPGNFPLNPSSTPASTTIGYDDV  778

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             +SSQYKD +  + LQQ ENSGMW+HG GSRTMSA P +TYY+ Q Q+QQ  GFRQ QQPS
Sbjct  779   ISSQYKDGNQFIPLQQNENSGMWVHGLGSRTMSALPGSTYYSFQGQSQQHGGFRQGQQPS  838

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Q+Y +LGY PNFY SQTG+S    H QQNP DG LGG  G +  Q    S Q+WQ++Y
Sbjct  839   QHYGALGY-PNFYQSQTGVS--QEHPQQNPNDGTLGGSQGASAKQ----SHQIWQHNY  889



>ref|XP_010275801.1| PREDICTED: uncharacterized protein LOC104610735 isoform X1 [Nelumbo 
nucifera]
Length=907

 Score =   273 bits (699),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 176/238 (74%), Gaps = 16/238 (7%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
             ALPQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP  FQQ +AGNS Y QS AAV  
Sbjct  677   ALPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSAFQQAYAGNSAYHQSPAAVHS  736

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDG  677
                   LP YKNSVSVSSLP  A V SGYG FGN+  IPG+FPLNPS+ P ST++G DD 
Sbjct  737   AGVKYTLPQYKNSVSVSSLPQSAAVASGYGGFGNSTNIPGNFPLNPSSTPASTTIGYDDV  796

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             +SSQYKD +  + LQQ ENSGMW+HG GSRTMSA P +TYY+ Q Q+QQ  GFRQ QQPS
Sbjct  797   ISSQYKDGNQFIPLQQNENSGMWVHGLGSRTMSALPGSTYYSFQGQSQQHGGFRQGQQPS  856

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Q+Y +LGY PNFY SQTG+S    H QQNP DG LGG  G +  Q    S Q+WQ++Y
Sbjct  857   QHYGALGY-PNFYQSQTGVS--QEHPQQNPNDGTLGGSQGASAKQ----SHQIWQHNY  907



>gb|EYU28172.1| hypothetical protein MIMGU_mgv1a001362mg [Erythranthe guttata]
Length=833

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 180/238 (76%), Gaps = 17/238 (7%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQHLAVHPYSQ TLPLGPF N+I YPF+ QSYTY+P  FQQ FAGNSTY QSLAA+LP 
Sbjct  603   LPQHLAVHPYSQHTLPLGPFTNMIGYPFLPQSYTYVPSAFQQTFAGNSTYHQSLAALLPQ  662

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YKNS+S  SLP  A +PSGYGAFGNT T+PG+F +NP AAP+  +L  DD LSSQYKDN 
Sbjct  663   YKNSISAGSLPQSAAIPSGYGAFGNTTTVPGNFQMNPPAAPTGATLSYDDVLSSQYKDNS  722

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  470
             HL+SLQQ ENS MWLHG  SRTMSA PA+TYYN Q Q+QQ  GFRQ QQPSQNY +LGY 
Sbjct  723   HLVSLQQNENSAMWLHGPNSRTMSAVPASTYYNYQGQSQQGGGFRQGQQPSQNYGALGY-  781

Query  469   PNFYHSQTGISLD---------HHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PNFYHSQTG+SLD            QQQN RDG L    G AQ QPK S  Q+WQN+Y
Sbjct  782   PNFYHSQTGMSLDQQQQQQQQQQQQQQQNARDGSL----GGAQGQPKQS--QIWQNNY  833



>ref|XP_006580202.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=845

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 186/235 (79%), Gaps = 14/235 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GNSTY QSLAA+LP
Sbjct  619   ALPQHLAVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQAFPGNSTYHQSLAAMLP  678

Query  829   NYKNSVSVSSLPH---FATVPSGYGAFGNTGTIPG-SFPLNPSAAP-STSLGIDDGLSSQ  665
              YKNS+SVSSLP     A V SGYG FG++ +IPG ++PLNP AAP ST++G DD ++SQ
Sbjct  679   QYKNSISVSSLPQSAAAAAVASGYG-FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQ  737

Query  664   YKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ-NY  488
             +K+N+H++SLQQ ENS MW+HG  SRTMSA P +TYY+ Q QNQQP GFRQ QQPSQ ++
Sbjct  738   FKENNHIISLQQNENSPMWVHGPSSRTMSAVPPSTYYSFQGQNQQPGGFRQSQQPSQQHF  797

Query  487   ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              SLGY PNFYHSQTGISL+  HQQQNPR+  L      +Q QP   SQQ+WQNSY
Sbjct  798   GSLGY-PNFYHSQTGISLE--HQQQNPREASL----AGSQSQPPKQSQQIWQNSY  845



>ref|XP_010243690.1| PREDICTED: uncharacterized protein LOC104587685 isoform X2 [Nelumbo 
nucifera]
Length=855

 Score =   267 bits (683),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 170/237 (72%), Gaps = 16/237 (7%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LPQHL VHPYSQP LPLG FANII YPF+ QSYTYMP  +QQ +AGN+ YQQS AAV   
Sbjct  626   LPQHLTVHPYSQPALPLGHFANIIGYPFLPQSYTYMPSAYQQAYAGNNAYQQSPAAVHNT  685

Query  835   -----LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGL  674
                  LP YKNSVS SSLPH   V SGYG FGN+  IPGSFPLNPS+ P ST++G DD +
Sbjct  686   GVKYTLPQYKNSVSASSLPHSTAVASGYGGFGNSTNIPGSFPLNPSSTPASTTIGYDDVI  745

Query  673   SSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ  494
             SSQYKD +H + LQQ +NS MW+HG GSRTMSA PA+TYY+ Q Q+QQ  GFRQ QQPSQ
Sbjct  746   SSQYKDGNHFIPLQQNDNSAMWVHGPGSRTMSALPASTYYSFQGQSQQHGGFRQAQQPSQ  805

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +Y +LGY PNFY SQ  +S    H QQNP DG L      +Q  P   S Q+WQ++Y
Sbjct  806   HYGALGY-PNFYQSQPRVS--QEHPQQNPNDGTL----AGSQGVPTKQSHQIWQHNY  855



>ref|XP_010243689.1| PREDICTED: uncharacterized protein LOC104587685 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   268 bits (684),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 170/237 (72%), Gaps = 16/237 (7%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LPQHL VHPYSQP LPLG FANII YPF+ QSYTYMP  +QQ +AGN+ YQQS AAV   
Sbjct  646   LPQHLTVHPYSQPALPLGHFANIIGYPFLPQSYTYMPSAYQQAYAGNNAYQQSPAAVHNT  705

Query  835   -----LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGL  674
                  LP YKNSVS SSLPH   V SGYG FGN+  IPGSFPLNPS+ P ST++G DD +
Sbjct  706   GVKYTLPQYKNSVSASSLPHSTAVASGYGGFGNSTNIPGSFPLNPSSTPASTTIGYDDVI  765

Query  673   SSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ  494
             SSQYKD +H + LQQ +NS MW+HG GSRTMSA PA+TYY+ Q Q+QQ  GFRQ QQPSQ
Sbjct  766   SSQYKDGNHFIPLQQNDNSAMWVHGPGSRTMSALPASTYYSFQGQSQQHGGFRQAQQPSQ  825

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +Y +LGY PNFY SQ  +S    H QQNP DG L      +Q  P   S Q+WQ++Y
Sbjct  826   HYGALGY-PNFYQSQPRVS--QEHPQQNPNDGTL----AGSQGVPTKQSHQIWQHNY  875



>ref|XP_011085623.1| PREDICTED: uncharacterized protein LOC105167549 [Sesamum indicum]
Length=848

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 179/229 (78%), Gaps = 11/229 (5%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQHLAVHPYSQPTLPLGPFAN+I YPF+ QSYTYMP  FQQ FAG+STY QSLAAVLP 
Sbjct  630   LPQHLAVHPYSQPTLPLGPFANMIGYPFLPQSYTYMPSAFQQSFAGSSTYHQSLAAVLPQ  689

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             YK+SVSVSSLP  A V SGYGAFG+T TI G++P+NP AAPS T+L  DD LSSQYKD+ 
Sbjct  690   YKSSVSVSSLPQSAAVASGYGAFGSTATIAGNYPMNPPAAPSGTTLSYDDVLSSQYKDSS  749

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  470
              L+SLQQ ENS MWLHG  SRTM A PA+TYYN Q QNQQP GFRQ QQ SQ+Y S GY 
Sbjct  750   QLLSLQQNENSAMWLHGPNSRTMPAVPASTYYNYQGQNQQPGGFRQGQQQSQSYGSPGY-  808

Query  469   PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PNFYHSQTGI LD   QQQNPRDG +      +Q QPK S  Q+W NSY
Sbjct  809   PNFYHSQTGILLD---QQQNPRDGSI----AGSQGQPKQS--QIWPNSY  848



>gb|KHG18569.1| Protein translocase subunit SecA [Gossypium arboreum]
Length=851

 Score =   267 bits (682),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 178/230 (77%), Gaps = 9/230 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGNS Y QSLAAVLP
Sbjct  630   ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQGFAGNSNYPQSLAAVLP  689

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  690   QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  748

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  GFRQ QQPSQ + +LGY
Sbjct  749   NHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGGFRQGQQPSQQFGALGY  808

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQLWQN+Y
Sbjct  809   -PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQLWQNNY  851



>gb|KJB57294.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=722

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 179/230 (78%), Gaps = 9/230 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTY+P  FQQ FAGNS Y QSLAAVLP
Sbjct  501   ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYVPSAFQQGFAGNSNYPQSLAAVLP  560

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  561   QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  619

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY
Sbjct  620   NHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY  679

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQLWQN+Y
Sbjct  680   -PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQLWQNNY  722



>gb|KJB57297.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57298.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=761

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 179/230 (78%), Gaps = 9/230 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTY+P  FQQ FAGNS Y QSLAAVLP
Sbjct  540   ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYVPSAFQQGFAGNSNYPQSLAAVLP  599

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  600   QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  658

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY
Sbjct  659   NHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY  718

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQLWQN+Y
Sbjct  719   -PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQLWQNNY  761



>gb|KJB57295.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57300.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=869

 Score =   265 bits (677),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 179/230 (78%), Gaps = 9/230 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTY+P  FQQ FAGNS Y QSLAAVLP
Sbjct  648   ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYVPSAFQQGFAGNSNYPQSLAAVLP  707

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  708   QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  766

Query  652   HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  473
             +HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY
Sbjct  767   NHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY  826

Query  472   NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQLWQN+Y
Sbjct  827   -PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQLWQNNY  869



>ref|XP_008358625.1| PREDICTED: cell wall protein RBR3-like [Malus domestica]
Length=312

 Score =   250 bits (638),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 184/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  82    ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  141

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVS SSLP  A +P GYG F ++ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  142   QYKNSVSASSLPQSANIPPGYG-FSSSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  200

Query  655   NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  488
             N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q  QPSQ Y
Sbjct  201   NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPQPSQQY  260

Query  487   A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  323
             A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQN+Y
Sbjct  261   AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNNY  312



>ref|XP_003629905.1| hypothetical protein MTR_8g088190 [Medicago truncatula]
 gb|AET04381.1| plant/F15D2-27 protein [Medicago truncatula]
Length=865

 Score =   260 bits (665),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 180/233 (77%), Gaps = 15/233 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             +LPQHLAVHPYSQ    LGPFAN+ISYPFM QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  644   SLPQHLAVHPYSQ----LGPFANMISYPFMPQSYTYMPSAFQQAFAGNSTYHQSLAAVLP  699

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKD  656
              YKNS+SVSSLP  A +PSGYG FG++ +IP G++PLNPSAAP ST++G DD ++SQYKD
Sbjct  700   QYKNSISVSSLPQSAAIPSGYG-FGSSTSIPGGNYPLNPSAAPTSTTIGYDDVINSQYKD  758

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQN-QQPSGFRQVQQPS-QNYAS  482
             N+H++SLQQ EN+ MW+ G GSRTMS  P+ TYY+ Q QN QQP  FRQ QQPS Q++A 
Sbjct  759   NNHMISLQQNENNPMWVQGPGSRTMSVPPS-TYYSFQGQNQQQPGAFRQSQQPSQQHFAP  817

Query  481   LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              GY  NFYHSQ+GISL+  HQQQNPRD  L G       Q   S QQLWQNSY
Sbjct  818   HGYPNNFYHSQSGISLE--HQQQNPRDASLAGSQSQPPKQ---SQQQLWQNSY  865



>ref|XP_008364175.1| PREDICTED: uncharacterized protein LOC103427870 isoform X2 [Malus 
domestica]
Length=857

 Score =   260 bits (664),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 183/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  628   ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  687

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A +P GYG F ++ +IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  688   QYKNSVSVSSLPQSANIPPGYG-FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKD  746

Query  655   NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA  485
             N HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA
Sbjct  747   NSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYA  806

Query  484   -SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLWQNSY  323
              +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  807   GTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  857



>ref|XP_008364176.1| PREDICTED: uncharacterized protein LOC103427870 isoform X3 [Malus 
domestica]
Length=856

 Score =   260 bits (664),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 183/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  627   ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  686

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A +P GYG F ++ +IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  687   QYKNSVSVSSLPQSANIPPGYG-FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKD  745

Query  655   NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA  485
             N HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA
Sbjct  746   NSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYA  805

Query  484   -SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLWQNSY  323
              +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  806   GTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  856



>ref|XP_008364174.1| PREDICTED: uncharacterized protein LOC103427870 isoform X1 [Malus 
domestica]
Length=857

 Score =   259 bits (663),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 183/237 (77%), Gaps = 14/237 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  627   ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  686

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVSVSSLP  A +P GYG F ++ +IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  687   QYKNSVSVSSLPQSANIPPGYG-FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKD  745

Query  655   NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  488
             N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  746   NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQY  805

Query  487   A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLWQNSY  323
             A +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  806   AGTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  857



>ref|XP_009353840.1| PREDICTED: uncharacterized protein LOC103945058 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009360833.1| PREDICTED: uncharacterized protein LOC103951238 isoform X2 [Pyrus 
x bretschneideri]
Length=856

 Score =   258 bits (659),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 183/237 (77%), Gaps = 14/237 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  626   ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  685

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVS SSLP  A +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  686   QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  744

Query  655   NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  488
             N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  745   NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQY  804

Query  487   A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  323
             A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  805   AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_009353841.1| PREDICTED: uncharacterized protein LOC103945058 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009360834.1| PREDICTED: uncharacterized protein LOC103951238 isoform X3 [Pyrus 
x bretschneideri]
Length=856

 Score =   258 bits (659),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 157/236 (67%), Positives = 183/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  627   ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  686

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVS SSLP  A +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  687   QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  745

Query  655   NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA  485
             N HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA
Sbjct  746   NSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQYA  805

Query  484   -SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  323
              +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  806   GALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_009353842.1| PREDICTED: uncharacterized protein LOC103945058 isoform X5 [Pyrus 
x bretschneideri]
 ref|XP_009360836.1| PREDICTED: uncharacterized protein LOC103951238 isoform X4 [Pyrus 
x bretschneideri]
Length=855

 Score =   258 bits (659),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 183/237 (77%), Gaps = 14/237 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  625   ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  684

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVS SSLP  A +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  685   QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  743

Query  655   NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  488
             N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  744   NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQY  803

Query  487   A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  323
             A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  804   AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  855



>ref|XP_009353838.1| PREDICTED: uncharacterized protein LOC103945058 isoform X1 [Pyrus 
x bretschneideri]
Length=857

 Score =   258 bits (658),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 183/237 (77%), Gaps = 14/237 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  627   ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  686

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVS SSLP  A +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  687   QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  745

Query  655   NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  488
             N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  746   NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQY  805

Query  487   A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  323
             A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  806   AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  857



>ref|XP_009353839.1| PREDICTED: uncharacterized protein LOC103945058 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009360832.1| PREDICTED: uncharacterized protein LOC103951238 isoform X1 [Pyrus 
x bretschneideri]
Length=856

 Score =   258 bits (658),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 183/237 (77%), Gaps = 14/237 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  626   ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  685

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVS SSLP  A +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  686   QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  744

Query  655   NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  488
             N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  745   NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQY  804

Query  487   A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  323
             A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  805   AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_004504230.1| PREDICTED: serine/threonine-protein kinase pakD-like [Cicer arietinum]
Length=861

 Score =   257 bits (657),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 177/231 (77%), Gaps = 10/231 (4%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             +LPQHLAVHPYSQPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  639   SLPQHLAVHPYSQPTLPLGHFANMISYPFMPQSYTYMPSAFQQAFAGNSTYHQSLAAVLP  698

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKD  656
              YKNS+SVSSLP  A +PSGYG FG++ +IP G++PLNPSA P ST++G DD +SSQYK+
Sbjct  699   QYKNSISVSSLPQSAAIPSGYG-FGSSTSIPGGNYPLNPSAPPTSTAIGYDDVISSQYKE  757

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             N+H++SLQQ ENS MW+ G GSRTMS  P+  Y       QQ  GFRQ QQPSQ++   G
Sbjct  758   NNHMISLQQNENSPMWVQGPGSRTMSVPPSTYYSFQGQNQQQAGGFRQNQQPSQHFGPHG  817

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y PN+YHSQ+GISL+  HQQQNPRD  L      +Q Q    SQQLWQNSY
Sbjct  818   Y-PNYYHSQSGISLE--HQQQNPRDASL----AGSQQQNPKQSQQLWQNSY  861



>ref|XP_008366008.1| PREDICTED: protein lingerer-like [Malus domestica]
Length=856

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 184/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  626   ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  685

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKNSVS SSLP  A +P GYG F ++ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  686   QYKNSVSASSLPQSANIPPGYG-FSSSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  744

Query  655   NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  488
             N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q  QPSQ Y
Sbjct  745   NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPQPSQQY  804

Query  487   A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  323
             A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQN+Y
Sbjct  805   AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNNY  856



>ref|XP_010666705.1| PREDICTED: uncharacterized protein LOC104883839 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=847

 Score =   240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 170/235 (72%), Gaps = 21/235 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFA--NIISYPFMHQSYTYMPPGFQQPFA-GNSTYQQSLAA  839
             AL QHL VHPYSQ ++P+G FA  N+I YPF+ Q+YTYMP  FQQ FA GNSTY QSLAA
Sbjct  628   ALQQHL-VHPYSQHSVPMGHFAAANMIGYPFLPQNYTYMPSAFQQAFAAGNSTYPQSLAA  686

Query  838   -VLPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQ  665
              VLP YKNSVSVSSLP  A VPSGYGAFGN+ +IP +FPLNP +AP+ TS+  DD LSSQ
Sbjct  687   AVLPQYKNSVSVSSLPQAAAVPSGYGAFGNSNSIPNNFPLNPPSAPAGTSVNYDDLLSSQ  746

Query  664   YKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNY  488
             YKD  HL+SLQQ         G GSRT+S  P +TYYN  Q QNQQP+GFRQ QQPSQ+Y
Sbjct  747   YKDASHLLSLQQ---------GAGSRTLSGVPGSTYYNSFQGQNQQPAGFRQSQQPSQHY  797

Query  487   ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
               L   PNFYHSQ+G+SLD H QQQ  RDG L      +Q Q    +QQLWQNSY
Sbjct  798   GQLSGYPNFYHSQSGLSLD-HQQQQMSRDGSL----SGSQGQQPKQTQQLWQNSY  847



>ref|XP_010666704.1| PREDICTED: uncharacterized protein LOC104883839 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=858

 Score =   239 bits (611),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 170/235 (72%), Gaps = 21/235 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFA--NIISYPFMHQSYTYMPPGFQQPFA-GNSTYQQSLAA  839
             AL QHL VHPYSQ ++P+G FA  N+I YPF+ Q+YTYMP  FQQ FA GNSTY QSLAA
Sbjct  639   ALQQHL-VHPYSQHSVPMGHFAAANMIGYPFLPQNYTYMPSAFQQAFAAGNSTYPQSLAA  697

Query  838   -VLPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQ  665
              VLP YKNSVSVSSLP  A VPSGYGAFGN+ +IP +FPLNP +AP+ TS+  DD LSSQ
Sbjct  698   AVLPQYKNSVSVSSLPQAAAVPSGYGAFGNSNSIPNNFPLNPPSAPAGTSVNYDDLLSSQ  757

Query  664   YKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNY  488
             YKD  HL+SLQQ         G GSRT+S  P +TYYN  Q QNQQP+GFRQ QQPSQ+Y
Sbjct  758   YKDASHLLSLQQ---------GAGSRTLSGVPGSTYYNSFQGQNQQPAGFRQSQQPSQHY  808

Query  487   ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
               L   PNFYHSQ+G+SLD H QQQ  RDG L      +Q Q    +QQLWQNSY
Sbjct  809   GQLSGYPNFYHSQSGLSLD-HQQQQMSRDGSL----SGSQGQQPKQTQQLWQNSY  858



>ref|XP_010056862.1| PREDICTED: uncharacterized protein LOC104444809 isoform X3 [Eucalyptus 
grandis]
Length=833

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 168/233 (72%), Gaps = 12/233 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAVL  833
             ALPQHLA+HPYSQPTLPLGPFAN++SYPF+ QSY+Y+PP  FQQ F GNSTY QSLAA+L
Sbjct  609   ALPQHLAMHPYSQPTLPLGPFANMVSYPFLPQSYSYVPPSAFQQTFTGNSTYHQSLAALL  668

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKD  656
             P YKNS+S SSLP    +PSGYG  G+TG   G+F LNP +AP +T+LG DD LSSQYKD
Sbjct  669   PQYKNSLSSSSLPQSGAIPSGYGFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKD  728

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYAS  482
              + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ S
Sbjct  729   ANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGS  788

Query  481   LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             L Y PNFY S  GISL+  HQQQ  RD  LGG            S Q+WQN+Y
Sbjct  789   LNY-PNFYQS-AGISLE--HQQQIARDSSLGGSQSQQAK----QSAQIWQNTY  833



>ref|XP_010056861.1| PREDICTED: uncharacterized protein LOC104444809 isoform X2 [Eucalyptus 
grandis]
 gb|KCW73756.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=857

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 170/233 (73%), Gaps = 12/233 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAVL  833
             ALPQHLA+HPYSQPTLPLGPFAN++SYPF+ QSY+Y+PP  FQQ F GNSTY QSLAA+L
Sbjct  633   ALPQHLAMHPYSQPTLPLGPFANMVSYPFLPQSYSYVPPSAFQQTFTGNSTYHQSLAALL  692

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKD  656
             P YKNS+S SSLP    +PSGYG  G+TG   G+F LNP +AP +T+LG DD LSSQYKD
Sbjct  693   PQYKNSLSSSSLPQSGAIPSGYGFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKD  752

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYAS  482
              + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ S
Sbjct  753   ANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGS  812

Query  481   LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             L Y PNFY S  GISL+  HQQQ  RD  L    G +Q Q    S Q+WQN+Y
Sbjct  813   LNY-PNFYQS-AGISLE--HQQQIARDSSL----GGSQSQQAKQSAQIWQNTY  857



>ref|XP_010056860.1| PREDICTED: uncharacterized protein LOC104444809 isoform X1 [Eucalyptus 
grandis]
 gb|KCW73755.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=859

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 170/233 (73%), Gaps = 12/233 (5%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAVL  833
             ALPQHLA+HPYSQPTLPLGPFAN++SYPF+ QSY+Y+PP  FQQ F GNSTY QSLAA+L
Sbjct  635   ALPQHLAMHPYSQPTLPLGPFANMVSYPFLPQSYSYVPPSAFQQTFTGNSTYHQSLAALL  694

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKD  656
             P YKNS+S SSLP    +PSGYG  G+TG   G+F LNP +AP +T+LG DD LSSQYKD
Sbjct  695   PQYKNSLSSSSLPQSGAIPSGYGFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKD  754

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYAS  482
              + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ S
Sbjct  755   ANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGS  814

Query  481   LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             L Y PNFY S  GISL+  HQQQ  RD  L    G +Q Q    S Q+WQN+Y
Sbjct  815   LNY-PNFYQS-AGISLE--HQQQIARDSSL----GGSQSQQAKQSAQIWQNTY  859



>ref|XP_006597650.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=800

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 179/236 (76%), Gaps = 15/236 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP
Sbjct  573   ALPQHLAVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLP  632

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKN+VS SSLP  A +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KD
Sbjct  633   QYKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKD  691

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQN  491
             N+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ         +Q QQPSQ+
Sbjct  692   NNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQH  751

Query  490   YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +  LGY PNFY SQTGISL+  HQ QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  752   FGPLGY-PNFYQSQTGISLE--HQPQNPREASL----GGPQSQPSKQSQQIWQNSY  800



>ref|XP_004486425.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=831

 Score =   237 bits (604),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 158/199 (79%), Gaps = 5/199 (3%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQHLA+HPYSQPTLPLG FAN+ISYP + QSY YMP  FQQ FAGN+ Y QSLAA+LP 
Sbjct  609   LPQHLAMHPYSQPTLPLGHFANMISYPLLPQSYAYMPSAFQQTFAGNNAYHQSLAALLPQ  668

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIP--GSFPLN-PSAAPSTSLGIDDGLSSQYKD  656
             YK+SVSVS++P  A +P GYG F ++ +IP  GSF LN P+AA  T++G ++ ++SQ KD
Sbjct  669   YKSSVSVSNVPPSANIPPGYG-FNSSTSIPGGGSFSLNPPAAATGTTIGYENVINSQLKD  727

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             N H++SLQQ ENS +WL G GSRTM A P + YY++Q QNQQPSGF+Q QQP+Q++ SLG
Sbjct  728   NSHMISLQQNENSPIWLQGPGSRTMPAVPPSAYYSLQGQNQQPSGFQQRQQPTQHFGSLG  787

Query  475   YNPNFYHSQTGISLDHHHQ  419
             + PNFY SQ+GISL+H HQ
Sbjct  788   H-PNFYQSQSGISLEHQHQ  805



>ref|XP_006597649.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=832

 Score =   237 bits (604),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 179/236 (76%), Gaps = 15/236 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP
Sbjct  605   ALPQHLAVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLP  664

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKN+VS SSLP  A +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KD
Sbjct  665   QYKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKD  723

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQN  491
             N+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ         +Q QQPSQ+
Sbjct  724   NNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQH  783

Query  490   YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +  LGY PNFY SQTGISL+  HQ QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  784   FGPLGY-PNFYQSQTGISLE--HQPQNPREASL----GGPQSQPSKQSQQIWQNSY  832



>gb|KHN14369.1| hypothetical protein glysoja_012407 [Glycine soja]
Length=831

 Score =   236 bits (603),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 179/236 (76%), Gaps = 15/236 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLAVHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP
Sbjct  604   ALPQHLAVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLP  663

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKN+VS SSLP  A +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KD
Sbjct  664   QYKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKD  722

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQN  491
             N+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ         +Q QQPSQ+
Sbjct  723   NNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQH  782

Query  490   YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +  LGY PNFY SQTGISL+  HQ QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  783   FGPLGY-PNFYQSQTGISLE--HQPQNPREASL----GGPQSQPSKQSQQIWQNSY  831



>ref|XP_008797517.1| PREDICTED: uncharacterized protein LOC103712704 isoform X2 [Phoenix 
dactylifera]
Length=733

 Score =   231 bits (590),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 167/239 (70%), Gaps = 20/239 (8%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV-  836
              LPQHL VH Y+QPTLPLG FAN+ISY F+ QSYTY+P   FQQP+ GN  + QS AAV 
Sbjct  505   VLPQHLPVHHYAQPTLPLGHFANMISYQFLPQSYTYLPSAAFQQPYTGNGPFHQSPAAVP  564

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNP-SAAPSTSLGIDD  680
                    LP YK+SVS++SLP  A V SGYG FG++  IPGSF  NP SA+ ST++G D+
Sbjct  565   GAGIKYPLPQYKSSVSMTSLPQSAAVVSGYGGFGSSTNIPGSFTRNPTSASASTTIGFDE  624

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+YN Q Q+Q  SGFRQ QQP
Sbjct  625   SLSSQYKEANHYMPLQQTDNPAMWVHGAGSRTMSALPASTFYNFQGQSQH-SGFRQGQQP  683

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ + + GY PNFYHSQ G+S +H   QQNP +G L      +Q  P   S Q+WQ+SY
Sbjct  684   SQ-FGAPGY-PNFYHSQAGVSQEH---QQNPGEGNL----NGSQATPSQPSHQIWQHSY  733



>ref|XP_008797516.1| PREDICTED: uncharacterized protein LOC103712704 isoform X1 [Phoenix 
dactylifera]
Length=893

 Score =   233 bits (593),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 167/239 (70%), Gaps = 20/239 (8%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV-  836
              LPQHL VH Y+QPTLPLG FAN+ISY F+ QSYTY+P   FQQP+ GN  + QS AAV 
Sbjct  665   VLPQHLPVHHYAQPTLPLGHFANMISYQFLPQSYTYLPSAAFQQPYTGNGPFHQSPAAVP  724

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNP-SAAPSTSLGIDD  680
                    LP YK+SVS++SLP  A V SGYG FG++  IPGSF  NP SA+ ST++G D+
Sbjct  725   GAGIKYPLPQYKSSVSMTSLPQSAAVVSGYGGFGSSTNIPGSFTRNPTSASASTTIGFDE  784

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+YN Q Q+Q  SGFRQ QQP
Sbjct  785   SLSSQYKEANHYMPLQQTDNPAMWVHGAGSRTMSALPASTFYNFQGQSQH-SGFRQGQQP  843

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ + + GY PNFYHSQ G+S +H   QQNP +G L      +Q  P   S Q+WQ+SY
Sbjct  844   SQ-FGAPGY-PNFYHSQAGVSQEH---QQNPGEGNL----NGSQATPSQPSHQIWQHSY  893



>ref|XP_010926244.1| PREDICTED: uncharacterized protein LOC105048593 [Elaeis guineensis]
Length=886

 Score =   231 bits (589),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 167/239 (70%), Gaps = 20/239 (8%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV-  836
              +PQ L VH Y+QPTLPLG FAN+ISY F+ QSYTY+P   FQQP+ GN  + QS AAV 
Sbjct  658   VVPQQLPVHHYAQPTLPLGHFANMISYQFLPQSYTYLPSAAFQQPYTGNGPFHQSPAAVP  717

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNP-SAAPSTSLGIDD  680
                    LP YK+SVSV+SLP  A V SGYG FG++  IPGSF  NP SA+ ST++G D+
Sbjct  718   SAGIKYTLPQYKSSVSVTSLPQSAAVVSGYGGFGSSTNIPGSFTRNPTSASASTTIGFDE  777

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+Y+ Q Q+Q  SGFRQ QQP
Sbjct  778   SLSSQYKEANHYMPLQQNDNPAMWVHGAGSRTMSALPASTFYSFQGQSQH-SGFRQSQQP  836

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ + +LGY PNFYHSQ GIS +H   QQNP +G L      +Q  P   S Q+WQ+SY
Sbjct  837   SQ-FGALGY-PNFYHSQAGISQEH---QQNPGEGNL----NGSQATPSQPSHQIWQHSY  886



>ref|XP_008349816.1| PREDICTED: serine/threonine-protein kinase CBK1-like [Malus domestica]
Length=208

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 161/214 (75%), Gaps = 14/214 (7%)
 Frame = -1

Query  940  IISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYKNSVSVSSLPHFATVPSGYGA  761
            +I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP YKNSVSVSSLP  A +P GYG 
Sbjct  1    MIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLPQYKNSVSVSSLPQSANIPPGYG-  59

Query  760  FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  593
            F ++ +IP G+FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ   +NSGMW+HG G
Sbjct  60   FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKDNSHLISLQQQQNDNSGMWVHGPG  119

Query  592  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  422
            SR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQTG+SL+ H 
Sbjct  120  SRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQ  177

Query  421  QQQNPRDGPLggggGNAQVQP-KPSSQQLWQNSY  323
            QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  178  QQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  208



>ref|XP_010924304.1| PREDICTED: signaling mucin HKR1-like [Elaeis guineensis]
Length=887

 Score =   225 bits (574),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 166/238 (70%), Gaps = 20/238 (8%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV--  836
             LPQHL VH Y+QPTLPL  FAN+IS+PF+ QSYTY+P   FQQP+  N  + QS A +  
Sbjct  660   LPQHLPVHHYTQPTLPLSHFANMISFPFLPQSYTYLPSAAFQQPYTSNGPFHQSPAPIPN  719

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPS-AAPSTSLGIDDG  677
                   LP YK+SVSV+SLP  A+V S YG FG++  +PGSF LNP+ A+ ST++G+++ 
Sbjct  720   AGIKYTLPQYKSSVSVTSLPQSASVASAYGGFGSSANLPGSFTLNPTTASASTTIGLEEA  779

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+Y+ Q QNQ  SGFRQ QQPS
Sbjct  780   LSSQYKEANHYMPLQQADNPAMWVHGAGSRTMSALPASTFYSFQGQNQH-SGFRQGQQPS  838

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Q + +LGY PNFY SQ G+S +H   QQNP +G L      +Q  P   S Q+WQ+ Y
Sbjct  839   Q-FGALGY-PNFYPSQGGVSQEH---QQNPSEGNLSV----SQAAPSQPSHQMWQHGY  887



>ref|XP_010549430.1| PREDICTED: uncharacterized protein LOC104820614 [Tarenaya hassleriana]
Length=826

 Score =   223 bits (567),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 171/245 (70%), Gaps = 30/245 (12%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ LA+HPYSQPTLPL  F N++ YP + QSY YMP  FQQ FAGNS+Y QSLAA+LP
Sbjct  596   ALPQQLAMHPYSQPTLPLTHFPNMMGYPLLPQSYPYMPSAFQQAFAGNSSYHQSLAALLP  655

Query  829   NYKNSVSVSSLPHFAT--VPSGYGAFGNTGTI-PGSFPLN-PSAAPS-TSLGIDDGLSSQ  665
              YKNSV+ SSLP  AT   PS YG FGN+  I  G++PLN P+A P+ T+LG  D LSSQ
Sbjct  656   QYKNSVAASSLPQTATGAAPSAYG-FGNSSNIGTGNYPLNQPTAPPTGTTLGYGDVLSSQ  714

Query  664   YKDNHHLMSLQQV---ENSGMWLHGHGSRTMSAAPANTYYNIQA--QNQQP-----SGF-  518
             YK+ +HL+SLQQ    ENS MW+HGHG++TM A P NTYYN+QA   NQQ      SG+ 
Sbjct  715   YKEINHLLSLQQQQQNENSAMWVHGHGAQTMPAIPTNTYYNLQAAHHNQQASSSSSSGYH  774

Query  517   RQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQL  338
             R   QP  +Y SLGY PNFY SQTG+SL+   QQQNPRDG           Q +P S+Q+
Sbjct  775   RHAHQP--DYGSLGY-PNFYQSQTGMSLE-QQQQQNPRDGG---------SQGQPPSKQI  821

Query  337   WQNSY  323
             WQNSY
Sbjct  822   WQNSY  826



>ref|XP_007147529.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
 gb|ESW19523.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
Length=843

 Score =   222 bits (565),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 175/239 (73%), Gaps = 17/239 (7%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHL VHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GNSTY QSLAA+LP
Sbjct  612   ALPQHLPVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFPGNSTYHQSLAAMLP  671

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  656
              YKN+VS SSLP  A +P GYG FG++ +IP G+F L+P AAP+ T++G +D ++SQ+KD
Sbjct  672   QYKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLSPPAAPTGTTIGYEDLINSQFKD  730

Query  655   NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQ--------NQQPSGFRQVQQP  500
             ++H++SLQQ +NS MW+ G G RTMSA P + YY++Q Q         Q+    +Q QQP
Sbjct  731   SNHMISLQQNDNSPMWVQGPGPRTMSAVPPSNYYSMQGQSQQQAGGFRQRQQQQQQQQQP  790

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ++ SLGY PNFY SQ+GISL+  HQ QNPR+  LGG       Q   S QQLWQNSY
Sbjct  791   SQHFGSLGY-PNFYQSQSGISLE--HQPQNPREASLGGPQSQPSKQ---SQQQLWQNSY  843



>ref|XP_006586817.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=837

 Score =   220 bits (560),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 172/239 (72%), Gaps = 20/239 (8%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  824
             PQHLA+HPYSQP+LPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP Y
Sbjct  607   PQHLAMHPYSQPSLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLPQY  666

Query  823   KNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             KN+VS SSLP  A +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KDN+
Sbjct  667   KNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDVINSQFKDNN  725

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQ----------AQNQQPSGFRQVQQP  500
             H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q           Q  Q    +Q Q P
Sbjct  726   HMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRHQQQQQQQQQPP  785

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              Q++  LGY PNFY SQTGISL+   Q QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  786   LQHFGPLGY-PNFYQSQTGISLE--QQPQNPREASL----GGPQSQPSKQSQQIWQNSY  837



>ref|XP_003534759.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=838

 Score =   220 bits (560),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 172/239 (72%), Gaps = 20/239 (8%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  824
             PQHLA+HPYSQP+LPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP Y
Sbjct  608   PQHLAMHPYSQPSLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLPQY  667

Query  823   KNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  650
             KN+VS SSLP  A +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KDN+
Sbjct  668   KNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDVINSQFKDNN  726

Query  649   HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQ----------AQNQQPSGFRQVQQP  500
             H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q           Q  Q    +Q Q P
Sbjct  727   HMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRHQQQQQQQQQPP  786

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              Q++  LGY PNFY SQTGISL+   Q QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  787   LQHFGPLGY-PNFYQSQTGISLE--QQPQNPREASL----GGPQSQPSKQSQQIWQNSY  838



>ref|XP_008800693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103714980 
[Phoenix dactylifera]
Length=885

 Score =   217 bits (553),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 162/239 (68%), Gaps = 20/239 (8%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV-  836
             ALPQHL VH Y+QP LP   FAN+IS+PF+ QSYTY+P   FQQP+ GN  + QS A + 
Sbjct  657   ALPQHLPVHHYTQPALPSSHFANMISFPFLPQSYTYLPSAAFQQPYTGNGPFHQSPATIP  716

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  680
                    LP YK+S+SV+SLP  A V S YG FG++  IPGSF L+P+  + ST++G+++
Sbjct  717   SAGIKYTLPQYKSSISVTSLPQSAAVASAYGGFGSSANIPGSFTLDPTTVSASTTIGLEE  776

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              LSSQYK+ +H M LQQ +N+ MW+HG GSRTMSA PA+T+Y+ Q QNQ  SGFRQ QQP
Sbjct  777   ALSSQYKEANHYMPLQQADNTAMWVHGAGSRTMSALPASTFYSFQGQNQH-SGFRQGQQP  835

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ +   GY PNFY SQ G+       QQNP +G L      +Q  P  +S Q+WQ+SY
Sbjct  836   SQ-FGPPGY-PNFYPSQAGVP---QELQQNPSEGNLNV----SQAAPSQASHQMWQHSY  885



>ref|XP_010538220.1| PREDICTED: uncharacterized protein LOC104812645 isoform X1 [Tarenaya 
hassleriana]
Length=818

 Score =   216 bits (549),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 162/237 (68%), Gaps = 24/237 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAG-NSTYQQSLAAVL  833
             ALPQ L +HPY+QP+LPL  F N+I YP + QSY Y+P  F Q FAG NS+Y QSLAA+ 
Sbjct  595   ALPQQLPMHPYAQPSLPLTHFPNMIGYPLLPQSYPYIPSAFMQAFAGNNSSYHQSLAALH  654

Query  832   PNYKNSVSVSSLPH-FATVPSGYGAFGNTGTI-PGSFPLNPSAAPS-TSLGIDDGLSSQY  662
             P YKNSVS SSLP   A   S YG FGN+  +  G++PLN SA P+ TSLG ++ LSSQY
Sbjct  655   PQYKNSVSTSSLPQPGAASASAYG-FGNSSNVGAGNYPLNQSAGPTGTSLGYEEALSSQY  713

Query  661   KDNHHLMSLQ--QVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ-QPSQ  494
             K+++H++SLQ  Q ENS MWLH GHGSRTMS  P N YYN+Q Q Q P  FR  Q Q SQ
Sbjct  714   KESNHMLSLQQHQQENSPMWLHNGHGSRTMSTVPTNGYYNLQPQQQGPE-FRHSQPQASQ  772

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +Y SLGY PNFYH QTGIS++ HH  QNPRDG              PS QQ+WQN Y
Sbjct  773   HYGSLGY-PNFYHPQTGISIE-HHPPQNPRDG------------GPPSKQQIWQNPY  815



>ref|XP_010538221.1| PREDICTED: uncharacterized protein LOC104812645 isoform X2 [Tarenaya 
hassleriana]
Length=817

 Score =   214 bits (545),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 162/236 (69%), Gaps = 23/236 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAG-NSTYQQSLAAVL  833
             ALPQ L +HPY+QP+LPL  F N+I YP + QSY Y+P  F Q FAG NS+Y QSLAA+ 
Sbjct  595   ALPQQLPMHPYAQPSLPLTHFPNMIGYPLLPQSYPYIPSAFMQAFAGNNSSYHQSLAALH  654

Query  832   PNYKNSVSVSSLPH-FATVPSGYGAFGNTGTI-PGSFPLNPSAAPS-TSLGIDDGLSSQY  662
             P YKNSVS SSLP   A   S YG FGN+  +  G++PLN SA P+ TSLG ++ LSSQY
Sbjct  655   PQYKNSVSTSSLPQPGAASASAYG-FGNSSNVGAGNYPLNQSAGPTGTSLGYEEALSSQY  713

Query  661   KDNHHLMSLQQ-VENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ-QPSQN  491
             K+++H++SLQQ  +NS MWLH GHGSRTMS  P N YYN+Q Q Q P  FR  Q Q SQ+
Sbjct  714   KESNHMLSLQQHQQNSPMWLHNGHGSRTMSTVPTNGYYNLQPQQQGPE-FRHSQPQASQH  772

Query  490   YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y SLGY PNFYH QTGIS++ HH  QNPRDG              PS QQ+WQN Y
Sbjct  773   YGSLGY-PNFYHPQTGISIE-HHPPQNPRDG------------GPPSKQQIWQNPY  814



>ref|XP_006415582.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33935.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=836

 Score =   206 bits (523),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 166/254 (65%), Gaps = 38/254 (15%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPT+PL  FAN+I YP M Q+Y YMP  FQQ +AGNS+Y Q LAA+LP
Sbjct  596   ALPQQLPMHPYSQPTMPLAHFANMIGYPLMPQNYPYMPSAFQQTYAGNSSYHQQLAALLP  655

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKD  656
              YK ++S S+LP  A+ P+    FGN+  +   G+FPLN  +AP+   G +D LSSQYK+
Sbjct  656   QYKTNLSPSNLPQSASAPASAYGFGNSTNVGSTGNFPLNQQSAPT---GYEDVLSSQYKE  712

Query  655   NHHLMSLQQV----------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  524
             ++HL++LQQ                 ENS MW HGHGSRTMS  PANTYYN+QAQ QQ  
Sbjct  713   SNHLLALQQQQQQQQQQQLLLQQQQNENSAMWHHGHGSRTMSGIPANTYYNLQAQQQQQQ  772

Query  523   ------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-  365
                   G+RQ QQ  Q+Y S GY PNFY SQT +SLD   QQQNPRDG        AQV 
Sbjct  773   PQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLD--RQQQNPRDG------AGAQVG  822

Query  364   QPKPSSQQLWQNSY  323
             QP   +QQLWQNSY
Sbjct  823   QPSNQTQQLWQNSY  836



>ref|XP_006415581.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33934.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=838

 Score =   206 bits (523),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 166/254 (65%), Gaps = 38/254 (15%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPT+PL  FAN+I YP M Q+Y YMP  FQQ +AGNS+Y Q LAA+LP
Sbjct  598   ALPQQLPMHPYSQPTMPLAHFANMIGYPLMPQNYPYMPSAFQQTYAGNSSYHQQLAALLP  657

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKD  656
              YK ++S S+LP  A+ P+    FGN+  +   G+FPLN  +AP+   G +D LSSQYK+
Sbjct  658   QYKTNLSPSNLPQSASAPASAYGFGNSTNVGSTGNFPLNQQSAPT---GYEDVLSSQYKE  714

Query  655   NHHLMSLQQV----------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  524
             ++HL++LQQ                 ENS MW HGHGSRTMS  PANTYYN+QAQ QQ  
Sbjct  715   SNHLLALQQQQQQQQQQQLLLQQQQNENSAMWHHGHGSRTMSGIPANTYYNLQAQQQQQQ  774

Query  523   ------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-  365
                   G+RQ QQ  Q+Y S GY PNFY SQT +SLD   QQQNPRDG        AQV 
Sbjct  775   PQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLD--RQQQNPRDG------AGAQVG  824

Query  364   QPKPSSQQLWQNSY  323
             QP   +QQLWQNSY
Sbjct  825   QPSNQTQQLWQNSY  838



>emb|CDX94662.1| BnaC07g09960D [Brassica napus]
Length=805

 Score =   202 bits (515),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 158/238 (66%), Gaps = 27/238 (11%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  824
             PQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP Y
Sbjct  584   PQQLPMHPYSQPTMPLAHFANMLGYPLMPQNYPYMPSAFPQTFAGNSLYQQQLAALLPQY  643

Query  823   KNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHH  647
             K ++S S+LPH AT         N G+  G+FPLN  S  P T++G +D LSSQYK++ H
Sbjct  644   KTNLSPSNLPHSATAL-------NVGSA-GNFPLNQHSTPPGTTMGYEDVLSSQYKESSH  695

Query  646   LMSLQQV----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS------GFRQVQQPS  497
             L++LQQ     ENS MW HGHGSRTMS  PANTYYN+QAQ Q         G+RQ QQ  
Sbjct  696   LLALQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQQAQQAAGGYRQAQQ-Q  754

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Q+Y S GY PN+Y SQT +S+D   QQQNPRDG     G  A  QP   +QQLWQNSY
Sbjct  755   QHYGSQGY-PNYYQSQTEMSVD--RQQQNPRDG----AGAQAGSQPSNQTQQLWQNSY  805



>ref|XP_010539204.1| PREDICTED: putative uncharacterized protein DDB_G0277255 [Tarenaya 
hassleriana]
Length=790

 Score =   202 bits (515),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 155/233 (67%), Gaps = 26/233 (11%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             AL QHLA+HPYSQPTLPLG + N+ISYPF+ QSY YMP GFQQ      TY QSLAA+LP
Sbjct  580   ALAQHLAMHPYSQPTLPLGHYTNMISYPFLPQSYPYMPSGFQQ------TYPQSLAAMLP  633

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPSTSLGID--DGLSSQYK  659
              YK+    S+LP  A VPS YG FG +  +P G+FPLN S+  +T++G D  D LSSQ+K
Sbjct  634   QYKS----SNLPQSAAVPSAYG-FGASSNVPGGNFPLNQSSTGNTTMGYDNNDVLSSQFK  688

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-PSGFRQVQQPSQNYAS  482
             D++H  S+QQ E+S  WL G  SR +S  P +TYY+   QNQQ P GFR  QQPSQ +  
Sbjct  689   DSNHFASIQQNESSQAWLQGQNSRVVSVVPGSTYYSFPGQNQQPPGGFR--QQPSQQH--  744

Query  481   LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              GY   +Y SQ G+S++H+H  QNPRD  +      AQ      +QQLWQNSY
Sbjct  745   FGYMSPYY-SQAGMSMEHNHHHQNPRDTSV------AQTHASKQAQQLWQNSY  790



>ref|XP_009410966.1| PREDICTED: uncharacterized protein LOC103992822 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=830

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 152/238 (64%), Gaps = 21/238 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
             ALPQHL VH YSQP LPLG FAN+ISYPF+  SYTY+P   QQ FA NS + QS AAV  
Sbjct  605   ALPQHLPVHHYSQPALPLGHFANMISYPFLPHSYTYLP-SIQQAFAANSPFHQSPAAVPS  663

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  677
                    P +K+S+S +SLP  + + S YG  G++  IPG+F LN  +A+ ST++G D+ 
Sbjct  664   VGMKYSQPQFKSSLSATSLPQASAIASAYGGLGSSANIPGAFILNHTTASASTTIGFDEA  723

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  SG R  QQ S
Sbjct  724   LSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-SGIRPSQQTS  782

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + Q+WQ+ Y
Sbjct  783   Q-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPANQIWQHGY  830



>ref|XP_009410964.1| PREDICTED: uncharacterized protein LOC103992822 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=878

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 152/238 (64%), Gaps = 21/238 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
             ALPQHL VH YSQP LPLG FAN+ISYPF+  SYTY+P   QQ FA NS + QS AAV  
Sbjct  653   ALPQHLPVHHYSQPALPLGHFANMISYPFLPHSYTYLP-SIQQAFAANSPFHQSPAAVPS  711

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  677
                    P +K+S+S +SLP  + + S YG  G++  IPG+F LN  +A+ ST++G D+ 
Sbjct  712   VGMKYSQPQFKSSLSATSLPQASAIASAYGGLGSSANIPGAFILNHTTASASTTIGFDEA  771

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  SG R  QQ S
Sbjct  772   LSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-SGIRPSQQTS  830

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + Q+WQ+ Y
Sbjct  831   Q-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPANQIWQHGY  878



>ref|XP_009410965.1| PREDICTED: uncharacterized protein LOC103992822 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=872

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 152/238 (64%), Gaps = 21/238 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
             ALPQHL VH YSQP LPLG FAN+ISYPF+  SYTY+P   QQ FA NS + QS AAV  
Sbjct  647   ALPQHLPVHHYSQPALPLGHFANMISYPFLPHSYTYLP-SIQQAFAANSPFHQSPAAVPS  705

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  677
                    P +K+S+S +SLP  + + S YG  G++  IPG+F LN  +A+ ST++G D+ 
Sbjct  706   VGMKYSQPQFKSSLSATSLPQASAIASAYGGLGSSANIPGAFILNHTTASASTTIGFDEA  765

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  SG R  QQ S
Sbjct  766   LSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-SGIRPSQQTS  824

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + Q+WQ+ Y
Sbjct  825   Q-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPANQIWQHGY  872



>ref|XP_009410962.1| PREDICTED: uncharacterized protein LOC103992822 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 152/238 (64%), Gaps = 21/238 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
             ALPQHL VH YSQP LPLG FAN+ISYPF+  SYTY+P   QQ FA NS + QS AAV  
Sbjct  658   ALPQHLPVHHYSQPALPLGHFANMISYPFLPHSYTYLP-SIQQAFAANSPFHQSPAAVPS  716

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  677
                    P +K+S+S +SLP  + + S YG  G++  IPG+F LN  +A+ ST++G D+ 
Sbjct  717   VGMKYSQPQFKSSLSATSLPQASAIASAYGGLGSSANIPGAFILNHTTASASTTIGFDEA  776

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  SG R  QQ S
Sbjct  777   LSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-SGIRPSQQTS  835

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + Q+WQ+ Y
Sbjct  836   Q-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPANQIWQHGY  883



>gb|EYU43283.1| hypothetical protein MIMGU_mgv1a002920mg [Erythranthe guttata]
Length=625

 Score =   197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 165/245 (67%), Gaps = 34/245 (14%)
 Frame = -1

Query  1009  ALPQHLAVHP-YSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  833
             ALPQ +A+HP YSQ  LP+G F N+I YPF+ QSYTYMP  FQQ  AG+S Y QSLAA+L
Sbjct  399   ALPQQVALHPQYSQTNLPMGQFPNMIGYPFLPQSYTYMPSAFQQSLAGSSAYHQSLAALL  458

Query  832   PNYK-NSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNP-SAAP--STSLGIDDGLSSQ  665
             P YK ++ S+SSLP  A   SGYG FGN  +IPG++ +NP SAAP   ++L  DD L++Q
Sbjct  459   PQYKSSASSISSLPQSA---SGYGGFGNNTSIPGNYQMNPQSAAPLSESALSYDDVLNAQ  515

Query  664   YKDNHHLMSL-QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQ--NQQPSGFR-------  515
             YK+  HL+SL QQ ENS +WL GH SRTMS  PA+T YN+QAQ  NQQ  GFR       
Sbjct  516   YKERSHLLSLQQQSENSPVWLQGHNSRTMSGVPASTLYNLQAQQTNQQLGGFRQGQAPHQ  575

Query  514   -QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQL  338
              Q QQ SQNY     NPN+YHSQTG+SLD   Q QNPRD         +Q QPK S  Q+
Sbjct  576   QQQQQQSQNYG----NPNYYHSQTGMSLD---QLQNPRD------VSGSQGQPKQS--QM  620

Query  337   WQNSY  323
             W N+Y
Sbjct  621   WPNNY  625



>ref|XP_002893558.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69817.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
Length=841

 Score =   196 bits (498),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 161/257 (63%), Gaps = 37/257 (14%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGN+ Y Q LAA+LP
Sbjct  594   ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNNAYHQQLAALLP  652

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +   G+FPLN  +AP+ T+LG +D LSSQYK
Sbjct  653   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSTGNFPLNQQSAPTGTTLGYEDVLSSQYK  712

Query  658   DNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---  524
             +N HL++LQQ             ENS MW HGHGSRTMS  P NTYYN+QAQ Q      
Sbjct  713   EN-HLLALQQQQQQQQQQQQQQNENSAMWHHGHGSRTMSGVPTNTYYNLQAQQQLQLQQQ  771

Query  523   ----------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGN  374
                       G+RQ QQ  Q+Y S GY PN+Y SQT +SLD   QQQNPRDG  G   G 
Sbjct  772   QQQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLD--RQQQNPRDGGTGSQAGQ  827

Query  373   AQVQPKPSSQQLWQNSY  323
                Q +   QQLWQNSY
Sbjct  828   PSNQTQ---QQLWQNSY  841



>ref|XP_006306766.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39664.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=840

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 161/258 (62%), Gaps = 38/258 (15%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSL-AAVL  833
             ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q L A++L
Sbjct  592   ALPQQLPMHPYSQPTLPLTHYANMISYPIMPQNYPYMPSAFQQTF-GNSSYHQQLSASLL  650

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQY  662
             P YK +VS  +LP  AT P+    FGN+      G+FP N  +AP+ T+LG +D LSSQY
Sbjct  651   PQYKTNVSPGNLPQSATAPASAYGFGNSTNAGSAGNFPPNQQSAPTGTTLGYEDVLSSQY  710

Query  661   KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---------  524
             K+++HL++LQQ      ENS MW HGHGSRTMS  PANTYYN+QAQ Q            
Sbjct  711   KESNHLLALQQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLHQQQLQQQQLQ  770

Query  523   -----------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggG  377
                        G+RQ QQ   +Y S GY PNFY SQT +SL+   QQQNPRDG     G 
Sbjct  771   QQQQQTQQAAGGYRQAQQQQHHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDGGGSQAG-  826

Query  376   NAQVQPKPSSQQLWQNSY  323
                 Q    +QQLWQNSY
Sbjct  827   ----QQSNQTQQLWQNSY  840



>ref|XP_006306765.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39663.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=832

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 161/258 (62%), Gaps = 38/258 (15%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSL-AAVL  833
             ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q L A++L
Sbjct  584   ALPQQLPMHPYSQPTLPLTHYANMISYPIMPQNYPYMPSAFQQTF-GNSSYHQQLSASLL  642

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQY  662
             P YK +VS  +LP  AT P+    FGN+      G+FP N  +AP+ T+LG +D LSSQY
Sbjct  643   PQYKTNVSPGNLPQSATAPASAYGFGNSTNAGSAGNFPPNQQSAPTGTTLGYEDVLSSQY  702

Query  661   KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---------  524
             K+++HL++LQQ      ENS MW HGHGSRTMS  PANTYYN+QAQ Q            
Sbjct  703   KESNHLLALQQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLHQQQLQQQQLQ  762

Query  523   -----------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggG  377
                        G+RQ QQ   +Y S GY PNFY SQT +SL+   QQQNPRDG     G 
Sbjct  763   QQQQQTQQAAGGYRQAQQQQHHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDGGGSQAG-  818

Query  376   NAQVQPKPSSQQLWQNSY  323
                 Q    +QQLWQNSY
Sbjct  819   ----QQSNQTQQLWQNSY  832



>ref|NP_174230.2| Kinase-related protein [Arabidopsis thaliana]
 gb|AAL36210.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20314.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31077.1| Kinase-related protein [Arabidopsis thaliana]
Length=831

 Score =   194 bits (492),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 157/256 (61%), Gaps = 37/256 (14%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  586   ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  644

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +   G+FPLN  SA   T+LG DD LSSQYK
Sbjct  645   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYDDVLSSQYK  704

Query  658   DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  524
             +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  705   EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  763

Query  523   ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  371
                      G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPRDG     G  A
Sbjct  764   QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPRDG----AGSQA  815

Query  370   QVQPKPSSQQLWQNSY  323
                   S QQLWQNSY
Sbjct  816   GQPSNQSQQQLWQNSY  831



>gb|AAG51735.1|AC068667_14 unknown protein; 25451-20507 [Arabidopsis thaliana]
Length=858

 Score =   194 bits (492),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 157/256 (61%), Gaps = 37/256 (14%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  613   ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  671

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +   G+FPLN  SA   T+LG DD LSSQYK
Sbjct  672   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYDDVLSSQYK  731

Query  658   DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  524
             +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  732   EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  790

Query  523   ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  371
                      G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPRDG     G  A
Sbjct  791   QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPRDG----AGSQA  842

Query  370   QVQPKPSSQQLWQNSY  323
                   S QQLWQNSY
Sbjct  843   GQPSNQSQQQLWQNSY  858



>ref|XP_010478296.1| PREDICTED: probable serine/threonine-protein kinase yakA [Camelina 
sativa]
Length=845

 Score =   193 bits (490),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 164/263 (62%), Gaps = 42/263 (16%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q  A++LP
Sbjct  591   ALPQQLPMHPYSQPTLPLTHYANMISYPVMPQNYPYMPSAFQQTF-GNSSYHQLAASLLP  649

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +   GSFP+N  +AP+ T+LG +D LSSQYK
Sbjct  650   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGSFPVNQQSAPTGTALGYEDVLSSQYK  709

Query  658   DNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---  524
             +++HL++LQQ             ENS MW HGHGSRTMS  PANTYYN+QAQ Q      
Sbjct  710   ESNHLLALQQQQQQQQQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQLHQQ  769

Query  523   ----------------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  392
                             G+RQ QQ  Q+Y S GY PNFY SQT +SL+   QQQNPRDG  
Sbjct  770   LQQQQQQQQQNQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDGAG  825

Query  391   ggggGNAQVQPKPSSQQLWQNSY  323
                GG    Q   + QQLWQNSY
Sbjct  826   SQAGGQQSNQ---TQQQLWQNSY  845



>ref|XP_010499452.1| PREDICTED: RNA polymerase II degradation factor 1-like [Camelina 
sativa]
Length=842

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 163/261 (62%), Gaps = 41/261 (16%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q  A++LP
Sbjct  591   ALPQQLPMHPYSQPTLPLTHYANMISYPVMPQNYPYMPSAFQQTF-GNSSYHQLAASLLP  649

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +    SFPLN  +AP+ T+LG +D LSSQYK
Sbjct  650   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAASFPLNQQSAPTGTTLGYEDVLSSQYK  709

Query  658   DNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---  524
             +++HL++LQQ             ENS MW HGHGSRTMS  PANTYYN+QAQ Q      
Sbjct  710   ESNHLLALQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQLHQQ  769

Query  523   --------------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgg  386
                           G+RQ QQ  Q+Y S GY PNFY SQT +SL+   QQQ+PRDG    
Sbjct  770   LQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE--RQQQSPRDG----  821

Query  385   ggGNAQVQPKPSSQQLWQNSY  323
              G  A  Q   + QQLWQNSY
Sbjct  822   AGSQAGQQSNQTQQQLWQNSY  842



>ref|XP_010540528.1| PREDICTED: uncharacterized protein LOC104814266 [Tarenaya hassleriana]
Length=832

 Score =   192 bits (487),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 160/244 (66%), Gaps = 29/244 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQ LA+HPYSQPTLPL  F N++ YP + QSY YMP  FQQ FAGNS+Y QSLAA+LP 
Sbjct  602   LPQQLAMHPYSQPTLPLTHFPNMMGYPLLPQSYPYMPSAFQQAFAGNSSYHQSLAALLPQ  661

Query  826   YKNSVSVSSLPHFAT--VPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYK  659
             YKN +S SSLP  AT    S YG FGN+  +  G++PLN  AAPS T+LG +D LSSQYK
Sbjct  662   YKNHISASSLPQSATGGAASAYG-FGNSSNVGIGNYPLNQPAAPSGTTLGYEDVLSSQYK  720

Query  658   DNHHLMSLQQV-----ENSGMWL-HGHGSRTMSAAPANTYYN---IQAQNQQPSGFR--Q  512
             +++HL+SLQQ      ENSGMW+ HG  SRTM A P+NTYYN    Q   Q  SG+R   
Sbjct  721   ESNHLLSLQQQQQQQNENSGMWIHHGSASRTMPAVPSNTYYNHLQAQQNQQASSGYRQAA  780

Query  511   VQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLW  335
              QQ   +Y SLGY PNFY SQTG+      +QQN   GP        Q QP K + QQ+W
Sbjct  781   SQQQQHHYGSLGY-PNFYQSQTGMMA---MEQQNRDGGP--------QGQPSKQNQQQMW  828

Query  334   QNSY  323
              NSY
Sbjct  829   PNSY  832



>ref|XP_010460715.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X2 [Camelina sativa]
Length=842

 Score =   192 bits (487),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 135/262 (52%), Positives = 162/262 (62%), Gaps = 42/262 (16%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q  A++LP
Sbjct  590   ALPQQLPMHPYSQPTLPLTHYANMISYPVMPQNYPYMPSAFQQTF-GNSSYHQLAASLLP  648

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +    SFPLN  +AP+ T+L  +D LSSQYK
Sbjct  649   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAASFPLNQQSAPTGTTLDYEDVLSSQYK  708

Query  658   DNHHLMSLQQV---------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  524
             +++HL++LQQ                ENS MW HGHGSRTMS  PANTYYN+QAQ Q   
Sbjct  709   ESNHLLALQQQQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQL  768

Query  523   ---------------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLg  389
                            G+RQ QQ  Q+Y S GY PNFY SQT +SL+   QQQNPRDG   
Sbjct  769   HQQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG---  821

Query  388   gggGNAQVQPKPSSQQLWQNSY  323
               G  A  Q   + QQLWQNSY
Sbjct  822   -AGSQAGQQSNQTQQQLWQNSY  842



>emb|CDY15632.1| BnaA07g08030D [Brassica napus]
Length=786

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 155/232 (67%), Gaps = 26/232 (11%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP
Sbjct  578   ALPQQLPMHPYSQPTIPLAHFANMLGYPLMPQNYPYMPSAFPQTFAGNSLYQQQLAALLP  637

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDN  653
              YK ++S S+LPH AT         N G+  G+FPLN  SA P T++G +D   +QYK++
Sbjct  638   QYKTNLSPSNLPHSATAL-------NVGSA-GNFPLNQQSAPPGTTMGYED---AQYKES  686

Query  652   HHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             +HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ     +  Q  Q+Y S G
Sbjct  687   NHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ---QLRQAQQQQHYGSHG  743

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKPSSQQLWQNSY  323
             Y PN+Y SQT +S  H  QQQNPRDG        AQ  QP   +QQLWQNSY
Sbjct  744   Y-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSNQTQQLWQNSY  786



>ref|NP_174229.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE31075.1| uncharacterized protein AT1G29350 [Arabidopsis thaliana]
Length=831

 Score =   192 bits (487),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 158/257 (61%), Gaps = 39/257 (15%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  586   ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  644

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +   G+FPLN  SA   T+LG +D LSSQYK
Sbjct  645   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYK  704

Query  658   DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  524
             +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  705   EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  763

Query  523   ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  371
                      G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPRDG     G   
Sbjct  764   QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPRDGAGSQAG---  816

Query  370   QVQP-KPSSQQLWQNSY  323
               QP   S QQLWQNSY
Sbjct  817   --QPSNQSQQQLWQNSY  831



>ref|XP_010460714.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X1 [Camelina sativa]
Length=843

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 135/262 (52%), Positives = 162/262 (62%), Gaps = 42/262 (16%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q  A++LP
Sbjct  591   ALPQQLPMHPYSQPTLPLTHYANMISYPVMPQNYPYMPSAFQQTF-GNSSYHQLAASLLP  649

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +    SFPLN  +AP+ T+L  +D LSSQYK
Sbjct  650   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAASFPLNQQSAPTGTTLDYEDVLSSQYK  709

Query  658   DNHHLMSLQQV---------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  524
             +++HL++LQQ                ENS MW HGHGSRTMS  PANTYYN+QAQ Q   
Sbjct  710   ESNHLLALQQQQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQL  769

Query  523   ---------------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLg  389
                            G+RQ QQ  Q+Y S GY PNFY SQT +SL+   QQQNPRDG   
Sbjct  770   HQQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG---  822

Query  388   gggGNAQVQPKPSSQQLWQNSY  323
               G  A  Q   + QQLWQNSY
Sbjct  823   -AGSQAGQQSNQTQQQLWQNSY  843



>gb|AAG51729.1|AC068667_8 unknown protein; 16040-11188 [Arabidopsis thaliana]
Length=858

 Score =   191 bits (486),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 158/257 (61%), Gaps = 39/257 (15%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  613   ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  671

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +   G+FPLN  SA   T+LG +D LSSQYK
Sbjct  672   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYK  731

Query  658   DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  524
             +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  732   EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  790

Query  523   ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  371
                      G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPRDG     G   
Sbjct  791   QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPRDGAGSQAG---  843

Query  370   QVQP-KPSSQQLWQNSY  323
               QP   S QQLWQNSY
Sbjct  844   --QPSNQSQQQLWQNSY  858



>emb|CDX99817.1| BnaC05g22390D [Brassica napus]
Length=620

 Score =   190 bits (482),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 154/243 (63%), Gaps = 34/243 (14%)
 Frame = -1

Query  1009  ALPQH-LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTY-QQSLAAV  836
             ALPQ  L +HPYSQPT+PL  FAN+ISYP M Q+Y YMP  FQQ FA NS+Y QQ LAA+
Sbjct  398   ALPQQQLPMHPYSQPTMPLAHFANMISYPMMPQNYPYMPSAFQQAFASNSSYHQQQLAAL  457

Query  835   LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQY  662
             LP YK ++S S+LP   T P+    FGN+ ++   G+FPLN  +AP+   G +D LSSQY
Sbjct  458   LPQYKANLSPSNLPQSGTAPASAYGFGNSTSVGSAGNFPLNQQSAPT---GYEDVLSSQY  514

Query  661   KDNHHLMSLQQV---------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQV  509
             K+N HL++LQQ          +NS MW HGHGSRTMS  PAN YYN+Q Q       +  
Sbjct  515   KENSHLLALQQQQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYYNLQQQ------QQLQ  568

Query  508   QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLWQ  332
             Q   Q Y S GY PNFY SQT +S  H  QQQNPRDG        A  QP   + QQLWQ
Sbjct  569   QAQQQQYGSHGY-PNFYQSQTEMS--HERQQQNPRDG--------AGAQPSNQTQQQLWQ  617

Query  331   NSY  323
             NSY
Sbjct  618   NSY  620



>ref|XP_009102863.1| PREDICTED: uncharacterized protein LOC103828968 isoform X3 [Brassica 
rapa]
Length=639

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 153/232 (66%), Gaps = 26/232 (11%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP
Sbjct  431   ALPQQLPMHPYSQPTIPLAHFANMLGYPPMPQNYPYMPSAFPQTFAGNSLYQQQLAALLP  490

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDN  653
              YK ++S S+LPH AT         N G+  G+FPLN  SA P T++G +D   +QYK++
Sbjct  491   QYKTNLSPSNLPHSATAL-------NVGSA-GNFPLNQQSAPPGTTMGYED---AQYKES  539

Query  652   HHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             +HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ        +  Q  Q+Y S G
Sbjct  540   NHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQ---QQQLRQAQQQQHYGSHG  596

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKPSSQQLWQNSY  323
             Y PN+Y SQT +S  H  QQQNPRDG        AQ  QP   +QQLWQNSY
Sbjct  597   Y-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSNQTQQLWQNSY  639



>emb|CDY48333.1| BnaA09g26880D [Brassica napus]
Length=823

 Score =   189 bits (480),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 158/246 (64%), Gaps = 32/246 (13%)
 Frame = -1

Query  1009  ALPQH-LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTY-QQSLAAV  836
             ALPQ  L +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ FAGNS+Y QQ LAA+
Sbjct  593   ALPQQQLPMHPYSQPTMPLAHFANMISYPMIPQNYPYMPSAFQQAFAGNSSYHQQQLAAL  652

Query  835   LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQY  662
             LP YK ++S S+LP   T P+    FGN+  +   G+FPLN  +AP+   G +D LSSQY
Sbjct  653   LPQYKANLSPSTLPQSGTAPASPYGFGNSTNVGSAGNFPLNQQSAPT---GYEDVLSSQY  709

Query  661   KDNHHLMSLQQV------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS------GF  518
             K+N HL++LQQ       +NS MW HGHGSRTMS  PAN YYN+Q Q Q         G+
Sbjct  710   KENSHLLALQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYYNLQQQQQLQQAQQAAGGY  769

Query  517   RQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQ  341
             RQ QQ  Q Y S GY PNFY SQT +S  H  QQQNPRD         A  QP   + QQ
Sbjct  770   RQAQQ-QQQYGSHGY-PNFYQSQTEMS--HERQQQNPRDA--------AGAQPSNQTQQQ  817

Query  340   LWQNSY  323
             LWQNSY
Sbjct  818   LWQNSY  823



>ref|XP_009102862.1| PREDICTED: uncharacterized protein LOC103828968 isoform X2 [Brassica 
rapa]
Length=782

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 155/232 (67%), Gaps = 26/232 (11%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP
Sbjct  574   ALPQQLPMHPYSQPTIPLAHFANMLGYPPMPQNYPYMPSAFPQTFAGNSLYQQQLAALLP  633

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDN  653
              YK ++S S+LPH AT         N G+  G+FPLN  SA P T++G +D   +QYK++
Sbjct  634   QYKTNLSPSNLPHSATAL-------NVGSA-GNFPLNQQSAPPGTTMGYED---AQYKES  682

Query  652   HHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             +HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ     +  Q  Q+Y S G
Sbjct  683   NHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ---QLRQAQQQQHYGSHG  739

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKPSSQQLWQNSY  323
             Y PN+Y SQT +S  H  QQQNPRDG        AQ  QP   +QQLWQNSY
Sbjct  740   Y-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSNQTQQLWQNSY  782



>ref|XP_009102861.1| PREDICTED: uncharacterized protein LOC103828968 isoform X1 [Brassica 
rapa]
Length=783

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 155/232 (67%), Gaps = 26/232 (11%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP
Sbjct  575   ALPQQLPMHPYSQPTIPLAHFANMLGYPPMPQNYPYMPSAFPQTFAGNSLYQQQLAALLP  634

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDN  653
              YK ++S S+LPH AT         N G+  G+FPLN  SA P T++G +D   +QYK++
Sbjct  635   QYKTNLSPSNLPHSATAL-------NVGSA-GNFPLNQQSAPPGTTMGYED---AQYKES  683

Query  652   HHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  476
             +HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ     +  Q  Q+Y S G
Sbjct  684   NHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ---QLRQAQQQQHYGSHG  740

Query  475   YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKPSSQQLWQNSY  323
             Y PN+Y SQT +S  H  QQQNPRDG        AQ  QP   +QQLWQNSY
Sbjct  741   Y-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSNQTQQLWQNSY  783



>ref|XP_006646178.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like, partial 
[Oryza brachyantha]
Length=780

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 154/242 (64%), Gaps = 26/242 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA----  839
             LPQ L+VHPYSQPTLPLGPF+N++ YP++ Q+Y      FQQP++ N  + QS A     
Sbjct  551   LPQQLSVHPYSQPTLPLGPFSNLVGYPYLPQNYYLPSAAFQQPYSSNGPFHQSAATNAVP  610

Query  838   ------VLPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN---PSAAPSTSLGI  686
                    +P YK+S+  +S P  ++V SG+G FG++ +IPG+F LN   PSAA  TS+G 
Sbjct  611   GVNMKYSVPQYKSSLPATSPPQPSSVVSGFGGFGSSTSIPGNFGLNQNVPSAA--TSMGF  668

Query  685   DDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQV  509
             D+ LS+Q+KDN H ++LQQ +NS MWL G  GSR +SA P   +Y  Q QN QP GFRQ 
Sbjct  669   DEALSAQFKDNSHYIALQQSDNSAMWLQGAAGSRAVSAVPPGNFYGFQGQN-QPGGFRQG  727

Query  508   QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  329
             QQPSQ Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S QLWQ+
Sbjct  728   QQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLPEGTL----NSSQTAPSQPSHQLWQH  778

Query  328   SY  323
              Y
Sbjct  779   IY  780



>dbj|BAD72339.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72382.1| TA9 protein-like [Oryza sativa Japonica Group]
Length=371

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 149/242 (62%), Gaps = 26/242 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LPQ L+VHPY QPTLPLGPF+N++ YP++ Q+Y      FQQ F+ N  + QS A     
Sbjct  142   LPQQLSVHPYPQPTLPLGPFSNLVGYPYLPQNYYLPSAAFQQSFSSNGPFHQSAATTGVP  201

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN---PSAAPSTSLGI  686
                    +P YK S+  +S P  ++V SG+G FG++  IPG+F LN   PSA   T++G 
Sbjct  202   GVSMKYSMPQYKGSLPATSPPQPSSVVSGFGGFGSSNNIPGNFGLNQNVPSAP--TTMGF  259

Query  685   DDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQV  509
             ++ LS+Q+KDN   ++LQQ +NS MWLHG  GSR +SA P   +Y  Q QN QP GFRQ 
Sbjct  260   EEALSTQFKDNSQYIALQQNDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPGGFRQG  318

Query  508   QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  329
             QQPSQ Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S Q+WQ+
Sbjct  319   QQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSHQIWQH  369

Query  328   SY  323
              Y
Sbjct  370   IY  371



>ref|XP_009115248.1| PREDICTED: putative uncharacterized protein DDB_G0271606 [Brassica 
rapa]
Length=859

 Score =   182 bits (462),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 156/246 (63%), Gaps = 32/246 (13%)
 Frame = -1

Query  1009  ALPQH-LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTY-QQSLAAV  836
             ALPQ  L + PYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ FAGNS+Y QQ LAA+
Sbjct  629   ALPQQQLPMRPYSQPTMPLAHFANMISYPMIPQNYPYMPSAFQQAFAGNSSYHQQQLAAL  688

Query  835   LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQY  662
             LP YK ++S S+LP   T P+    FGN+  +   G+FPLN  +AP+   G +D LSSQY
Sbjct  689   LPQYKANLSPSTLPQSGTAPASAYGFGNSTNVGSAGNFPLNQQSAPT---GYEDVLSSQY  745

Query  661   KDNHHLMSLQQV------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS------GF  518
             K+N +L++LQQ       +NS MW HGHGSRTMS  PAN Y+N+Q Q Q         G+
Sbjct  746   KENSNLLALQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYFNLQQQQQLQQAQQAAGGY  805

Query  517   RQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQ  341
             RQ QQ  Q Y S GY PNFY SQT   + H  QQQNPRD         A  QP   + QQ
Sbjct  806   RQAQQ-QQQYGSHGY-PNFYQSQT--EMPHERQQQNPRDA--------AGAQPSNQTQQQ  853

Query  340   LWQNSY  323
             LWQNSY
Sbjct  854   LWQNSY  859



>ref|XP_009141365.1| PREDICTED: RNA polymerase II degradation factor 1-like [Brassica 
rapa]
Length=819

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 156/241 (65%), Gaps = 25/241 (10%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  824
             PQ L +HPYSQ T+PL  FAN+ISYP M Q Y YMP  FQQ F+GNS+Y QS AA+LP Y
Sbjct  590   PQQLPMHPYSQHTVPLTHFANMISYPLMPQGYPYMPSAFQQAFSGNSSYHQSPAALLPQY  649

Query  823   KNSVSVSSLPHFATVPSGYGAFGNTGTI-PGSFPLN-PSAAPS-TSLGIDDGLSSQYKDN  653
             KN++S SSLP  A + S YG FGN+  +  G+F LN   AAP+ T+L  +D +S QYK N
Sbjct  650   KNNISPSSLPQSAPISSPYG-FGNSSNVGAGNFSLNQQQAAPTGTTLSYEDVMSLQYKQN  708

Query  652   HHLMSLQQV---------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              HL+SLQQ          ENS +WLHG GS+TMS   +N YYN+QAQ Q     +  QQ 
Sbjct  709   SHLLSLQQQQQQQQQQQNENSPVWLHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQA  768

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS--QQLWQNS  326
                Y SLGY PN+Y SQTG+S++  HQQ+NPR+G        +Q QP   +  Q LWQNS
Sbjct  769   QHQYGSLGY-PNYYQSQTGMSME--HQQRNPREG-------GSQGQPSKQTPQQHLWQNS  818

Query  325   Y  323
             Y
Sbjct  819   Y  819



>gb|KJB57296.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=677

 Score =   179 bits (454),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTY+P  FQQ FAGNS Y QSLAAVLP
Sbjct  540   ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYVPSAFQQGFAGNSNYPQSLAAVLP  599

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
              YKNSVSVSSLP  A + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  600   QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  658

Query  652   HHLMSLQQVEN  620
             +HLMSLQQV N
Sbjct  659   NHLMSLQQVIN  669



>gb|AAL58943.1|AF462857_1 At1g29350/F15D2_27 [Arabidopsis thaliana]
Length=832

 Score =   179 bits (455),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 144/229 (63%), Gaps = 33/229 (14%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  586   ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  644

Query  829   NYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  659
              YK +VS  +LP  AT P+    FGN+  +   G+FPLN  SA   T+LG +D LSSQYK
Sbjct  645   QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYK  704

Query  658   DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  524
             +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  705   EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  763

Query  523   ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  404
                      G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPR
Sbjct  764   QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPR  808



>ref|NP_001043788.1| Os01g0663800 [Oryza sativa Japonica Group]
 dbj|BAD72338.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72381.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAF05702.1| Os01g0663800 [Oryza sativa Japonica Group]
 gb|EEE55130.1| hypothetical protein OsJ_02914 [Oryza sativa Japonica Group]
Length=851

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 149/242 (62%), Gaps = 26/242 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LPQ L+VHPY QPTLPLGPF+N++ YP++ Q+Y      FQQ F+ N  + QS A     
Sbjct  622   LPQQLSVHPYPQPTLPLGPFSNLVGYPYLPQNYYLPSAAFQQSFSSNGPFHQSAATTGVP  681

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN---PSAAPSTSLGI  686
                    +P YK S+  +S P  ++V SG+G FG++  IPG+F LN   PSA   T++G 
Sbjct  682   GVSMKYSMPQYKGSLPATSPPQPSSVVSGFGGFGSSNNIPGNFGLNQNVPSAP--TTMGF  739

Query  685   DDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQV  509
             ++ LS+Q+KDN   ++LQQ +NS MWLHG  GSR +SA P   +Y  Q QN QP GFRQ 
Sbjct  740   EEALSTQFKDNSQYIALQQNDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPGGFRQG  798

Query  508   QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  329
             QQPSQ Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S Q+WQ+
Sbjct  799   QQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSHQIWQH  849

Query  328   SY  323
              Y
Sbjct  850   IY  851



>ref|XP_009395691.1| PREDICTED: mucin-17-like [Musa acuminata subsp. malaccensis]
Length=910

 Score =   178 bits (452),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 150/238 (63%), Gaps = 21/238 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS------  848
             +LPQHL V  YSQP LPL  FAN++SY F+ QSY Y+P  FQQ +A NS + QS      
Sbjct  685   SLPQHLPVR-YSQPALPLSHFANMMSYSFLPQSYPYLP-SFQQAYAANSPFHQSHHVAPS  742

Query  847   --LAAVLPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  677
               ++   P +K+S+S +SLP  +++ S YG FG+  +IPG F LN  +A+ +T+ G+ + 
Sbjct  743   AGMSYSQPQFKSSLSATSLPQVSSIASAYGGFGSAASIPGGFTLNHTTASANTTTGLGEA  802

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             LS QYK+  H M LQQ EN  MW+ G GSRTMSA PANT+YN Q  NQQ SGFRQ  Q S
Sbjct  803   LSLQYKEGSHYMPLQQNENPAMWVQGAGSRTMSALPANTFYNYQGHNQQ-SGFRQNLQAS  861

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
                 +LGY PN Y SQ G S +H   QQ+P DG L G     Q QP   + Q+WQ+ Y
Sbjct  862   P-LGALGY-PNLYLSQGGPSREH---QQSPSDGNLNGSQA-TQSQP---ANQIWQHGY  910



>emb|CDX90188.1| BnaA08g17960D [Brassica napus]
Length=822

 Score =   177 bits (450),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 159/250 (64%), Gaps = 32/250 (13%)
 Frame = -1

Query  1009  ALPQHL-AVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  833
             ALPQ L  +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ +AGN++Y Q LAA+L
Sbjct  584   ALPQQLPQMHPYSQPTMPLAHFANMISYPLIPQNYPYMPSAFQQTYAGNTSYHQQLAALL  643

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQY  662
             P YK ++S S+LP  AT P+    FGN  T  GS   FPLN   +  T  G +D LSSQY
Sbjct  644   PQYKTNLSSSNLPQSATAPASAYGFGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQY  701

Query  661   KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------G  521
             K+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ QQ          G
Sbjct  702   KESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGG  761

Query  520   FR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV---QPKP  353
             +R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG        AQV       
Sbjct  762   YRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG------AGAQVGQQPSDQ  812

Query  352   SSQQLWQNSY  323
             + QQLWQNSY
Sbjct  813   TQQQLWQNSY  822



>ref|XP_009109668.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Brassica rapa]
Length=823

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 159/250 (64%), Gaps = 32/250 (13%)
 Frame = -1

Query  1009  ALPQHL-AVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  833
             ALPQ L  +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ +AGN++Y Q LAA+L
Sbjct  585   ALPQQLPQMHPYSQPTMPLAHFANMISYPLIPQNYPYMPSAFQQTYAGNTSYHQQLAALL  644

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQY  662
             P YK ++S S+LP  AT P+    FGN  T  GS   FPLN   +  T  G +D LSSQY
Sbjct  645   PQYKTNLSSSNLPQSATAPASAYGFGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQY  702

Query  661   KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------G  521
             K+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ QQ          G
Sbjct  703   KESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGG  762

Query  520   FR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV---QPKP  353
             +R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG        AQV       
Sbjct  763   YRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG------AGAQVGQQPSDQ  813

Query  352   SSQQLWQNSY  323
             + QQLWQNSY
Sbjct  814   TQQQLWQNSY  823



>ref|XP_009109669.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Brassica rapa]
Length=822

 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 159/250 (64%), Gaps = 32/250 (13%)
 Frame = -1

Query  1009  ALPQHL-AVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  833
             ALPQ L  +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ +AGN++Y Q LAA+L
Sbjct  584   ALPQQLPQMHPYSQPTMPLAHFANMISYPLIPQNYPYMPSAFQQTYAGNTSYHQQLAALL  643

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQY  662
             P YK ++S S+LP  AT P+    FGN  T  GS   FPLN   +  T  G +D LSSQY
Sbjct  644   PQYKTNLSSSNLPQSATAPASAYGFGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQY  701

Query  661   KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------G  521
             K+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ QQ          G
Sbjct  702   KESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGG  761

Query  520   FR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV---QPKP  353
             +R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG        AQV       
Sbjct  762   YRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG------AGAQVGQQPSDQ  812

Query  352   SSQQLWQNSY  323
             + QQLWQNSY
Sbjct  813   TQQQLWQNSY  822



>emb|CDY43334.1| BnaC03g59060D [Brassica napus]
Length=822

 Score =   177 bits (448),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 160/248 (65%), Gaps = 30/248 (12%)
 Frame = -1

Query  1009  ALPQHL-AVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  833
             ALPQ L  +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ +AGN++Y Q LAA+L
Sbjct  586   ALPQQLPQMHPYSQPTMPLAHFANMISYPLIPQNYPYMPSAFQQTYAGNTSYHQQLAALL  645

Query  832   PNYKNSVSVSSLPHFATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYK  659
             P YK ++S S+LP  AT P+    FGN+  +   G+FP+N   +  T  G +D LSSQYK
Sbjct  646   PQYKTNLSPSNLPQSATAPASAYGFGNSTNVGSAGNFPINQQQSAPT--GYEDVLSSQYK  703

Query  658   DNHHLMSLQQV----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------GFR  515
             +++HL++LQ      ENS MW HGHGSRTMS  PANTYYN+QAQ QQ          G+R
Sbjct  704   ESNHLLALQHQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGGYR  763

Query  514   -QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV---QPKPSS  347
                QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG        AQV       + 
Sbjct  764   QAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG------AGAQVGQQTSDQTQ  814

Query  346   QQLWQNSY  323
             QQLWQNSY
Sbjct  815   QQLWQNSY  822



>gb|EEC71225.1| hypothetical protein OsI_03160 [Oryza sativa Indica Group]
Length=732

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 150/242 (62%), Gaps = 26/242 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LPQ L+VHPY QPTLPLGPF+N++ YP++ Q+Y      FQQ F+ N  + QS A     
Sbjct  503   LPQQLSVHPYPQPTLPLGPFSNLVGYPYLPQNYYLPSAAFQQSFSSNGPFHQSAATTGVP  562

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN---PSAAPSTSLGI  686
                    +P YK+S+  +S P  ++V SG+G FG++  IPG+F LN   PSA   T++G 
Sbjct  563   GVSMKYSMPQYKSSLPATSPPQPSSVVSGFGGFGSSNNIPGNFGLNQNVPSAP--TTMGF  620

Query  685   DDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQV  509
             ++ LS+Q+KDN   ++LQQ ++S MWLHG  GSR +SA P   +Y  Q QN QP GFRQ 
Sbjct  621   EEALSTQFKDNSQYIALQQNDSSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPGGFRQG  679

Query  508   QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  329
             QQPSQ Y  LGY+ +FY SQ G+  +H    QN  +G L     ++Q  P   S Q+WQ+
Sbjct  680   QQPSQ-YGGLGYS-SFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSHQIWQH  730

Query  328   SY  323
              Y
Sbjct  731   IY  732



>emb|CDY43685.1| BnaA04g20060D [Brassica napus]
Length=830

 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 156/243 (64%), Gaps = 27/243 (11%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  824
             PQ L +HPYSQ T+PL  FAN+ISYP M Q Y YMP  FQQ F+GNS+Y QS AA+LP Y
Sbjct  599   PQQLPMHPYSQHTVPLTHFANMISYPLMPQGYPYMPSAFQQAFSGNSSYHQSPAALLPQY  658

Query  823   KNSVSVSSLPHFATVPSGYGAFGNTGTI-PGSFPLN----PSAAPS-TSLGIDDGLSSQY  662
             KN++S SSLP  A + S YG FGN+  +  G+F LN      AAP+  +L  +D +S QY
Sbjct  659   KNNISPSSLPQSAPISSPYG-FGNSSNVGTGNFSLNQQQQQQAAPTGATLSYEDVMSLQY  717

Query  661   KDNHHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  506
             K N HL+SLQQ         ENS +WLHG GS+TMS   +N YYN+QAQ Q     +  Q
Sbjct  718   KQNSHLLSLQQQQQQQQQQNENSPVWLHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQ  777

Query  505   QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS--QQLWQ  332
             Q  Q Y SLGY PN+Y SQTG+S++  +QQ+NPR+G        +Q QP   +  Q LWQ
Sbjct  778   QAQQQYGSLGY-PNYYQSQTGMSME--YQQRNPREG-------GSQGQPSKQTPQQHLWQ  827

Query  331   NSY  323
             NSY
Sbjct  828   NSY  830



>ref|XP_009394232.1| PREDICTED: uncharacterized protein LOC103979756 [Musa acuminata 
subsp. malaccensis]
Length=884

 Score =   174 bits (441),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 151/239 (63%), Gaps = 21/239 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
               PQ+L VH YSQP LPLG FANIISYP++  SY Y+P    Q F  NS + Q  AAV  
Sbjct  657   VFPQNLPVHHYSQPALPLGHFANIISYPYLPHSYAYLP-SVHQAFTTNSPFHQPTAAVPS  715

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  677
                    P Y++S+SV+SLP  + + S YG FG++  +PG + LN  SA+ +T +G+D+ 
Sbjct  716   AGMKYSQPQYRSSLSVASLPQASAIGSAYGGFGSSANVPGGYTLNHTSASTNTMIGLDEA  775

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             L+ Q+++  H + LQQ EN  MW+HG GSRTMSA P +T+YN   QNQ  SGFRQ QQ S
Sbjct  776   LNLQHREASHHVPLQQSENPAMWIHGGGSRTMSALPTSTFYNYPGQNQH-SGFRQTQQ-S  833

Query  496   QNYASLGYNPNFYH-SQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              +  +LGY PN +H +Q G S +H   QQN  DG + G      VQ +P++ Q+WQ+ Y
Sbjct  834   SHLGALGY-PNLHHDAQAGPSQEH---QQNLSDGNMSGSQT---VQSQPAN-QIWQHGY  884



>gb|KHN22963.1| hypothetical protein glysoja_030633 [Glycine soja]
Length=980

 Score =   172 bits (436),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQHLA+HPYSQP+LPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP 
Sbjct  574   LPQHLAMHPYSQPSLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLPQ  633

Query  826   YKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
             YKN+VS SSLP  A +P GYG FG++ +IP GSF LNP AAP+ T++G +D ++SQ+KDN
Sbjct  634   YKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGSFSLNPPAAPTGTTIGYEDVINSQFKDN  692

Query  652   HHLMSLQQVENSGMWLH  602
             +H+MSLQQ   +   +H
Sbjct  693   NHMMSLQQFTCTTSSIH  709



>emb|CDY61562.1| BnaCnng37970D [Brassica napus]
Length=762

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 156/243 (64%), Gaps = 34/243 (14%)
 Frame = -1

Query  1000 QHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYK  821
            Q L +HPYSQ T+PL  FAN++SYP M QSY YMP      FAGNS Y  SLAA+LP YK
Sbjct  537  QQLPMHPYSQHTVPLTHFANMMSYPLMPQSYPYMP------FAGNSPYHPSLAALLPQYK  590

Query  820  NSVSVSSLPHFAT---VPSGYGAFGNTGTI-PGSFPLNPS-----AAPS-TSLGIDDGLS  671
            N+VS S+LP   T   + S YG FGN+  + PG+FPLN       AAP+  +L  +D +S
Sbjct  591  NNVSASNLPQSVTSAPISSAYG-FGNSNNVGPGNFPLNQQQQQQQAAPTGATLSYEDIMS  649

Query  670  SQYKDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  506
             QYK N+HL+SLQQ      +NS +W+HG GS+TMS   +N YY++QAQ Q     +  Q
Sbjct  650  LQYKQNNHLLSLQQQQQQQNDNSPLWVHGPGSQTMSGVQSNAYYSLQAQQQAQQLRQAQQ  709

Query  505  QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ--LWQ  332
            +  Q Y SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q QP   +QQ  LWQ
Sbjct  710  EAQQQYGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQPSKQTQQQHLWQ  759

Query  331  NSY  323
            NSY
Sbjct  760  NSY  762



>ref|XP_009396491.1| PREDICTED: uncharacterized protein LOC103981474 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=885

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 146/241 (61%), Gaps = 23/241 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSYTYMPPGFQQPFAGNSTYQQSLAAV-  836
             AL QHL V  YSQP LPLG FAN+ISYP F+ QSYTY+P  FQQ +  NS + QS  AV 
Sbjct  656   ALHQHLPVPHYSQPALPLGHFANMISYPPFLPQSYTYLP-SFQQAYTANSPFHQSPGAVP  714

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN--PSAAPSTSLGID  683
                     P +KNS+SV+SLP  + + S YG  GN+  IPG F LN   S + ST+ G D
Sbjct  715   GAGMKYSQPQFKNSLSVTSLPQASAIASAYGGLGNSANIPGGFALNHHTSGSASTTTGFD  774

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  506
             + LS Q K+  H M  QQ EN  +WLH   GSR M A PA+T+YN Q Q+QQ SGFRQ  
Sbjct  775   ESLSLQNKEESHYMPPQQSENPNLWLHSAAGSRAMPALPASTFYNYQGQSQQ-SGFRQSP  833

Query  505   QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNS  326
             Q S +  +LGY PN YHS  G+S +H   QQN  +G L  G    Q  P   + Q+WQ+ 
Sbjct  834   QAS-HLGALGY-PNLYHSPAGLSREH---QQNTGEGNL-NGPPTTQAHP---ANQIWQHG  884

Query  325   Y  323
             Y
Sbjct  885   Y  885



>ref|XP_009396490.1| PREDICTED: uncharacterized protein LOC103981474 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 146/241 (61%), Gaps = 23/241 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSYTYMPPGFQQPFAGNSTYQQSLAAV-  836
             AL QHL V  YSQP LPLG FAN+ISYP F+ QSYTY+P  FQQ +  NS + QS  AV 
Sbjct  657   ALHQHLPVPHYSQPALPLGHFANMISYPPFLPQSYTYLP-SFQQAYTANSPFHQSPGAVP  715

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLN--PSAAPSTSLGID  683
                     P +KNS+SV+SLP  + + S YG  GN+  IPG F LN   S + ST+ G D
Sbjct  716   GAGMKYSQPQFKNSLSVTSLPQASAIASAYGGLGNSANIPGGFALNHHTSGSASTTTGFD  775

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  506
             + LS Q K+  H M  QQ EN  +WLH   GSR M A PA+T+YN Q Q+QQ SGFRQ  
Sbjct  776   ESLSLQNKEESHYMPPQQSENPNLWLHSAAGSRAMPALPASTFYNYQGQSQQ-SGFRQSP  834

Query  505   QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNS  326
             Q S +  +LGY PN YHS  G+S +H   QQN  +G L  G    Q  P   + Q+WQ+ 
Sbjct  835   QAS-HLGALGY-PNLYHSPAGLSREH---QQNTGEGNL-NGPPTTQAHP---ANQIWQHG  885

Query  325   Y  323
             Y
Sbjct  886   Y  886



>ref|XP_006410567.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52020.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=842

 Score =   169 bits (427),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 140/226 (62%), Gaps = 29/226 (13%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQ T+PL  FAN+I YP M QSY YMP  FQQ FAGNS+Y QSLAA+LP
Sbjct  604   ALPQQLPMHPYSQHTVPLAHFANMIGYPLMPQSYPYMPSAFQQAFAGNSSYHQSLAALLP  663

Query  829   NYKNSVSVSSLPHFAT---VPSGYGAFGNTGTI-PGSFPLN----PSAAPSTSLGIDDGL  674
              YKN++S S++P  AT     S YG FGN+     G++PLN     SA    SL  +D L
Sbjct  664   QYKNNISASNVPQSATSAPTSSAYG-FGNSSNAGAGNYPLNHQQQQSAPSGASLSYEDAL  722

Query  673   SSQYKDNHHLMSLQQV-------------ENSGMWLHGHGSRTMSAAPANTYYNI-QAQN  536
             S QYK N+HL+SLQQ              ENS MWLHG GS+TMS  P+NTYYN+   Q 
Sbjct  723   SLQYKQNNHLLSLQQQQQLQQQQLQQQQNENSPMWLHGPGSQTMSGVPSNTYYNLQAQQQ  782

Query  535   QQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  398
              Q     Q Q   Q Y SLGY PN+Y SQT       HQQQNPRDG
Sbjct  783   AQQVRQAQQQAQQQQYGSLGY-PNYYQSQT-----MEHQQQNPRDG  822



>ref|XP_006410569.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52022.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=840

 Score =   169 bits (427),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 140/226 (62%), Gaps = 29/226 (13%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQ T+PL  FAN+I YP M QSY YMP  FQQ FAGNS+Y QSLAA+LP
Sbjct  602   ALPQQLPMHPYSQHTVPLAHFANMIGYPLMPQSYPYMPSAFQQAFAGNSSYHQSLAALLP  661

Query  829   NYKNSVSVSSLPHFAT---VPSGYGAFGNTGTI-PGSFPLN----PSAAPSTSLGIDDGL  674
              YKN++S S++P  AT     S YG FGN+     G++PLN     SA    SL  +D L
Sbjct  662   QYKNNISASNVPQSATSAPTSSAYG-FGNSSNAGAGNYPLNHQQQQSAPSGASLSYEDAL  720

Query  673   SSQYKDNHHLMSLQQV-------------ENSGMWLHGHGSRTMSAAPANTYYNI-QAQN  536
             S QYK N+HL+SLQQ              ENS MWLHG GS+TMS  P+NTYYN+   Q 
Sbjct  721   SLQYKQNNHLLSLQQQQQLQQQQLQQQQNENSPMWLHGPGSQTMSGVPSNTYYNLQAQQQ  780

Query  535   QQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  398
              Q     Q Q   Q Y SLGY PN+Y SQT       HQQQNPRDG
Sbjct  781   AQQVRQAQQQAQQQQYGSLGY-PNYYQSQT-----MEHQQQNPRDG  820



>gb|EMT31975.1| Retrovirus-related Pol polyprotein LINE-1 [Aegilops tauschii]
Length=1186

 Score =   169 bits (429),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 154/237 (65%), Gaps = 21/237 (9%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV----  836
             PQ L++HPYSQPTLPLGPFA+++ YP++ Q+Y   P  FQQ ++ N  + QS  A     
Sbjct  961   PQQLSLHPYSQPTLPLGPFASLVGYPYLPQNYYVPPAAFQQAYSSNGPFHQSGGAAVPGS  1020

Query  835   -----LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLS  671
                  +P YK+ + V+S P  ++  SGYG FG++  IP +F  N SA+P+T++GID+ LS
Sbjct  1021  AMKYSMPQYKSGLPVTSPPQHSSAVSGYGGFGSSSNIP-NFGQNQSASPATTMGIDEALS  1079

Query  670   SQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ  494
             SQ+K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q+ Q  GFR+VQQPSQ
Sbjct  1080  SQFKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSAQ-GGFREVQQPSQ  1138

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              Y  LG+ P+FY SQ G+  +H    QNP +G L     ++Q  P   S Q+WQ+SY
Sbjct  1139  -YGGLGH-PSFYQSQNGMQQEH---PQNPAEGSL----NSSQTAPSQPSHQMWQHSY  1186



>emb|CDJ26391.1| unnamed protein product [Triticum aestivum]
Length=845

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/239 (48%), Positives = 154/239 (64%), Gaps = 23/239 (10%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS---LAAV-  836
             PQ L++HPYSQPTLPLGPFA+++ YP++ Q+Y   P  FQQ ++ N  + QS    AAV 
Sbjct  618   PQQLSLHPYSQPTLPLGPFASLVGYPYLPQNYYVPPTAFQQAYSSNGPFHQSGGGGAAVP  677

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDG  677
                    +P YK+ + V S P  ++  SGYG FG++  IP +F  N SA+P+T++GID+ 
Sbjct  678   GSAMKYSMPQYKSGLPVMSPPQHSSAVSGYGGFGSSSNIP-NFGQNQSASPATTMGIDEA  736

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
             LSSQ K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q+ Q  GFR+VQQP
Sbjct  737   LSSQLKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSAQ-GGFREVQQP  795

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ Y  LGY P+FY SQ G+  +H    QNP +G L     ++Q  P   S Q+WQ+SY
Sbjct  796   SQ-YGGLGY-PSFYQSQNGMQQEH---PQNPAEGSL----NSSQTAPSQPSHQMWQHSY  845



>gb|KFK36320.1| hypothetical protein AALP_AA4G107400 [Arabis alpina]
Length=834

 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 147/217 (68%), Gaps = 18/217 (8%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  833
             ALPQ +A+HPYSQP  P+  + N++ YP M QSY YMP  FQQ +AGNS+Y QSLAA +L
Sbjct  600   ALPQQIAMHPYSQPP-PMAHYTNMLGYPLMPQSYPYMPSAFQQAYAGNSSYHQSLAAALL  658

Query  832   PNYKNSVSVSSLPHFATVP---SGYGAFGNTG-TIPGSFPLNPS--AAPST-SLGIDDGL  674
             P YKN++S S+LP   T P   S YG FGN+   + G+FPLN    AAP+  +L  +D L
Sbjct  659   PQYKNNISASNLPQSGTSPATSSAYG-FGNSSNVVAGNFPLNQQQQAAPTGGTLSYEDVL  717

Query  673   SSQYKDNHHLMSLQQVE-----NSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQV  509
             + QYK N+HL+SLQQ +     N  +WLHG GS+TMS   +NTYYN+QAQ Q     +  
Sbjct  718   NLQYKQNNHLLSLQQQQQHQQQNEPVWLHGPGSQTMSGVTSNTYYNLQAQQQAQQLRQAQ  777

Query  508   QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  398
             QQ  Q Y SLGY PN+Y  QTG+S++  HQQQNPRDG
Sbjct  778   QQAQQQYGSLGY-PNYYQPQTGMSME--HQQQNPRDG  811



>ref|NP_001130067.1| uncharacterized protein LOC100191159 [Zea mays]
 gb|ACF78188.1| unknown [Zea mays]
Length=255

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 144/240 (60%), Gaps = 26/240 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A    
Sbjct  30    LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSAPFQQAYSSNGPFHQSAAPAVP  86

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSA-APSTSLGIDD  680
                    +P YK+S   S+LP  +++ SGYG FG+   IPG+F  N  A A  T+LG D+
Sbjct  87    GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPGNFSQNQGAPAAPTTLGFDE  145

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
              L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q   GFRQ  Q
Sbjct  146   ALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQH-GGFRQAHQ  204

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P   S QLWQ+ Y
Sbjct  205   PSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQPSHQLWQHIY  255



>ref|XP_008648655.1| PREDICTED: uncharacterized protein LOC103629266 [Zea mays]
Length=281

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 146/240 (61%), Gaps = 26/240 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A    
Sbjct  56    LPQQLLV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSAPFQQAYSSNGPFHQSAAPAVP  112

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDD  680
                    +P YK+S   S+LP  +++ SGYG FG+   IPG+F  N  AA + T+LG D+
Sbjct  113   GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPGNFSQNQGAAAAPTTLGFDE  171

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
              L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y+ Q Q+Q   GFRQ  Q
Sbjct  172   ALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYDFQGQSQH-GGFRQAHQ  230

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P   S QLWQ+ Y
Sbjct  231   PSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQPSHQLWQHIY  281



>ref|XP_010232108.1| PREDICTED: uncharacterized protein LOC100846506 isoform X2 [Brachypodium 
distachyon]
Length=824

 Score =   160 bits (404),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 144/240 (60%), Gaps = 30/240 (13%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS--------  848
             PQ L VHPYSQP   LGPFA+++ YP++ Q+Y   PP FQQ +A N  + QS        
Sbjct  602   PQQLPVHPYSQPAA-LGPFASLVGYPYLPQNYYVPPPAFQQAYANNGPFHQSGGAAAAAV  660

Query  847   ----LAAVLPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAA-PSTSLGID  683
                 +   +P YK+S+  +S P  ++V  GYG FGN    P +F  N SA+ P T++G+D
Sbjct  661   PGSAMKYSMPQYKSSLPATSPPQHSSVVPGYGGFGN---FP-NFGQNQSASSPGTTMGLD  716

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
             + LS+Q+K+ +H M+LQQ +NS MWLHG  +    A P + +Y  Q QN Q  GFRQ QQ
Sbjct  717   EALSTQFKEANHYMALQQSDNSAMWLHGAAAS--RAVPPSNFYGFQGQNTQ-GGFRQAQQ  773

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ Y  LGY P+FY SQTG+      + QNP +G L     ++Q  P   S Q+WQ+SY
Sbjct  774   PSQ-YGGLGY-PSFYQSQTGMP---QERLQNPTEGSL----NSSQTTPSQPSHQIWQHSY  824



>ref|XP_004961191.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Setaria 
italica]
Length=847

 Score =   160 bits (404),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 127/209 (61%), Gaps = 21/209 (10%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSY-TYMPPG-FQQPFAGNSTYQQSLAAV  836
             LPQ LA HPYSQPTLPL  FAN+  YP ++ Q+Y TY+  G FQQP+  N+ + QS AA+
Sbjct  608   LPQQLAAHPYSQPTLPLTHFANMFGYPTYLPQNYATYLSSGAFQQPYPSNAQFHQSAAAL  667

Query  835   L--------PNYKNSVSVSSLPHF-------ATVPSGYGAFGNTGTIPGSFPLNPSAAPS  701
             L        P YKN++S + L          ++V SGYG FGN+  +PG+F LN S   +
Sbjct  668   LGSGLKYSTPEYKNNLSATGLQQQPQQQPPPSSVISGYGGFGNSSNLPGNFALNQSTGSA  727

Query  700   TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  521
             ++LG D+ LS QYKD    M+ QQ +NS MWLHG GSR  SA P   +Y  Q Q+Q   G
Sbjct  728   STLGFDEALSRQYKDTSQYMAPQQGDNSAMWLHGSGSRATSALPQGHFYGFQGQSQL-GG  786

Query  520   FRQVQQPS-QNYASLGYNPNFYHSQTGIS  437
             FRQ QQP    +   GY P FY SQ G++
Sbjct  787   FRQAQQPQPSQFGGHGY-PTFYQSQGGLT  814



>ref|XP_004961192.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Setaria 
italica]
Length=846

 Score =   160 bits (404),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 127/209 (61%), Gaps = 21/209 (10%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSY-TYMPPG-FQQPFAGNSTYQQSLAAV  836
             LPQ LA HPYSQPTLPL  FAN+  YP ++ Q+Y TY+  G FQQP+  N+ + QS AA+
Sbjct  607   LPQQLAAHPYSQPTLPLTHFANMFGYPTYLPQNYATYLSSGAFQQPYPSNAQFHQSAAAL  666

Query  835   L--------PNYKNSVSVSSLPHF-------ATVPSGYGAFGNTGTIPGSFPLNPSAAPS  701
             L        P YKN++S + L          ++V SGYG FGN+  +PG+F LN S   +
Sbjct  667   LGSGLKYSTPEYKNNLSATGLQQQPQQQPPPSSVISGYGGFGNSSNLPGNFALNQSTGSA  726

Query  700   TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  521
             ++LG D+ LS QYKD    M+ QQ +NS MWLHG GSR  SA P   +Y  Q Q+Q   G
Sbjct  727   STLGFDEALSRQYKDTSQYMAPQQGDNSAMWLHGSGSRATSALPQGHFYGFQGQSQL-GG  785

Query  520   FRQVQQPS-QNYASLGYNPNFYHSQTGIS  437
             FRQ QQP    +   GY P FY SQ G++
Sbjct  786   FRQAQQPQPSQFGGHGY-PTFYQSQGGLT  813



>ref|XP_006827353.1| PREDICTED: uncharacterized protein LOC18422579 [Amborella trichopoda]
 gb|ERM94590.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
Length=904

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 153/247 (62%), Gaps = 42/247 (17%)
 Frame = -1

Query  1000 QHL-AVHPYSQPT-LPLGPFANIISYPFMHQSYTYMPP-GFQQPFA-GNSTYQQSLAA--  839
            QHL +VH +SQPT LPLG F+N++SYP++ QSY Y+P   +Q  +A GN+ + QS +A  
Sbjct  679  QHLPSVHAFSQPTALPLGQFSNMLSYPYLPQSYAYLPSSAYQHAYAAGNTGFHQSPSAGQ  738

Query  838  -------VLPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIP-GSFPLNPSAAPSTS--LG  689
                    LP YKNSV+VSSLPH     S   A+G+ GT P GSF LN S   S S  +G
Sbjct  739  GAAGIKYSLPQYKNSVAVSSLPH-----SAAAAYGSFGTNPLGSFALNSSTTSSGSTTMG  793

Query  688  IDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQV  509
             DD +SSQYKD  H + +QQ E+S +W+HG GSR +SA PANTYY++Q  NQ    FRQ 
Sbjct  794  YDDIVSSQYKDGSHYVPIQQNESSAVWVHGPGSRNVSAIPANTYYSLQGHNQL-GEFRQP  852

Query  508  QQPSQNYASLGYNPNFYHSQTGI-----SLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  344
            QQ S +Y +LGY PNFYH+Q G+     +L+H   QQ+P DG              PSS 
Sbjct  853  QQAS-HYNTLGY-PNFYHAQMGVAPPAAALEH---QQSPSDGG----------SRAPSSH  897

Query  343  QLWQNSY  323
            Q+W + Y
Sbjct  898  QIWAHGY  904



>ref|XP_003569505.1| PREDICTED: uncharacterized protein LOC100846506 isoform X1 [Brachypodium 
distachyon]
Length=834

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 144/240 (60%), Gaps = 30/240 (13%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS--------  848
             PQ L VHPYSQP   LGPFA+++ YP++ Q+Y   PP FQQ +A N  + QS        
Sbjct  612   PQQLPVHPYSQPAA-LGPFASLVGYPYLPQNYYVPPPAFQQAYANNGPFHQSGGAAAAAV  670

Query  847   ----LAAVLPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAA-PSTSLGID  683
                 +   +P YK+S+  +S P  ++V  GYG FGN    P +F  N SA+ P T++G+D
Sbjct  671   PGSAMKYSMPQYKSSLPATSPPQHSSVVPGYGGFGN---FP-NFGQNQSASSPGTTMGLD  726

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
             + LS+Q+K+ +H M+LQQ +NS MWLHG  +    A P + +Y  Q QN Q  GFRQ QQ
Sbjct  727   EALSTQFKEANHYMALQQSDNSAMWLHGAAAS--RAVPPSNFYGFQGQNTQ-GGFRQAQQ  783

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ Y  LGY P+FY SQTG+      + QNP +G L     ++Q  P   S Q+WQ+SY
Sbjct  784   PSQ-YGGLGY-PSFYQSQTGMP---QERLQNPTEGSL----NSSQTTPSQPSHQIWQHSY  834



>ref|XP_004969440.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Setaria italica]
Length=837

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 135/239 (56%), Gaps = 22/239 (9%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LPQ L VHPYSQPTLPLGPFA+++ YP+M Q+Y      FQQ ++ N  + QS A     
Sbjct  610   LPQQLPVHPYSQPTLPLGPFASLVGYPYMPQNYFLPSAAFQQAYSSNGPFHQSAAPAVPG  669

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS--TSLGIDD  680
                   +P YK+S   SSL    +  SGYG FGN   IPG+F LN   APS  T+LG D+
Sbjct  670   AGMKYSMPQYKSSTPASSL-PQPSSLSGYGGFGNANNIPGNFSLN-QGAPSAPTTLGFDE  727

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              L +Q+KD +H  +LQQ +NS MWLHG      +  P N Y       Q      QVQQP
Sbjct  728   ALGTQFKDPNHYAALQQSDNSAMWLHGAAGSRAAVPPGNFYGFQGQSQQGGFRQAQVQQP  787

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ Y  LGY P+FY SQ G+  +H    QNP +G L     N Q  P   S QLWQ+SY
Sbjct  788   SQ-YGGLGY-PSFYQSQAGLPQEH---PQNPTEGSL----NNPQAAPSQPSHQLWQHSY  837



>ref|XP_004969439.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Setaria italica]
Length=839

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 135/239 (56%), Gaps = 22/239 (9%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LPQ L VHPYSQPTLPLGPFA+++ YP+M Q+Y      FQQ ++ N  + QS A     
Sbjct  612   LPQQLPVHPYSQPTLPLGPFASLVGYPYMPQNYFLPSAAFQQAYSSNGPFHQSAAPAVPG  671

Query  835   ------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS--TSLGIDD  680
                   +P YK+S   SSL    +  SGYG FGN   IPG+F LN   APS  T+LG D+
Sbjct  672   AGMKYSMPQYKSSTPASSL-PQPSSLSGYGGFGNANNIPGNFSLN-QGAPSAPTTLGFDE  729

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              L +Q+KD +H  +LQQ +NS MWLHG      +  P N Y       Q      QVQQP
Sbjct  730   ALGTQFKDPNHYAALQQSDNSAMWLHGAAGSRAAVPPGNFYGFQGQSQQGGFRQAQVQQP  789

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ Y  LGY P+FY SQ G+  +H    QNP +G L     N Q  P   S QLWQ+SY
Sbjct  790   SQ-YGGLGY-PSFYQSQAGLPQEH---PQNPTEGSL----NNPQAAPSQPSHQLWQHSY  839



>gb|EMS47817.1| hypothetical protein TRIUR3_20557 [Triticum urartu]
Length=1165

 Score =   159 bits (403),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 136/197 (69%), Gaps = 16/197 (8%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS---LAAV-  836
             PQ L++HPYSQPTLPLGPFA+++ YP++ Q+Y   PP FQQ ++ N  + QS    AAV 
Sbjct  711   PQQLSLHPYSQPTLPLGPFASLVGYPYLPQNYYVPPPAFQQAYSSNGPFHQSDGGAAAVP  770

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDG  677
                    +P YK+ + V+S P  ++  SGYG FG++  IP +F  N SA+P+T++GID+ 
Sbjct  771   GSAMKYSMPQYKSGLPVTSPPQHSSAVSGYGGFGSSSNIP-NFGQNQSASPATTMGIDEA  829

Query  676   LSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
             LSSQ+K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q++Q  GFR+VQQP
Sbjct  830   LSSQFKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSEQ-GGFREVQQP  888

Query  499   SQNYASLGYNPNFYHSQ  449
             SQ Y  LGY P+FY SQ
Sbjct  889   SQ-YGGLGY-PSFYQSQ  903



>ref|XP_008671999.1| PREDICTED: uncharacterized protein LOC100191159 isoform X1 [Zea 
mays]
 tpg|DAA58235.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=842

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 144/240 (60%), Gaps = 26/240 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A    
Sbjct  617   LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSAPFQQAYSSNGPFHQSAAPAVP  673

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSA-APSTSLGIDD  680
                    +P YK+S   S+LP  +++ SGYG FG+   IPG+F  N  A A  T+LG D+
Sbjct  674   GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPGNFSQNQGAPAAPTTLGFDE  732

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
              L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q   GFRQ  Q
Sbjct  733   ALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQH-GGFRQAHQ  791

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P   S QLWQ+ Y
Sbjct  792   PSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQPSHQLWQHIY  842



>tpg|DAA58234.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=821

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 144/240 (60%), Gaps = 26/240 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A    
Sbjct  596   LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSAPFQQAYSSNGPFHQSAAPAVP  652

Query  835   -------LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSA-APSTSLGIDD  680
                    +P YK+S   S+LP  +++ SGYG FG+   IPG+F  N  A A  T+LG D+
Sbjct  653   GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPGNFSQNQGAPAAPTTLGFDE  711

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
              L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q   GFRQ  Q
Sbjct  712   ALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQH-GGFRQAHQ  770

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P   S QLWQ+ Y
Sbjct  771   PSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQPSHQLWQHIY  821



>ref|XP_010413764.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=843

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 142/241 (59%), Gaps = 40/241 (17%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ +A++PYSQPTLPL  +AN+I YP + QSY Y+P  FQQ +AGN++Y QSLAA+LP
Sbjct  585   ALPQQIAMNPYSQPTLPLTHYANMIGYPMIPQSYPYIPSAFQQAYAGNNSYHQSLAALLP  644

Query  829   NYKNSVSVSSLPHFATVPSGYGA---FGNTGTIPGS-FPLN--PSAAPS-TSLGIDDGLS  671
              YKN+ S S+LP   T      +   FGN+  +    F LN    AAPS  +L  +D LS
Sbjct  645   QYKNNTSASNLPQSTTTTPASSSAYMFGNSSNVETENFLLNQQQQAAPSGATLSYEDVLS  704

Query  670   SQYKDNHHLMSLQQV------------------------------ENSGMWLHGHGSRTM  581
              QYK N++L+SLQQ                               EN  MWLHG GS+TM
Sbjct  705   LQYKQNNYLLSLQQQQQQQLQQQQQQQQQQQQQQQQQQQQHQQQNENLPMWLHGPGSQTM  764

Query  580   SAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRD  401
             S    NTYYN+QAQ Q     +  QQ  Q Y  LGY PN+Y SQTGIS++  HQQQNPR+
Sbjct  765   SGVAGNTYYNLQAQQQSQQVRQAQQQEQQQYGLLGY-PNYYQSQTGISIE--HQQQNPRE  821

Query  400   G  398
             G
Sbjct  822   G  822



>ref|XP_010413763.1| PREDICTED: alpha-protein kinase 1-like isoform X1 [Camelina sativa]
Length=864

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 142/241 (59%), Gaps = 40/241 (17%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ +A++PYSQPTLPL  +AN+I YP + QSY Y+P  FQQ +AGN++Y QSLAA+LP
Sbjct  606   ALPQQIAMNPYSQPTLPLTHYANMIGYPMIPQSYPYIPSAFQQAYAGNNSYHQSLAALLP  665

Query  829   NYKNSVSVSSLPHFATVPSGYGA---FGNTGTIPGS-FPLN--PSAAPS-TSLGIDDGLS  671
              YKN+ S S+LP   T      +   FGN+  +    F LN    AAPS  +L  +D LS
Sbjct  666   QYKNNTSASNLPQSTTTTPASSSAYMFGNSSNVETENFLLNQQQQAAPSGATLSYEDVLS  725

Query  670   SQYKDNHHLMSLQQV------------------------------ENSGMWLHGHGSRTM  581
              QYK N++L+SLQQ                               EN  MWLHG GS+TM
Sbjct  726   LQYKQNNYLLSLQQQQQQQLQQQQQQQQQQQQQQQQQQQQHQQQNENLPMWLHGPGSQTM  785

Query  580   SAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRD  401
             S    NTYYN+QAQ Q     +  QQ  Q Y  LGY PN+Y SQTGIS++  HQQQNPR+
Sbjct  786   SGVAGNTYYNLQAQQQSQQVRQAQQQEQQQYGLLGY-PNYYQSQTGISIE--HQQQNPRE  842

Query  400   G  398
             G
Sbjct  843   G  843



>ref|XP_008645740.1| PREDICTED: uncharacterized protein LOC103627229 [Zea mays]
Length=281

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 142/240 (59%), Gaps = 26/240 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A  +P
Sbjct  56    LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSSPFQQAYSSNGPFHQSAAPAMP  112

Query  829   N---------YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDD  680
                       YK+S   S+LP  +++ SGYG FG+   IP +F  N  AA + T+LG D+
Sbjct  113   GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPRNFSQNQGAAAAPTTLGFDE  171

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
              L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q++   GFRQ   
Sbjct  172   ALGTQFKHPNHYAALQQSDNSAMWLHGGAGSRTISAVPPGNFYGFQGQSKH-GGFRQAHH  230

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ Y  LGY P+FY SQT +  +H    Q+P +G L     N    P   S QLWQ+ Y
Sbjct  231   PSQ-YGGLGY-PSFYQSQTSLPQEH---PQSPTEGSL----NNPYGVPSQPSHQLWQHIY  281



>gb|AFW71654.1| hypothetical protein ZEAMMB73_647126 [Zea mays]
Length=432

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 142/240 (59%), Gaps = 26/240 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A  +P
Sbjct  207   LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSSPFQQAYSSNGPFHQSAAPAMP  263

Query  829   N---------YKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDD  680
                       YK+S   S+LP  +++ SGYG FG+   IP +F  N  AA + T+LG D+
Sbjct  264   GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPRNFSQNQGAAAAPTTLGFDE  322

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
              L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q++   GFRQ   
Sbjct  323   ALGTQFKHPNHYAALQQSDNSAMWLHGGAGSRTISAVPPGNFYGFQGQSKH-GGFRQAHH  381

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ Y  LGY P+FY SQT +  +H    Q+P +G L     N    P   S QLWQ+ Y
Sbjct  382   PSQ-YGGLGY-PSFYQSQTSLPQEH---PQSPTEGSL----NNPYGVPSQPSHQLWQHIY  432



>ref|XP_006654843.1| PREDICTED: dentin sialophosphoprotein-like [Oryza brachyantha]
Length=807

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 140/239 (59%), Gaps = 29/239 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQHLA+HPY+Q TLPLG +A++I YP + QSY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  587   LPQHLALHPYAQATLPLG-YASMIGYPSLPQSYAYLPPAAFQQPYMNSGLFHQAAAAVPN  645

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  680
                   LP YK++VS++SLP  A++ S Y G FG   ++PG+F LN S A +T+  G D 
Sbjct  646   SSVKYPLPQYKSNVSLASLPQPASLLSSYVGGFGAASSMPGNFALNQSTASATAAPGFDG  705

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + +QYK+ +H +SLQQ EN  MW+HG GSRTM    AN  Y  Q Q     G RQ Q P
Sbjct  706   TVPAQYKEGNHFVSLQQSENPAMWMHGAGSRTMPPLAANALYGYQGQQGHQGGLRQGQLP  765

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  A+LG       SQ G+     H+ +NP DG       N        + Q+W NSY
Sbjct  766   SQFGAALG------QSQPGLG----HEHRNPSDG-------NLSAAAAAQANQMWPNSY  807



>ref|XP_003567874.1| PREDICTED: uncharacterized protein LOC100840916 [Brachypodium 
distachyon]
Length=859

 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 137/222 (62%), Gaps = 22/222 (10%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY-TYMPPGFQQPFAGNSTYQQSLAAV--  836
             LPQ L VHPYSQPTLP+ PF N++ YP++ Q+Y  Y+P  FQQ ++ N  + QS AAV  
Sbjct  622   LPQQLTVHPYSQPTLPIAPFTNMMGYPYLAQNYPAYLPSAFQQAYSSNGQFHQSAAAVPG  681

Query  835   ------LPNYKNSVSVSSLPHFATVPS---GYGAFGNTGTIPGSFPLNPSA-APSTSLGI  686
                   +P YK ++S ++L      PS   GYG FG++  +P +F LN +A + ST+ G 
Sbjct  682   AGMKYAMPQYKGNLSATNLQQ--QQPSSVLGYGGFGSSSNLPANFNLNQNATSASTNAGF  739

Query  685   DDGLSSQYKD-NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  512
             D+ L +QYKD N ++ +LQQ  +NS MWLHG GSRT +A P   +Y  Q Q+QQ    RQ
Sbjct  740   DEALGAQYKDANQYMAALQQQGDNSAMWLHGAGSRTAAALPPTQFYGYQGQSQQ-GALRQ  798

Query  511   VQQPSQNYASLGYN--PNFYHSQTGISLDHHHQQQNPRDGPL  392
              QQ  Q  +  G +  P FYHSQ+G++ +HH   QNP +  L
Sbjct  799   AQQQPQQPSQFGGHGYPAFYHSQSGMTQEHH--PQNPSEASL  838



>gb|ACF86865.1| unknown [Zea mays]
Length=564

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 140/239 (59%), Gaps = 33/239 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+QPTLPLG +A++I YP +  SY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  348   LPQHL-LHPYAQPTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGLFHQAAAAVPT  405

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  680
                   LP YK++++++SLP   ++ S Y G FG    +PG+FPLN S AA +T+LG D 
Sbjct  406   SSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTASNMPGNFPLNQSTAAATTTLGFDG  465

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q +G RQ Q P
Sbjct  466   TVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ-AGLRQGQLP  524

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W N+Y
Sbjct  525   SQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNTY  564



>ref|NP_001141689.1| uncharacterized protein LOC100273818 [Zea mays]
 gb|ACN27855.1| unknown [Zea mays]
 gb|ACN28046.1| unknown [Zea mays]
 gb|AFW79333.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 140/239 (59%), Gaps = 33/239 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+QPTLPLG +A++I YP +  SY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  611   LPQHL-LHPYAQPTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGLFHQAAAAVPT  668

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  680
                   LP YK++++++SLP   ++ S Y G FG    +PG+FPLN S AA +T+LG D 
Sbjct  669   SSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTASNMPGNFPLNQSTAAATTTLGFDG  728

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q +G RQ Q P
Sbjct  729   TVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ-AGLRQGQLP  787

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W N+Y
Sbjct  788   SQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNTY  827



>ref|XP_008647566.1| PREDICTED: uncharacterized protein LOC100273818 isoform X1 [Zea 
mays]
Length=828

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 140/239 (59%), Gaps = 33/239 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+QPTLPLG +A++I YP +  SY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  612   LPQHL-LHPYAQPTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGLFHQAAAAVPT  669

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  680
                   LP YK++++++SLP   ++ S Y G FG    +PG+FPLN S AA +T+LG D 
Sbjct  670   SSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTASNMPGNFPLNQSTAAATTTLGFDG  729

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q +G RQ Q P
Sbjct  730   TVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ-AGLRQGQLP  788

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W N+Y
Sbjct  789   SQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNTY  828



>ref|XP_008656717.1| PREDICTED: uncharacterized protein LOC103636139 [Zea mays]
 gb|AFW83479.1| putative DUF1296 domain containing family protein [Zea mays]
Length=840

 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 141/242 (58%), Gaps = 28/242 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  827
             LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y      FQQ ++ N  + QS A  +P 
Sbjct  613   LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNYYLPSAAFQQAYSSNGPFHQSGAPAVPG  670

Query  826   YKNSVSVSSLPHFATVP-----------SGYGAFGNTGTIPGSFPLNPSAAPS--TSLGI  686
                     S+P + + P           SGYG FGN   IPG+F LN   APS  T+LG 
Sbjct  671   AGMKY---SMPQYKSSPPASSLPQPSSLSGYGGFGNANNIPGNFSLN-QGAPSAPTTLGF  726

Query  685   DDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQV  509
             D+ L +Q+KD +H  +LQQ +NS MWLH G GSRT+SA P   +Y +Q Q+QQ  GFRQ 
Sbjct  727   DEALGTQFKDPNHYAALQQSDNSAMWLHGGAGSRTVSAVPPGNFYGLQGQSQQ-GGFRQA  785

Query  508   QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  329
              QPSQ Y  LGY P+FY SQ+  SL   H  QN  +G L     N+Q  P   S  LWQ+
Sbjct  786   HQPSQ-YGGLGY-PSFYQSQSQASLPQEH-PQNLTEGSL----NNSQGVPSQPSHHLWQH  838

Query  328   SY  323
             SY
Sbjct  839   SY  840



>ref|XP_009132981.1| PREDICTED: uncharacterized protein LOC103857526 [Brassica rapa]
Length=808

 Score =   145 bits (367),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 149/240 (62%), Gaps = 31/240 (13%)
 Frame = -1

Query  1000 QHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYK  821
            Q L +HPYSQ T+PL  FAN++SYP M QSY YMP      FAGNS Y  SLAA+LP YK
Sbjct  586  QQLPMHPYSQHTVPLTHFANMMSYPLMPQSYPYMP------FAGNSPYHPSLAALLPQYK  639

Query  820  NSVSVSSLPHFAT---VPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
            N+V  S+LP  AT   + S YG FGN+ ++         AAPS  +L  +D +S QYK N
Sbjct  640  NNVLASNLPQSATSAPISSAYG-FGNSSSVGALNQQQQQAAPSGATLSYEDIMSLQYKHN  698

Query  652  HHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             HL+SLQQ         +NS +W+HG GS+TMS   +N YYN+QAQ Q     +  QQ  
Sbjct  699  SHLLSLQQQQQQQQHQNDNSPLWVHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQAQ  758

Query  496  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ--LWQNSY  323
            Q + SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q QP   +QQ  LWQNSY
Sbjct  759  QQHGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQPSKQTQQQHLWQNSY  808



>emb|CDX84653.1| BnaA03g15770D [Brassica napus]
Length=813

 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 149/240 (62%), Gaps = 31/240 (13%)
 Frame = -1

Query  1000 QHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYK  821
            Q L +HPYSQ T+PL  FAN++SYP M QSY YMP      FAGNS Y  SLAA+LP YK
Sbjct  591  QQLPMHPYSQHTVPLTHFANMMSYPLMPQSYPYMP------FAGNSPYHPSLAALLPQYK  644

Query  820  NSVSVSSLPHFAT---VPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  653
            N+V  S+LP  AT   + S YG FGN+ ++         AAPS  +L  +D +S QYK N
Sbjct  645  NNVLASNLPQSATSAPISSAYG-FGNSSSVGALNQQQQQAAPSGATLSYEDIMSLQYKHN  703

Query  652  HHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  497
             HL+SLQQ         +NS +W+HG GS+TMS   +N YYN+QAQ Q     +  QQ  
Sbjct  704  SHLLSLQQQQQQQQHQNDNSPLWVHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQAQ  763

Query  496  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ--LWQNSY  323
            Q + SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q QP   +QQ  LWQNSY
Sbjct  764  QQHGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQPSKQTQQQHLWQNSY  813



>ref|XP_002881327.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57586.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score =   145 bits (367),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 139/244 (57%), Gaps = 44/244 (18%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             A+PQ +A+HPYSQPTLPL  +AN+ISYP M QSY Y+P  FQQ FAGN++Y QSLAA+LP
Sbjct  603   AIPQQIAMHPYSQPTLPLTHYANMISYPLMPQSYPYIPSTFQQAFAGNNSYHQSLAALLP  662

Query  829   NYKNSVSVSSLPH---FATVPSGYGAFGNTGTIPGSFPLN-PSAAP-STSLGIDDGLSSQ  665
              YKN++S S+LP         S YG   ++    G+F LN    AP   +   +D LS Q
Sbjct  663   QYKNNISASNLPQSATSPASSSAYGVGNSSNVEAGNFLLNQQQVAPIGATFSYEDALSLQ  722

Query  664   YKDNHHLMSLQQV---------------------------------ENSGMWLHGHGSRT  584
             YK N++L+ LQQ                                  EN  MWL+G GS+T
Sbjct  723   YKQNNYLLYLQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQNENFPMWLNGPGSQT  782

Query  583   MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL---GYNPNFYHSQTGISLDHHHQQQ  413
             MS  P+NTYYN++AQ Q     +  QQ  Q   +    GY PN+Y SQTG+S++   QQQ
Sbjct  783   MSGVPSNTYYNLEAQQQSQQVRQAQQQAQQAQQAQQQYGY-PNYYQSQTGMSME--QQQQ  839

Query  412   NPRD  401
             NPRD
Sbjct  840   NPRD  843



>ref|XP_002440322.1| hypothetical protein SORBIDRAFT_09g029670 [Sorghum bicolor]
 gb|EES18752.1| hypothetical protein SORBIDRAFT_09g029670 [Sorghum bicolor]
Length=649

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 139/239 (58%), Gaps = 33/239 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  433   LPQHL-LHPYAQATLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGLFHQAAAAVPN  490

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSA-APSTSLGIDD  680
                   LP YK++++++SLP   ++ S Y G FG    +PG+FPLN S  + +T+LG D 
Sbjct  491   SSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATTTLGFDG  550

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + S +KD +  +SLQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q P
Sbjct  551   TVPSHFKDGNQFISLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-AGLRQGQLP  609

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  610   SQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  649



>dbj|BAJ92311.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 141/229 (62%), Gaps = 27/229 (12%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISY------PFMHQSY-TYMP-PGFQQPFAGNSTYQ  854
             +LPQ L VHPYSQPTLP+ PFAN+I        P++ Q+Y  Y+P   FQQ ++ N  + 
Sbjct  619   SLPQQL-VHPYSQPTLPIAPFANMIGANMIGYNPYLAQNYPAYLPSTAFQQAYSSNGQFH  677

Query  853   QSLAAV--------LPNYKNSVSVSSLPHF---ATVPSGYGAFGNTGTIPGSFPLNPSAA  707
             QS AAV        +P YKN++S ++L      ++V SGY  FG++  +PG+F LN +AA
Sbjct  678   QSAAAVPGAGMKYSMPQYKNNMSAANLQQQQQPSSVISGYAGFGSSSNLPGNFALNQNAA  737

Query  706   P-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  533
             P S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+Q
Sbjct  738   PASANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQ  797

Query  532   QPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  392
             Q   FR  Q  Q    Y   GY P FYH+Q G++ +HH   QNP DG L
Sbjct  798   QQGAFRQAQQPQQPSQYGGHGY-PAFYHNQGGLAQEHH--PQNPADGTL  843



>gb|EMS63247.1| hypothetical protein TRIUR3_29233 [Triticum urartu]
Length=823

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 141/229 (62%), Gaps = 27/229 (12%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISY------PFMHQSY-TYMP-PGFQQPFAGNSTYQ  854
             +LPQ L VHPYSQPTLP+ PFAN+I        P++ Q+Y  Y+P   FQQ ++ N  + 
Sbjct  597   SLPQQL-VHPYSQPTLPIAPFANMIGANMIGYNPYLAQNYPAYLPSTAFQQAYSSNGQFH  655

Query  853   QSLAAV--------LPNYKNSVSVSSLPHF---ATVPSGYGAFGNTGTIPGSFPLNPSAA  707
             QS AAV        +P YKN++S ++L      ++V SGY  FG++  +PG+F LN +AA
Sbjct  656   QSAAAVPGAGMKYSMPQYKNNMSGANLQQQQQPSSVISGYAGFGSSSNLPGNFALNQNAA  715

Query  706   P-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  533
             P S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+Q
Sbjct  716   PPSANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQ  775

Query  532   QPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  392
             Q   FR  Q  Q    Y   GY P FYHSQ G++ +HH   QNP DG L
Sbjct  776   QQGAFRQAQQPQQPSQYGGHGY-PAFYHSQGGMAQEHH--PQNPADGAL  821



>dbj|BAJ85689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 140/229 (61%), Gaps = 27/229 (12%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISY------PFMHQSY-TYMP-PGFQQPFAGNSTYQ  854
             +LPQ L VHPYSQPTLP+ PFAN+I        P++ Q+Y  Y+P   FQQ ++ N  + 
Sbjct  619   SLPQQL-VHPYSQPTLPIAPFANMIGANMIGYNPYLAQNYPAYLPSTAFQQAYSSNGQFH  677

Query  853   QSLAAV--------LPNYKNSVSVSSLPHF---ATVPSGYGAFGNTGTIPGSFPLNPSAA  707
             QS AAV        +P YKN++S ++L      ++V SGY  FG++  +PG+F LN +AA
Sbjct  678   QSAAAVPGAGMKYSMPQYKNNMSAANLQQQQQPSSVISGYAGFGSSSNLPGNFALNQNAA  737

Query  706   P-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  533
             P S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+Q
Sbjct  738   PASANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQ  797

Query  532   QPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  392
             Q   FR  Q  Q    Y   GY P FYH+Q G++  HH   QNP DG L
Sbjct  798   QQGAFRQAQQPQQPSQYGGHGY-PAFYHNQGGLAQGHH--PQNPADGTL  843



>ref|XP_008229421.1| PREDICTED: cell wall protein AWA1-like [Prunus mume]
Length=840

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 127/239 (53%), Gaps = 30/239 (13%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
              LPQHL    YSQP L     ANII YP M QSY+  P   QQ + G S +QQS+A +  
Sbjct  622   VLPQHLTSRSYSQPALSYEQLANIIGYPSMTQSYSPAPSTLQQAYLGGSAFQQSVAGMDY  681

Query  835   -LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYK  659
               P Y++  SVS LP  A    G+G FG +  + GSF  N SAAP +    DD L ++YK
Sbjct  682   NFPQYRSGASVSRLPPSAAAVGGHGNFGASNNVHGSFLQNASAAPISMSDYDDALRARYK  741

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ---VQQPS--Q  494
             D  HL  L Q            SRT+S+ P + Y N+  QNQQ +G+RQ    Q PS  Q
Sbjct  742   DGSHLTPLHQ-----------SSRTLSSVPDSVYDNLLRQNQQNAGYRQGQAGQMPSQLQ  790

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ--QLWQNSY  323
             +Y S GY P+FY SQ GI+ +HH Q  N  D  L      A +Q     Q  Q+WQ +Y
Sbjct  791   HYGSPGY-PDFYPSQMGITQEHHRQSLN--DLSL------AGIQDLSPQQLHQIWQRTY  840



>ref|XP_002440264.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
 gb|EES18694.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
Length=856

 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 141/245 (58%), Gaps = 29/245 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSY-TYMPPG-FQQPFAGNSTYQQSLAAV  836
             LPQ LA HPYSQPTLP+  F N++ YP ++ Q+Y TY+  G FQQ +  N  + QS AA+
Sbjct  616   LPQQLAHHPYSQPTLPITHFPNMVGYPTYLPQNYATYLSSGTFQQAYPSNGPFHQSAAAL  675

Query  835   L--------PNYKNSVSVSSLPHF--------ATVPSGYGAFGNTGTIPGSFPLNPSAAP  704
             L        P YKN++S + L           ++V SGYG FG++G I G+F LN S   
Sbjct  676   LGSGMKYSTPEYKNNLSATGLQQQHQPQPQPPSSVISGYGGFGSSGNIQGNFTLNQSTGS  735

Query  703   STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  524
             +++LG D+ LS QYKD    M+LQQ +NSGMWLHG GSR  S  P N +Y  Q Q+Q   
Sbjct  736   ASTLGFDEALSRQYKDTSQYMALQQGDNSGMWLHGSGSRATSTLPPNHFYGYQGQSQL-G  794

Query  523   GFRQVQQPS-QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  347
             GFRQ QQP    +   GY P FY SQ G++ +H    QN  +G L G     QV P   S
Sbjct  795   GFRQAQQPQPSQFGGHGY-PTFYQSQGGLTQEH---PQNLAEGSLNGF----QVAPSQPS  846

Query  346   QQLWQ  332
                WQ
Sbjct  847   HPNWQ  851



>gb|EEC79757.1| hypothetical protein OsI_21141 [Oryza sativa Indica Group]
Length=798

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 135/239 (56%), Gaps = 26/239 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+Q TLPLG +A++I YP +  SYTY+PP  FQQP+  +  + Q+ AAV  
Sbjct  575   LPQHLTLHPYAQATLPLG-YASMIGYPSLAPSYTYLPPPAFQQPYMNSGLFHQAAAAVPN  633

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  680
                   LP YK +VS++SLP  A++ S Y G FG   ++PG+F LN S   +T+  G D 
Sbjct  634   SSVKYPLPQYKGNVSLASLPQQASLLSSYVGGFGAASSMPGNFALNQSTPSATAAPGFDG  693

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ Q P
Sbjct  694   TVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALYGYQGQQGHQGGLRQGQLP  753

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  A L        +Q G+     H+ +NP DG L      A       + Q+W NSY
Sbjct  754   SQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAAAA----QANQMWPNSY  798



>gb|AFW81250.1| putative DUF1296 domain containing family protein [Zea mays]
Length=787

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  570   LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  627

Query  829   N---------YKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  683
             N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  628   NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  687

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
               + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  688   GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  746

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  747   PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  787



>ref|XP_008654853.1| PREDICTED: uncharacterized protein LOC100280182 isoform X3 [Zea 
mays]
Length=792

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  575   LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  632

Query  829   N---------YKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  683
             N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  633   NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  692

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
               + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  693   GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  751

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  752   PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  792



>ref|XP_008654852.1| PREDICTED: uncharacterized protein LOC100280182 isoform X2 [Zea 
mays]
Length=823

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  606   LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  663

Query  829   N---------YKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  683
             N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  664   NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  723

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
               + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  724   GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  782

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  783   PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  823



>ref|XP_008654854.1| PREDICTED: uncharacterized protein LOC100280182 isoform X4 [Zea 
mays]
Length=791

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  574   LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  631

Query  829   N---------YKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  683
             N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  632   NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  691

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
               + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  692   GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  750

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  751   PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  791



>ref|XP_008654851.1| PREDICTED: uncharacterized protein LOC100280182 isoform X1 [Zea 
mays]
 gb|AFW81249.1| putative DUF1296 domain containing family protein [Zea mays]
Length=826

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  609   LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  666

Query  829   N---------YKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  683
             N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  667   NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  726

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
               + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  727   GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  785

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  786   PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  826



>gb|AFW81251.1| putative DUF1296 domain containing family protein [Zea mays]
Length=847

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  630   LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  687

Query  829   N---------YKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  683
             N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  688   NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  747

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
               + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  748   GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  806

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  807   PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  847



>ref|NP_001146586.1| uncharacterized protein LOC100280182 [Zea mays]
 gb|ACL54332.1| unknown [Zea mays]
Length=827

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  610   LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  667

Query  829   N---------YKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  683
             N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  668   NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  727

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
               + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  728   GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  786

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  787   PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  827



>gb|AFW81248.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  830
             LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  610   LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  667

Query  829   N---------YKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  683
             N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  668   NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  727

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
               + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  728   GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  786

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  787   PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  827



>ref|XP_007217053.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
 gb|EMJ18252.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
Length=883

 Score =   134 bits (337),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 126/239 (53%), Gaps = 30/239 (13%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
              LPQHL    YSQP L     ANI+ YP M QSY+  P   QQ + G S +QQS+A +  
Sbjct  665   VLPQHLTSRSYSQPALSYEQLANIMGYPSMTQSYSPAPSTLQQAYLGGSAFQQSVAGMDY  724

Query  835   -LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYK  659
               P Y++  SVS LP  A    G+G FG +  + GSF  N SAAP +    DD L ++YK
Sbjct  725   NFPQYRSGASVSRLPPSAAAVGGHGNFGASNNVHGSFLQNASAAPISMSDYDDALRARYK  784

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ---VQQPS--Q  494
             D  HL  L Q            SRT+S+ P + Y  +  QNQQ +G++Q    Q PS  Q
Sbjct  785   DGSHLTPLHQ-----------SSRTLSSIPDSVYNTLLRQNQQNAGYQQGQAGQMPSQLQ  833

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ--QLWQNSY  323
             +Y S GY P+FY SQ GI+ +HH Q  N  D  L      A +Q     Q  Q+WQ +Y
Sbjct  834   HYGSPGY-PDFYPSQMGITQEHHRQSVN--DLSL------AGIQDLSPQQLHQIWQRTY  883



>ref|NP_001056433.1| Os05g0581800 [Oryza sativa Japonica Group]
 gb|AAU10711.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18347.1| Os05g0581800 [Oryza sativa Japonica Group]
Length=852

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 135/239 (56%), Gaps = 29/239 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+Q TLPLG +A++I YP +  SYTY+PP  FQQP+  +  + Q+ AAV  
Sbjct  632   LPQHLTLHPYAQATLPLG-YASMIGYPSLAPSYTYLPPPAFQQPYMNSGLFHQAAAAVPN  690

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  680
                   LP YK +VS++SLP  A++ S Y G FG   ++PG+F LN S   +T+  G D 
Sbjct  691   SSVKYPLPQYKGNVSLASLPQQASLLSSYVGGFGAASSMPGNFALNQSTPSATAAPGFDG  750

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ Q P
Sbjct  751   TVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY-YQGQQGHQGGLRQGQLP  809

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  A L        +Q G+     H+ +NP DG L      A       + Q+W NSY
Sbjct  810   SQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAA------QANQMWPNSY  852



>gb|AAT44198.1| unknown protein [Oryza sativa Japonica Group]
Length=860

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 135/239 (56%), Gaps = 29/239 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+Q TLPLG +A++I YP +  SYTY+PP  FQQP+  +  + Q+ AAV  
Sbjct  640   LPQHLTLHPYAQATLPLG-YASMIGYPSLAPSYTYLPPPAFQQPYMNSGLFHQAAAAVPN  698

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  680
                   LP YK +VS++SLP  A++ S Y G FG   ++PG+F LN S   +T+  G D 
Sbjct  699   SSVKYPLPQYKGNVSLASLPQQASLLSSYVGGFGAASSMPGNFALNQSTPSATAAPGFDG  758

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ Q P
Sbjct  759   TVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY-YQGQQGHQGGLRQGQLP  817

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  A L        +Q G+     H+ +NP DG L      A       + Q+W NSY
Sbjct  818   SQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAA------QANQMWPNSY  860



>gb|EEE64826.1| hypothetical protein OsJ_19683 [Oryza sativa Japonica Group]
Length=853

 Score =   131 bits (330),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 135/239 (56%), Gaps = 29/239 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+Q TLPLG +A++I YP +  SYTY+PP  FQQP+  +  + Q+ AAV  
Sbjct  633   LPQHLTLHPYAQATLPLG-YASMIGYPSLAPSYTYLPPPAFQQPYMNSGLFHQAAAAVPN  691

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  680
                   LP YK +VS++SLP  A++ S Y G FG   ++PG+F LN S   +T+  G D 
Sbjct  692   SSVKYPLPQYKGNVSLASLPQQASLLSSYVGGFGAASSMPGNFALNQSTPSATAAPGFDG  751

Query  679   GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  500
              + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ Q P
Sbjct  752   TVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY-YQGQQGHQGGLRQGQLP  810

Query  499   SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             SQ  A L        +Q G+     H+ +NP DG L      A       + Q+W NSY
Sbjct  811   SQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAA------QANQMWPNSY  853



>ref|XP_006654800.1| PREDICTED: uncharacterized protein LOC102700994 [Oryza brachyantha]
Length=815

 Score =   130 bits (328),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 147/244 (60%), Gaps = 27/244 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY--TYMP-PGFQQPFAGNSTYQQSLAAV  836
             LPQ L VHPYSQPT+PL PFAN+I YP++ Q+Y   Y+P   FQQ ++ N  + QS AA 
Sbjct  575   LPQQL-VHPYSQPTVPLAPFANMIGYPYLAQNYPAAYLPSAAFQQAYSSNGPFHQSPAAA  633

Query  835   LPN-------------YKNSVSVSSLPHF-ATVPSGYGAFGNTGTIPGSFPLNPSAA-PS  701
             +P              YKN++S +SL    ++V SGYG FG++  + G+F LN +AA  S
Sbjct  634   VPGGAMKYNMNVLPQQYKNNLSATSLQQQPSSVISGYGGFGSSSNLQGNFNLNQNAASAS  693

Query  700   TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  521
             T+LG D+ LS+ YKD +  M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ   
Sbjct  694   TNLGFDEALSTPYKDPNQYMALQQGDNSAMWLHGAGSRATSAVPPSHFYGFQGQSQQGGF  753

Query  520   -FRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  344
                Q  Q    +   GY P FYHSQ+G++ +HH   QNP +G    G  +AQ QP   S 
Sbjct  754   RQAQQPQQHSQFGGHGY-PAFYHSQSGLTQEHH---QNPAEGGGLNGFQSAQSQP---SH  806

Query  343   QLWQ  332
             Q WQ
Sbjct  807   QGWQ  810



>emb|CBI20348.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = -1

Query  664  YKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNY  488
            YK+ +HL+S QQ  ENS MW HG GS+TMSA PANTYY+ Q QNQQP GFRQ  QPSQ++
Sbjct  74   YKNGNHLISFQQQNENSTMWNHGPGSQTMSAVPANTYYSFQGQNQQPGGFRQGHQPSQHF  133

Query  487  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  335
              LGY PNF+HSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+W
Sbjct  134  GVLGY-PNFHHSQAGISLE--HQQQNPRDGSL----SGSQGQACKQSQQIW  177



>ref|NP_001056347.1| Os05g0566900 [Oryza sativa Japonica Group]
 gb|AAU10662.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18261.1| Os05g0566900 [Oryza sativa Japonica Group]
 dbj|BAG89781.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00089.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64717.1| hypothetical protein OsJ_19573 [Oryza sativa Japonica Group]
Length=852

 Score =   127 bits (320),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 145/241 (60%), Gaps = 28/241 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY--TYMP-PGFQQPFAGNSTYQQSLAAV  836
             LPQ L VHPYSQPT+PL PFAN+I YP++ Q+Y   Y+P   FQQ ++ N  + QS AA 
Sbjct  619   LPQQL-VHPYSQPTVPLAPFANMIGYPYLAQNYPAAYLPSAAFQQAYSSNGPFHQSAAAA  677

Query  835   LPN----------YKNSVSVSSLPHF-ATVPSGYGAFGNTGTIPGSFPLNPSAA-PSTSL  692
             +P           +KN++S +SL    ++V SGYG FG++  +PG+F LN +AA  ST+L
Sbjct  678   VPGAMKYNMNVPQFKNNLSATSLQQQPSSVISGYGGFGSSSNLPGNFTLNQNAASASTNL  737

Query  691   GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG-FR  515
             G D+ LS+ YKD    M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ      
Sbjct  738   GFDEALSTPYKDPSQYMALQQGDNSAMWLHGAGSRATSALPPSHFYGFQGQSQQGGFRQA  797

Query  514   QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  335
             Q  Q    +   GY P FYHSQ   S +HH   QNP +G L  G  NAQ QP   S Q W
Sbjct  798   QQPQQHSQFGGHGY-PAFYHSQ---SQEHH---QNPAEGGL-NGFQNAQSQP---SHQGW  846

Query  334   Q  332
             Q
Sbjct  847   Q  847



>gb|EEC79711.1| hypothetical protein OsI_21014 [Oryza sativa Indica Group]
Length=852

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 145/241 (60%), Gaps = 28/241 (12%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY--TYMP-PGFQQPFAGNSTYQQSLAAV  836
             LPQ L VHPYSQPT+PL PFAN+I YP++ Q+Y   Y+P   FQQ ++ N  + QS AA 
Sbjct  619   LPQQL-VHPYSQPTVPLAPFANMIGYPYLAQNYPAAYLPSAAFQQAYSSNGPFHQSAAAA  677

Query  835   LPN----------YKNSVSVSSLPHF-ATVPSGYGAFGNTGTIPGSFPLNPSAA-PSTSL  692
             +P           +KN++S +SL    ++V SGYG FG++  +PG+F LN +AA  ST+L
Sbjct  678   VPGAMKYNMNVPQFKNNLSATSLQQQPSSVISGYGGFGSSSNLPGNFTLNQNAASASTNL  737

Query  691   GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG-FR  515
             G D+ LS+ YKD    M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ      
Sbjct  738   GFDEALSTPYKDPSQYMALQQGDNSAMWLHGAGSRATSALPPSHFYGFQGQSQQGGFRQA  797

Query  514   QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  335
             Q  Q    +   GY P FYHSQ   S +HH   QNP +G L  G  NAQ QP   S Q W
Sbjct  798   QQPQQHSQFGGHGY-PAFYHSQ---SQEHH---QNPAEGGL-NGFQNAQSQP---SHQGW  846

Query  334   Q  332
             Q
Sbjct  847   Q  847



>ref|XP_004961107.1| PREDICTED: uncharacterized protein LOC101764022 isoform X2 [Setaria 
italica]
Length=793

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 127/217 (59%), Gaps = 29/217 (13%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYM-PPGFQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+Q TLPLG +A +I YP +  SY Y+ P  FQQP+  N  + Q+ AAV  
Sbjct  581   LPQHL-LHPYAQATLPLG-YAGMIGYPSLPPSYAYIQPAAFQQPYMSN-MFHQAAAAVPN  637

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  680
                   LP YK   +++SLP  A++ S Y G FG    +PG+FP+N S A+ +T+LG D 
Sbjct  638   SSVKYPLPQYK---ALASLPQPASLLSSYVGGFGTANNMPGNFPVNQSTASATTTLGFDG  694

Query  679   GLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
              +   YK+ +  +SLQQ  EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  695   SVPPHYKEGNQFISLQQQNENPAMWMHGAGSRGMPPLAASTLYGYQGQSHQ-AGLRQGQL  753

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  392
             PSQ   +LG       SQ G+  +H    +NP DG L
Sbjct  754   PSQFGTALG------QSQPGLGPEH----RNPSDGNL  780



>ref|XP_004961106.1| PREDICTED: uncharacterized protein LOC101764022 isoform X1 [Setaria 
italica]
Length=794

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 127/217 (59%), Gaps = 29/217 (13%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYM-PPGFQQPFAGNSTYQQSLAAV--  836
             LPQHL +HPY+Q TLPLG +A +I YP +  SY Y+ P  FQQP+  N  + Q+ AAV  
Sbjct  582   LPQHL-LHPYAQATLPLG-YAGMIGYPSLPPSYAYIQPAAFQQPYMSN-MFHQAAAAVPN  638

Query  835   ------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  680
                   LP YK   +++SLP  A++ S Y G FG    +PG+FP+N S A+ +T+LG D 
Sbjct  639   SSVKYPLPQYK---ALASLPQPASLLSSYVGGFGTANNMPGNFPVNQSTASATTTLGFDG  695

Query  679   GLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  503
              +   YK+ +  +SLQQ  EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  696   SVPPHYKEGNQFISLQQQNENPAMWMHGAGSRGMPPLAASTLYGYQGQSHQ-AGLRQGQL  754

Query  502   PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  392
             PSQ   +LG       SQ G+  +H    +NP DG L
Sbjct  755   PSQFGTALG------QSQPGLGPEH----RNPSDGNL  781



>ref|XP_010230981.1| PREDICTED: uncharacterized protein LOC100825596 isoform X1 [Brachypodium 
distachyon]
Length=850

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 132/243 (54%), Gaps = 35/243 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LP HLA+HPY+Q TLPLG + +++ YP + QSY   P  FQQP+  +  + Q+ AA    
Sbjct  628   LPHHLALHPYAQATLPLG-YTSMMGYPSLPQSYYLPPAAFQQPYMNSGLFHQAAAAAAAA  686

Query  835   ----------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-  692
                       +P YK++V ++S+P  A++ S Y G FG    +PG++ LN S+ P+ +  
Sbjct  687   AAPNSNVKYPMPQYKSNVPLASMPQQASLLSNYVGGFGTANGMPGNYALNQSSVPANAAP  746

Query  691   GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  512
             G D  + SQYKD +H +SLQQ EN  MW+HG GSR M    ANT Y  Q Q     G RQ
Sbjct  747   GFDGTMPSQYKDGNHYISLQQNENPAMWMHGAGSRGMPPLAANTLYGYQGQQGHQGGLRQ  806

Query  511   VQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  332
              Q PSQ  A+LG       SQ G+  +H    +NP D  L   G          + Q+W 
Sbjct  807   GQLPSQFGAALG------QSQQGLGQEH----RNPSDSNLSAAGQ---------ANQMWP  847

Query  331   NSY  323
             NSY
Sbjct  848   NSY  850



>ref|XP_003567822.1| PREDICTED: uncharacterized protein LOC100825596 isoform X2 [Brachypodium 
distachyon]
Length=849

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 132/243 (54%), Gaps = 35/243 (14%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  836
             LP HLA+HPY+Q TLPLG + +++ YP + QSY   P  FQQP+  +  + Q+ AA    
Sbjct  627   LPHHLALHPYAQATLPLG-YTSMMGYPSLPQSYYLPPAAFQQPYMNSGLFHQAAAAAAAA  685

Query  835   ----------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-  692
                       +P YK++V ++S+P  A++ S Y G FG    +PG++ LN S+ P+ +  
Sbjct  686   AAPNSNVKYPMPQYKSNVPLASMPQQASLLSNYVGGFGTANGMPGNYALNQSSVPANAAP  745

Query  691   GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  512
             G D  + SQYKD +H +SLQQ EN  MW+HG GSR M    ANT Y  Q Q     G RQ
Sbjct  746   GFDGTMPSQYKDGNHYISLQQNENPAMWMHGAGSRGMPPLAANTLYGYQGQQGHQGGLRQ  805

Query  511   VQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  332
              Q PSQ  A+LG       SQ G+  +H    +NP D  L   G          + Q+W 
Sbjct  806   GQLPSQFGAALG------QSQQGLGQEH----RNPSDSNLSAAGQ---------ANQMWP  846

Query  331   NSY  323
             NSY
Sbjct  847   NSY  849



>emb|CAN79286.1| hypothetical protein VITISV_039797 [Vitis vinifera]
Length=298

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = -1

Query  664  YKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNY  488
            YK+ +HL+S QQ  ENS MW HG GS+TMSA PANTYY+ Q+QNQQP  FRQ  QPSQ++
Sbjct  191  YKNGNHLISFQQQNENSAMWNHGPGSQTMSAVPANTYYSFQSQNQQPGRFRQGHQPSQHF  250

Query  487  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  335
             +L Y PNF+HSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+W
Sbjct  251  GALEY-PNFHHSQAGISLE--HQQQNPRDGSL----SGSQGQACKQSQQIW  294



>ref|XP_006410568.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52021.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=885

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 86/129 (67%), Gaps = 9/129 (7%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  830
             ALPQ L +HPYSQ T+PL  FAN+I YP M QSY YMP  FQQ FAGNS+Y QSLAA+LP
Sbjct  604   ALPQQLPMHPYSQHTVPLAHFANMIGYPLMPQSYPYMPSAFQQAFAGNSSYHQSLAALLP  663

Query  829   NYKNSVSVSSLPHFAT---VPSGYGAFGNTGTI-PGSFPLN----PSAAPSTSLGIDDGL  674
              YKN++S S++P  AT     S YG FGN+     G++PLN     SA    SL  +D L
Sbjct  664   QYKNNISASNVPQSATSAPTSSAYG-FGNSSNAGAGNYPLNHQQQQSAPSGASLSYEDAL  722

Query  673   SSQYKDNHH  647
             S QYK N+H
Sbjct  723   SLQYKQNNH  731



>ref|XP_007048866.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
 gb|EOX93023.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
Length=873

 Score =   122 bits (306),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 97/239 (41%), Positives = 129/239 (54%), Gaps = 34/239 (14%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
              L +HL+ H YSQ             YP + QS+TY P   Q  +   + + +S + +  
Sbjct  659   VLKEHLSAHSYSQ-----------TGYPAIPQSHTYSPYALQHAYPNGNVFHESFSGMKY  707

Query  835   -LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTS-LGIDDGLSSQY  662
              LP Y+ S S+SSLP   +  SGY + GN+  IPGSF  N SA P+ S +G DD L SQY
Sbjct  708   NLPQYR-SNSMSSLPLSGSYTSGYESLGNSTDIPGSFLHNLSAGPAGSKVGYDDFLRSQY  766

Query  661   KD---NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQN  491
             +D   N +L  LQQ + S +W + HGSRT S  P + YY++Q QN Q +G+ Q Q+ SQ 
Sbjct  767   RDGGANFNL--LQQNDGSAVWDYVHGSRTTSTIPHSAYYSLQGQNHQLAGYHQGQRHSQL  824

Query  490   YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQL---WQNSY  323
             +  LGY P  Y+SQ GI+     QQQN  D  L G          PSS+QL   WQ  Y
Sbjct  825   HGFLGY-PGVYNSQAGIT--REQQQQNLGDVILNGSQS-------PSSKQLPQNWQRRY  873



>emb|CDY37665.1| BnaA04g20030D, partial [Brassica napus]
Length=670

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 88/130 (68%), Gaps = 8/130 (6%)
 Frame = -1

Query  1003  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  824
             PQ L +HPYSQ T+PL  FAN+ISYP M Q Y YMP  FQQ F+GNS+Y QS AA+LP Y
Sbjct  529   PQQLPMHPYSQHTVPLTHFANMISYPLMPQGYPYMPSAFQQAFSGNSSYHQSPAALLPQY  588

Query  823   KNSVSVSSLPHFATVPSGYGAFGNTGTI-PGSFPLN-----PSAAPS-TSLGIDDGLSSQ  665
             KN++S SSLP  A + S YG FGN+  +  G+F LN       AAP+  +L  +D +S Q
Sbjct  589   KNNISPSSLPQSAPISSPYG-FGNSSNVGAGNFSLNQQQQQQQAAPTGATLSYEDVMSLQ  647

Query  664   YKDNHHLMSL  635
             YK N HL+SL
Sbjct  648   YKQNSHLLSL  657



>ref|NP_001266740.1| uncharacterized protein LOC101027201 [Zea mays]
 gb|ACN30616.1| unknown [Zea mays]
Length=390

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 133/245 (54%), Gaps = 28/245 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTL-PLGPFANIISYP-FMHQSYT-YMPPG-FQQPFAGNSTYQQSLAA  839
             LPQ LA HPYSQPTL P+  F NI+ YP ++ Q+Y  Y+  G FQQ +  N  + QS AA
Sbjct  149   LPQQLAHHPYSQPTLAPITHFPNIVGYPPYLPQNYAAYLSSGTFQQAYPSNGAFHQSAAA  208

Query  838   VL--------PNYKNSVSVSSLPHF--------ATVPSGYGAFGNTGTIPGSFPLNPSAA  707
             +L        P YKN++S + L           ++V SGYG  G++  I G+F LN S  
Sbjct  209   LLGSGMKYSAPEYKNNLSATGLQQQHQPQPQPPSSVISGYGGLGSSSNIQGNFTLNQSTG  268

Query  706   PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  527
               ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q  
Sbjct  269   TGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLG  327

Query  526   SGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  347
                +  QQ    +   GY P FY SQ G++ +HH   QN  +G L G     QV P   S
Sbjct  328   GFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSLNGF----QVAPSQPS  380

Query  346   QQLWQ  332
                WQ
Sbjct  381   HPSWQ  385



>emb|CAE00871.1| TA9 protein [Oryza sativa Japonica Group]
Length=140

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = -1

Query  766  GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-  599
            G FG++  IPG+F LN   PSA   T++G ++ LS+Q+KDN   ++LQQ +NS MWLHG 
Sbjct  1    GGFGSSNNIPGNFGLNQNVPSAP--TTMGFEEALSTQFKDNSQYIALQQNDNSAMWLHGA  58

Query  598  HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQ  419
             GSR +SA P   +Y  Q QN QP GFRQ QQPSQ Y  LGY P+FY SQ G+  +H   
Sbjct  59   AGSRAVSAVPPGNFYGFQGQN-QPGGFRQGQQPSQ-YGGLGY-PSFYQSQAGLPHEH---  112

Query  418  QQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             QN  +G L     ++Q  P   S Q+WQ+ Y
Sbjct  113  PQNLTEGTL----NSSQTTPSQPSHQIWQHIY  140



>ref|XP_008655403.1| PREDICTED: uncharacterized protein LOC101027201 isoform X2 [Zea 
mays]
Length=836

 Score =   116 bits (291),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 133/245 (54%), Gaps = 28/245 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTL-PLGPFANIISYP-FMHQSYT-YMPPG-FQQPFAGNSTYQQSLAA  839
             LPQ LA HPYSQPTL P+  F NI+ YP ++ Q+Y  Y+  G FQQ +  N  + QS AA
Sbjct  595   LPQQLAHHPYSQPTLAPITHFPNIVGYPPYLPQNYAAYLSSGTFQQAYPSNGAFHQSAAA  654

Query  838   VL--------PNYKNSVSVSSLPHF--------ATVPSGYGAFGNTGTIPGSFPLNPSAA  707
             +L        P YKN++S + L           ++V SGYG  G++  I G+F LN S  
Sbjct  655   LLGSGMKYSAPEYKNNLSATGLQQQHQPQPQPPSSVISGYGGLGSSSNIQGNFTLNQSTG  714

Query  706   PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  527
               ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q  
Sbjct  715   TGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLG  773

Query  526   SGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  347
                +  QQ    +   GY P FY SQ G++ +HH   QN  +G L G     QV P   S
Sbjct  774   GFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSLNGF----QVAPSQPS  826

Query  346   QQLWQ  332
                WQ
Sbjct  827   HPSWQ  831



>ref|XP_008655402.1| PREDICTED: uncharacterized protein LOC101027201 isoform X1 [Zea 
mays]
 gb|AFW81159.1| putative DUF1296 domain containing family protein [Zea mays]
Length=856

 Score =   116 bits (290),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 133/245 (54%), Gaps = 28/245 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTL-PLGPFANIISYP-FMHQSYT-YMPPG-FQQPFAGNSTYQQSLAA  839
             LPQ LA HPYSQPTL P+  F NI+ YP ++ Q+Y  Y+  G FQQ +  N  + QS AA
Sbjct  615   LPQQLAHHPYSQPTLAPITHFPNIVGYPPYLPQNYAAYLSSGTFQQAYPSNGAFHQSAAA  674

Query  838   VL--------PNYKNSVSVSSLPHF--------ATVPSGYGAFGNTGTIPGSFPLNPSAA  707
             +L        P YKN++S + L           ++V SGYG  G++  I G+F LN S  
Sbjct  675   LLGSGMKYSAPEYKNNLSATGLQQQHQPQPQPPSSVISGYGGLGSSSNIQGNFTLNQSTG  734

Query  706   PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  527
               ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q  
Sbjct  735   TGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLG  793

Query  526   SGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  347
                +  QQ    +   GY P FY SQ G++ +HH   QN  +G L G     QV P   S
Sbjct  794   GFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSLNGF----QVAPSQPS  846

Query  346   QQLWQ  332
                WQ
Sbjct  847   HPSWQ  851



>ref|XP_008650021.1| PREDICTED: cell wall protein AWA1-like [Zea mays]
 gb|AFW79202.1| putative DUF1296 domain containing family protein [Zea mays]
Length=851

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 118/206 (57%), Gaps = 22/206 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY-TYMPPG-FQQPFAGNSTYQQS-----  848
             LPQ LA HPYSQPTLP+  F N++ YP++ Q+Y TY+  G FQQ +  +  + QS     
Sbjct  614   LPQQLAHHPYSQPTLPITHFPNMVGYPYLPQNYATYLSSGTFQQAYPSSGPFHQSAAAAL  673

Query  847   ----LAAVLPNYKNSVSVSSLPH--------FATVPSGYGAFGNTGTIPGSFPLNPSAAP  704
                 +    P YKN++S + L           ++V SGYG FG++  I G+F L+ S   
Sbjct  674   LASGMKYSTPEYKNNLSATGLQQQHQPQPQPLSSVISGYGGFGSSSNIQGNFTLSQSTGS  733

Query  703   STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  524
             +++LG D+ LS QYK+    M+LQQ +NSGMW+HG GSR  S  P N +Y  Q Q+Q   
Sbjct  734   ASALGFDEALSRQYKNTSQYMALQQGDNSGMWVHGSGSRAASTLPPNHFYGYQGQSQL-G  792

Query  523   GFRQVQQPS-QNYASLGYNPNFYHSQ  449
             GF + QQP    +   GY P  Y SQ
Sbjct  793   GFARAQQPQPSQFGGHGY-PTVYQSQ  817



>ref|XP_010449498.1| PREDICTED: uncharacterized protein LOC104731723 isoform X1 [Camelina 
sativa]
Length=795

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 129/237 (54%), Gaps = 38/237 (16%)
 Frame = -1

Query  985  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  815
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F  GN    QSLAA+LP YK  
Sbjct  581  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFPTGN---HQSLAAMLPQYKTQ  637

Query  814  VSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  638
             +   +P     PS YG FG       +FPLNP+ A ++    +D LSSQ+KD++HL+S 
Sbjct  638  ATAPPVP----PPSAYG-FGGGAASSNNFPLNPTNATNS---YEDVLSSQFKDSNHLVSS  689

Query  637  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYN  470
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFRQ QQ  Q   S    
Sbjct  690  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQ  746

Query  469  PNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +F        YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  747  QHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  795



>ref|XP_010449499.1| PREDICTED: uncharacterized protein LOC104731723 isoform X2 [Camelina 
sativa]
Length=794

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 129/237 (54%), Gaps = 38/237 (16%)
 Frame = -1

Query  985  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  815
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F  GN    QSLAA+LP YK  
Sbjct  580  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFPTGN---HQSLAAMLPQYKTQ  636

Query  814  VSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  638
             +   +P     PS YG FG       +FPLNP+ A ++    +D LSSQ+KD++HL+S 
Sbjct  637  ATAPPVP----PPSAYG-FGGGAASSNNFPLNPTNATNS---YEDVLSSQFKDSNHLVSS  688

Query  637  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYN  470
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFRQ QQ  Q   S    
Sbjct  689  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQ  745

Query  469  PNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +F        YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  746  QHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  794



>ref|XP_010439898.1| PREDICTED: uncharacterized protein LOC104723267 isoform X2 [Camelina 
sativa]
Length=798

 Score =   113 bits (282),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 130/237 (55%), Gaps = 38/237 (16%)
 Frame = -1

Query  985  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFA-GNSTYQQSLAAVLPNYKNS  815
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F+ GN    QSLAA+LP YK  
Sbjct  584  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFSTGN---HQSLAAMLPQYKTQ  640

Query  814  VSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  638
             +   +P     PS YG FG       +FPLNP+ A ++    +D L+SQ+KD++HL+S 
Sbjct  641  ATAPPVP----PPSAYG-FGGGAASNNNFPLNPTNATNS---YEDVLTSQFKDSNHLVSS  692

Query  637  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYN  470
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFRQ QQ  Q   S    
Sbjct  693  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQ  749

Query  469  PNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +F        YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  750  QHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  798



>ref|XP_010439897.1| PREDICTED: uncharacterized protein LOC104723267 isoform X1 [Camelina 
sativa]
Length=799

 Score =   113 bits (282),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 130/237 (55%), Gaps = 38/237 (16%)
 Frame = -1

Query  985  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFA-GNSTYQQSLAAVLPNYKNS  815
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F+ GN    QSLAA+LP YK  
Sbjct  585  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFSTGN---HQSLAAMLPQYKTQ  641

Query  814  VSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  638
             +   +P     PS YG FG       +FPLNP+ A ++    +D L+SQ+KD++HL+S 
Sbjct  642  ATAPPVP----PPSAYG-FGGGAASNNNFPLNPTNATNS---YEDVLTSQFKDSNHLVSS  693

Query  637  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYN  470
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFRQ QQ  Q   S    
Sbjct  694  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQ  750

Query  469  PNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +F        YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  751  QHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  799



>ref|XP_011467573.1| PREDICTED: uncharacterized protein LOC101307606 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 123/237 (52%), Gaps = 30/237 (13%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
              LPQHL    YSQPT      ANII YP   QS++  P   QQ +AG +   QS+A +  
Sbjct  589   VLPQHLTARSYSQPTYE--QIANIIGYPSPPQSFSRTPSALQQAYAGGTGLHQSVAGMEY  646

Query  835   -LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYK  659
               P ++N  S+S +P  A    G+G+FG +  + G++  N S AP      DD   SQYK
Sbjct  647   SFPQHRNGASISRVPPSAAA-GGHGSFGTSTNVHGNYLHNSSVAPVRDY--DDVFRSQYK  703

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS--Q  494
             D +HL  L Q             RT+S+   + Y N+  QNQQ +G+RQ Q    PS  Q
Sbjct  704   DGNHLTPLHQ-----------SPRTLSSVQDSAYNNLLGQNQQYAGYRQEQAGQVPSQLQ  752

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +Y S+GY P++Y+SQ GI+     Q+Q+  + P   G  +   Q     QQ+WQ +Y
Sbjct  753   HYGSMGY-PDYYNSQMGIT--QERQRQSLNESPFAPGIPDLSPQQL---QQIWQRTY  803



>ref|XP_011467574.1| PREDICTED: uncharacterized protein LOC101307606 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=731

 Score =   110 bits (276),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 123/237 (52%), Gaps = 30/237 (13%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  836
              LPQHL    YSQPT      ANII YP   QS++  P   QQ +AG +   QS+A +  
Sbjct  517   VLPQHLTARSYSQPTYE--QIANIIGYPSPPQSFSRTPSALQQAYAGGTGLHQSVAGMEY  574

Query  835   -LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYK  659
               P ++N  S+S +P  A    G+G+FG +  + G++  N S AP      DD   SQYK
Sbjct  575   SFPQHRNGASISRVPPSAAA-GGHGSFGTSTNVHGNYLHNSSVAPVRDY--DDVFRSQYK  631

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS--Q  494
             D +HL  L Q             RT+S+   + Y N+  QNQQ +G+RQ Q    PS  Q
Sbjct  632   DGNHLTPLHQ-----------SPRTLSSVQDSAYNNLLGQNQQYAGYRQEQAGQVPSQLQ  680

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             +Y S+GY P++Y+SQ GI+     Q+Q+  + P   G  +   Q     QQ+WQ +Y
Sbjct  681   HYGSMGY-PDYYNSQMGIT--QERQRQSLNESPFAPGIPDLSPQQL---QQIWQRTY  731



>ref|XP_010102151.1| hypothetical protein L484_021385 [Morus notabilis]
 gb|EXB92401.1| hypothetical protein L484_021385 [Morus notabilis]
Length=826

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 115/203 (57%), Gaps = 13/203 (6%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPL-GPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  833
              LPQH   +  SQPT+PL  P  N+I Y  + QSY+++P  FQQ + G+     SLA + 
Sbjct  610   VLPQHRIAN--SQPTVPLEKPSNNMIGYSGLPQSYSHLPSNFQQGYPGSDKV--SLADLN  665

Query  832   PNY-KNSVSVSSLPHFATVPSGYGAFGNTGTIPGSF-PLNPSAAPSTSLGIDDGLSSQYK  659
              N  ++  S+S  P  A+  +GYG +G    +PGS+  ++PS     + G DD    QYK
Sbjct  666   YNLPQHGASMSRFP-GASATAGYGNYGMPSNVPGSYLQISPSPPMIPNSGYDDLFHRQYK  724

Query  658   DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  479
             D  H   LQQ  NS  W  G GSR + +A    YYN+  QNQQ SG+RQ  QPSQ Y  L
Sbjct  725   DRDHFTPLQQ--NSSSWNQGPGSRKLPSAEEIAYYNLHGQNQQYSGYRQDHQPSQYYGGL  782

Query  478   GYNPNFYHSQTGISLDHHHQQQN  410
              Y+ N Y SQTG++ +  HQQ N
Sbjct  783   EYS-NPYRSQTGMARE--HQQHN  802



>ref|XP_010434571.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X3 [Camelina sativa]
Length=798

 Score =   110 bits (274),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 129/240 (54%), Gaps = 42/240 (18%)
 Frame = -1

Query  985  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  815
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F  GN    QSLAA+LP YK  
Sbjct  582  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFPTGN---HQSLAAMLPQYKTQ  638

Query  814  VSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  638
             +   +P     PS YG FG       +FPLNP+ A ++    +D LSSQ+KD++HL S 
Sbjct  639  ATAPPVP----PPSAYG-FGGGAASNNNFPLNPTNATNS---YEDVLSSQFKDSNHLTSS  690

Query  637  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQ  503
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFR             QQ
Sbjct  691  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQQPSQQ  747

Query  502  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              Q++   GY  + YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  748  QQQHFGGHGY-VSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQAQQQLWPNNY  798



>ref|XP_010434569.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X1 [Camelina sativa]
 ref|XP_010434570.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=799

 Score =   110 bits (274),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 129/240 (54%), Gaps = 42/240 (18%)
 Frame = -1

Query  985  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  815
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F  GN    QSLAA+LP YK  
Sbjct  583  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFPTGN---HQSLAAMLPQYKTQ  639

Query  814  VSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  638
             +   +P     PS YG FG       +FPLNP+ A ++    +D LSSQ+KD++HL S 
Sbjct  640  ATAPPVP----PPSAYG-FGGGAASNNNFPLNPTNATNS---YEDVLSSQFKDSNHLTSS  691

Query  637  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQ  503
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFR             QQ
Sbjct  692  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQQPSQQ  748

Query  502  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
              Q++   GY  + YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  749  QQQHFGGHGY-VSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQAQQQLWPNNY  799



>ref|XP_010559260.1| PREDICTED: uncharacterized protein LOC104827729 isoform X4 [Tarenaya 
hassleriana]
Length=793

 Score =   109 bits (273),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 19/144 (13%)
 Frame = -1

Query  994  LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQ-SLAAVLPNYKN  818
            LA+HPYSQPTLPLG +AN+I YPF+ QSYTYMP  FQQ F+GN+TY Q  L+A+LP+YK+
Sbjct  605  LAMHPYSQPTLPLGHYANMIGYPFLPQSYTYMPSAFQQAFSGNNTYHQPPLSAMLPHYKS  664

Query  817  SVSVSSLPH-FATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHH--  647
                ++LP   A VP G            + PLNPS A ++    D+ L SQ++D +   
Sbjct  665  ----NNLPQSAAAVPGG-----------NNIPLNPSNAVNSLSRYDNVLGSQFRDGNQLA  709

Query  646  LMSLQQVENSGMWLHGHGSRTMSA  575
            L SLQQ EN   W  G  SR  S+
Sbjct  710  LASLQQNENPRTWFQGQNSRLESS  733



>dbj|BAK03133.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 128/250 (51%), Gaps = 42/250 (17%)
 Frame = -1

Query  1006  LPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV-  836
             LP HLA +HPY+Q  LPLG +A++I YP + QSY Y+PP  +QQP+  +  + Q  AA  
Sbjct  309   LPHHLAALHPYAQGGLPLG-YASMIGYPSLPQSYAYLPPAAYQQPYINSGLFHQGAAAAP  367

Query  835   -------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLN---PSAAPSTSLG  689
                    +P YK++V + SLP  A++ S Y G FG    +P +F LN   PSA  +T+ G
Sbjct  368   NSGVKYPMPQYKSNVPLGSLPQPASMLSNYVGGFGTANGMPQNFALNQSNPSA--TTAPG  425

Query  688   IDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN--------TYYNIQAQNQ  533
              D  + SQYKD +  +SLQQ EN  MW+HG GSR M    AN               Q  
Sbjct  426   FDGTMPSQYKDGNPYISLQQGENPAMWMHGAGSRGMPPLAANPLYGYQGQQQGYQGQQQG  485

Query  532   QPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  353
                G RQ Q PSQ  A+LG       SQ G+  +H    +NP DG       N       
Sbjct  486   HQGGLRQGQMPSQYGAALG------QSQPGLGPEH----RNPSDG-------NLSAAAAA  528

Query  352   SSQQLWQNSY  323
              + Q+W N Y
Sbjct  529   QANQMWPNGY  538



>ref|XP_010559259.1| PREDICTED: uncharacterized protein LOC104827729 isoform X3 [Tarenaya 
hassleriana]
Length=794

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 19/144 (13%)
 Frame = -1

Query  994  LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQ-SLAAVLPNYKN  818
            LA+HPYSQPTLPLG +AN+I YPF+ QSYTYMP  FQQ F+GN+TY Q  L+A+LP+YK+
Sbjct  606  LAMHPYSQPTLPLGHYANMIGYPFLPQSYTYMPSAFQQAFSGNNTYHQPPLSAMLPHYKS  665

Query  817  SVSVSSLPH-FATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHH--  647
                ++LP   A VP G            + PLNPS A ++    D+ L SQ++D +   
Sbjct  666  ----NNLPQSAAAVPGG-----------NNIPLNPSNAVNSLSRYDNVLGSQFRDGNQLA  710

Query  646  LMSLQQVENSGMWLHGHGSRTMSA  575
            L SLQQ EN   W  G  SR  S+
Sbjct  711  LASLQQNENPRTWFQGQNSRLESS  734



>ref|XP_010559258.1| PREDICTED: uncharacterized protein LOC104827729 isoform X2 [Tarenaya 
hassleriana]
Length=795

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 19/144 (13%)
 Frame = -1

Query  994  LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQ-SLAAVLPNYKN  818
            LA+HPYSQPTLPLG +AN+I YPF+ QSYTYMP  FQQ F+GN+TY Q  L+A+LP+YK+
Sbjct  607  LAMHPYSQPTLPLGHYANMIGYPFLPQSYTYMPSAFQQAFSGNNTYHQPPLSAMLPHYKS  666

Query  817  SVSVSSLPH-FATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHH--  647
                ++LP   A VP G            + PLNPS A ++    D+ L SQ++D +   
Sbjct  667  ----NNLPQSAAAVPGG-----------NNIPLNPSNAVNSLSRYDNVLGSQFRDGNQLA  711

Query  646  LMSLQQVENSGMWLHGHGSRTMSA  575
            L SLQQ EN   W  G  SR  S+
Sbjct  712  LASLQQNENPRTWFQGQNSRLESS  735



>ref|XP_010559257.1| PREDICTED: uncharacterized protein LOC104827729 isoform X1 [Tarenaya 
hassleriana]
Length=796

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 19/144 (13%)
 Frame = -1

Query  994  LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQ-SLAAVLPNYKN  818
            LA+HPYSQPTLPLG +AN+I YPF+ QSYTYMP  FQQ F+GN+TY Q  L+A+LP+YK+
Sbjct  608  LAMHPYSQPTLPLGHYANMIGYPFLPQSYTYMPSAFQQAFSGNNTYHQPPLSAMLPHYKS  667

Query  817  SVSVSSLPH-FATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHH--  647
                ++LP   A VP G            + PLNPS A ++    D+ L SQ++D +   
Sbjct  668  ----NNLPQSAAAVPGG-----------NNIPLNPSNAVNSLSRYDNVLGSQFRDGNQLA  712

Query  646  LMSLQQVENSGMWLHGHGSRTMSA  575
            L SLQQ EN   W  G  SR  S+
Sbjct  713  LASLQQNENPRTWFQGQNSRLESS  736



>ref|XP_009356619.1| PREDICTED: uncharacterized protein LOC103947437 isoform X3 [Pyrus 
x bretschneideri]
Length=804

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 110/209 (53%), Gaps = 21/209 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFM--HQSYTYMPPGFQQPFAGNSTYQQSLAAV  836
              LPQ  A   Y+QPT      ANII YP M   Q+Y+ MP   QQ + G S + QS A++
Sbjct  585   VLPQRHAARSYAQPTHSYEQLANIIGYPSMPQAQNYSPMPSNLQQEYLGGSAFHQSGASM  644

Query  835   ---LPNYKNSVSVSSLPHFATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  668
                 P Y++  SVS LP  A    +G+G+FG +    GSF  N SA P +    DD    
Sbjct  645   EYNFPQYRSGASVSRLPTSAAAAVAGHGSFGASNNNHGSFLHNASATPGSIADYDDVFRP  704

Query  667   QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  497
             QYKD +HL +L Q            SRT+ + P + + N+  QNQQ +G+RQ Q    PS
Sbjct  705   QYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPS  753

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQN  410
             Q  +  G+ P+FYHSQ  ++ +   Q+ N
Sbjct  754   QLQSYRGH-PDFYHSQVDVTQELQRQRLN  781



>ref|XP_009356617.1| PREDICTED: uncharacterized protein LOC103947437 isoform X1 [Pyrus 
x bretschneideri]
Length=827

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 110/209 (53%), Gaps = 21/209 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFM--HQSYTYMPPGFQQPFAGNSTYQQSLAAV  836
              LPQ  A   Y+QPT      ANII YP M   Q+Y+ MP   QQ + G S + QS A++
Sbjct  608   VLPQRHAARSYAQPTHSYEQLANIIGYPSMPQAQNYSPMPSNLQQEYLGGSAFHQSGASM  667

Query  835   ---LPNYKNSVSVSSLPHFATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  668
                 P Y++  SVS LP  A    +G+G+FG +    GSF  N SA P +    DD    
Sbjct  668   EYNFPQYRSGASVSRLPTSAAAAVAGHGSFGASNNNHGSFLHNASATPGSIADYDDVFRP  727

Query  667   QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  497
             QYKD +HL +L Q            SRT+ + P + + N+  QNQQ +G+RQ Q    PS
Sbjct  728   QYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPS  776

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQN  410
             Q  +  G+ P+FYHSQ  ++ +   Q+ N
Sbjct  777   QLQSYRGH-PDFYHSQVDVTQELQRQRLN  804



>dbj|BAJ94362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=845

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 128/250 (51%), Gaps = 42/250 (17%)
 Frame = -1

Query  1006  LPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV-  836
             LP HLA +HPY+Q  LPLG +A++I YP + QSY Y+PP  +QQP+  +  + Q  AA  
Sbjct  616   LPHHLAALHPYAQGGLPLG-YASMIGYPSLPQSYAYLPPAAYQQPYINSGLFHQGAAAAP  674

Query  835   -------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLN---PSAAPSTSLG  689
                    +P YK++V + SLP  A++ S Y G FG    +P +F LN   PSA  +T+ G
Sbjct  675   NSGVKYPMPQYKSNVPLGSLPQPASMLSNYVGGFGTANGMPQNFALNQSNPSA--TTAPG  732

Query  688   IDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN--------TYYNIQAQNQ  533
              D  + SQYKD +  +SLQQ EN  MW+HG GSR M    AN               Q  
Sbjct  733   FDGTMPSQYKDGNPYISLQQGENPAMWMHGAGSRGMPPLAANPLYGYQGQQQGYQGQQQG  792

Query  532   QPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  353
                G RQ Q PSQ  A+LG       SQ G+  +H    +NP DG       N       
Sbjct  793   HQGGLRQGQMPSQYGAALG------QSQPGLGPEH----RNPSDG-------NLSAAAAA  835

Query  352   SSQQLWQNSY  323
              + Q+W N Y
Sbjct  836   QANQMWPNGY  845



>ref|XP_008380341.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=799

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 109/208 (52%), Gaps = 21/208 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFM--HQSYTYMPPGFQQPFAGNSTYQQSLAAV  836
              LPQ  A   Y+QPT      ANII YP M   Q+Y+ MP   QQ + G S + QS A++
Sbjct  582   VLPQRHAARSYAQPTHSYEQLANIIGYPSMPQAQNYSPMPSNLQQEYLGGSAFHQSGASM  641

Query  835   ---LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQ  665
                 P Y++  SVS LP  A   +G G+FG +    GSF  N SA P +    DD    Q
Sbjct  642   EYNFPQYRSGASVSRLPTSAAA-AGRGSFGASNNNHGSFLHNASATPGSIADYDDVFRPQ  700

Query  664   YKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PSQ  494
             YKD +HL +L Q            SRT+ + P + + N+  QNQQ +G+RQ Q    PSQ
Sbjct  701   YKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPSQ  749

Query  493   NYASLGYNPNFYHSQTGISLDHHHQQQN  410
               +  G+ P+FYHSQ  ++ +   Q+ N
Sbjct  750   LQSYRGH-PDFYHSQVDVTQELQRQRLN  776



>ref|XP_002870069.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=802

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 128/241 (53%), Gaps = 43/241 (18%)
 Frame = -1

Query  985  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  815
            +PYS QP +PLG + N+ISYPFM QSY  YMP  FQQ F  GN    QSLAA+LP YK  
Sbjct  585  NPYSHQPGMPLGHYGNLISYPFMAQSYNPYMPSAFQQAFPTGN---HQSLAAMLPQYKTQ  641

Query  814  VSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  638
             +   +P     PS YG FG       +FPLNP++A ++    +D LSSQ+ D +HL S 
Sbjct  642  ATAPPVP----PPSAYG-FGGGAASSNNFPLNPTSAANS---YEDVLSSQFNDGNHLASS  693

Query  637  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFR------------QVQ  506
              QQ ENS  W  G    SR +   P + YY+    QNQQP GFR            Q Q
Sbjct  694  LQQQNENSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQPSQQQ  750

Query  505  QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNS  326
            Q  Q+Y   GY  + YHSQ  +SL+H H Q             NA+   K + QQLW N+
Sbjct  751  QQQQHYGGHGY-VSPYHSQAAMSLEHLHHQH--------QQQQNARDASKQTQQQLWPNN  801

Query  325  Y  323
            Y
Sbjct  802  Y  802



>emb|CDY61669.1| BnaC01g40800D [Brassica napus]
Length=740

 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 124/234 (53%), Gaps = 41/234 (18%)
 Frame = -1

Query  982  PYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFAGNSTYQQSLAAVLPNYKNSVS  809
            PYS QP +PLG + N++SYPFM QSY  YMP  FQQ F   + +Q    ++LP YK   +
Sbjct  534  PYSHQPGMPLGHYGNLMSYPFMPQSYNPYMPSAFQQAFPSGNHHQ----SMLPQYKTQAT  589

Query  808  VSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS--L  635
               +P     PS YG  G    +  +FPLN ++AP++    +D LSSQ++D++HL S   
Sbjct  590  APPVP----PPSAYGFGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSNHLASSLQ  642

Query  634  QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--------QVQQPSQNYASL  479
            QQ E+   W  G  S +    P + YY+   QNQQP GFR          QQ  Q++   
Sbjct  643  QQNEHLAAWHQGQQSNSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQHFGGH  699

Query  478  GYNPNFYHSQTGISLD--HHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
             Y  + YHSQ  +SLD  HH QQQN RD              K + QQLW N+Y
Sbjct  700  SYG-SHYHSQASMSLDHLHHQQQQNARDA------------SKQTHQQLWPNNY  740



>ref|XP_009356618.1| PREDICTED: uncharacterized protein LOC103947437 isoform X2 [Pyrus 
x bretschneideri]
Length=809

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 110/209 (53%), Gaps = 21/209 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFM--HQSYTYMPPGFQQPFAGNSTYQQSLAAV  836
             ++ +  A   Y+QPT      ANII YP M   Q+Y+ MP   QQ + G S + QS A++
Sbjct  590   SMSERHAARSYAQPTHSYEQLANIIGYPSMPQAQNYSPMPSNLQQEYLGGSAFHQSGASM  649

Query  835   ---LPNYKNSVSVSSLPHFATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  668
                 P Y++  SVS LP  A    +G+G+FG +    GSF  N SA P +    DD    
Sbjct  650   EYNFPQYRSGASVSRLPTSAAAAVAGHGSFGASNNNHGSFLHNASATPGSIADYDDVFRP  709

Query  667   QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  497
             QYKD +HL +L Q            SRT+ + P + + N+  QNQQ +G+RQ Q    PS
Sbjct  710   QYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPS  758

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQN  410
             Q  +  G+ P+FYHSQ  ++ +   Q+ N
Sbjct  759   QLQSYRGH-PDFYHSQVDVTQELQRQRLN  786



>gb|EMS61509.1| hypothetical protein TRIUR3_20581 [Triticum urartu]
Length=767

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 89/147 (61%), Gaps = 13/147 (9%)
 Frame = -1

Query  1006  LPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV-  836
             LP HLA +HPY+Q  LPLG +A++I YP + QSY Y+PP  +QQP+  +  + Q  AA  
Sbjct  557   LPHHLAALHPYAQGGLPLG-YASMIGYPSLPQSYAYLPPAAYQQPYMNSGLFHQGAAAAP  615

Query  835   -------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GID  683
                    +P YK +V + SLP  A++ S Y G FG    +P +F LN S  P+T+  G D
Sbjct  616   NSGVKYPMPQYKGNVPLGSLPQPASMLSNYVGGFGTANGMPQNFALNQSNPPATTAPGFD  675

Query  682   DGLSSQYKDNHHLMSLQQVENSGMWLH  602
               + SQYKD +  MSLQQ EN  MW+H
Sbjct  676   GAMPSQYKDGNPYMSLQQGENPAMWMH  702



>ref|XP_006282485.1| hypothetical protein CARUB_v10006235mg [Capsella rubella]
 gb|EOA15383.1| hypothetical protein CARUB_v10006235mg [Capsella rubella]
Length=732

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 114/214 (53%), Gaps = 29/214 (14%)
 Frame = -1

Query  1009  ALPQHLAVHPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFAGNSTYQQSLAAV  836
             AL QHLA++ +S QP +PLG ++N+ISYPFM QSY  YMP GFQQ    N+  QQSLAA+
Sbjct  529   ALTQHLALNSFSHQPRMPLGHYSNLISYPFMTQSYNPYMPSGFQQALPTNN--QQSLAAM  586

Query  835   LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKD  656
             LP YK+  +   +P     P     FG +     +F LNP++A ++    +D  SSQ+K 
Sbjct  587   LPQYKSQATAHHVP-----PPSVNGFGGSAASSNNFSLNPASAANS---YEDVSSSQFKH  638

Query  655   NHHLMSLQQ--VENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR----------  515
              +HL S  Q   ENS  W  G     +     N YY+    QNQ   GFR          
Sbjct  639   INHLASPHQHKNENSAAWHQG-KQPNLRVTMGNGYYSFPGHQNQHLHGFRQTQQLQQQHQ  697

Query  514   QVQQPSQNYASLGY-NPNFYHSQTGISLDHHHQQ  416
               Q   Q++   GY +P  YHSQ  +SLDH H Q
Sbjct  698   LSQHQQQHFGGHGYVSP--YHSQAAMSLDHLHYQ  729



>ref|XP_009131438.1| PREDICTED: flocculation protein FLO11 [Brassica rapa]
Length=780

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 119/236 (50%), Gaps = 41/236 (17%)
 Frame = -1

Query  982  PYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFAGNSTYQQSLAAVLPNYKNSVS  809
            PYS QP +PLG + N++SYPFM QSY  YMP  FQQ F   + +Q    ++LP YK   +
Sbjct  570  PYSHQPGMPLGHYGNLMSYPFMPQSYNPYMPSAFQQAFPSGNHHQ----SMLPQYKTQAT  625

Query  808  VSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS--L  635
               +P     PS YG  G    +  +FPLN ++AP++    +D LSSQ++D+ HL S   
Sbjct  626  APPVP----PPSAYGFGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSSHLASSLQ  678

Query  634  QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNF--  461
            QQ E+   W  G  S +    P + YY+   QNQQP GFRQ Q   Q         +F  
Sbjct  679  QQNEHLAAWHQGQQSNSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQQHFGG  735

Query  460  ------YHSQTGISLDH----HHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
                  YHSQ  +SLDH    H QQQN RD                  QQLW N+Y
Sbjct  736  HGYGSPYHSQAPMSLDHLHHQHQQQQNARDASKQTHQ-----------QQLWPNNY  780



>emb|CDX78828.1| BnaA01g08950D [Brassica napus]
Length=698

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 123/236 (52%), Gaps = 42/236 (18%)
 Frame = -1

Query  982  PYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFAGNSTYQQSLAAVLPNYKNSVS  809
            PYS QP +PLG + N++SYPFM QSY  YMP  FQQ F   + +Q    ++LP YK   +
Sbjct  489  PYSHQPGMPLGHYGNLMSYPFMPQSYNPYMPSAFQQAFPSGNHHQ----SMLPQYKTQAT  544

Query  808  VSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--  635
               +P     PS YG  G    +  +FPLN ++AP++    +D LSSQ++D+ HL S   
Sbjct  545  APPVP----PPSAYGFGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSSHLASSLQ  597

Query  634  QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--------QVQQPSQNYASL  479
            QQ E+   W  G  S +    P + YY+   QNQQP GFR          QQ  Q++   
Sbjct  598  QQNEHLAAWHQGQQSNSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQHFGGH  654

Query  478  GYNPNFYHSQTGISLDH----HHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
            GY  + YHSQ  +SLDH    H QQQN RD              +   QQLW N+Y
Sbjct  655  GYG-SPYHSQAPMSLDHLHHQHQQQQNARD-----------ASKQTHQQQLWPNNY  698



>gb|KFK28493.1| hypothetical protein AALP_AA7G003100 [Arabis alpina]
Length=797

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 122/237 (51%), Gaps = 43/237 (18%)
 Frame = -1

Query  985  HPYSQPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNSV  812
            +PYSQP +PLGP+ N+ISY FM QSY  YMP  FQQ F  GN    QSLAA+LP YK   
Sbjct  583  NPYSQPGMPLGPYGNLISYQFMPQSYNPYMPSAFQQAFPTGN---HQSLAAMLPQYKTQA  639

Query  811  SVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL-  635
            +   +P     PS YG FG       ++PLN ++A ++    +D L    ++++HL S  
Sbjct  640  TAPPVP----PPSAYG-FGGGAASSNNYPLNSTSAANS---YEDVL----RESNHLASSL  687

Query  634  -QQVENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR-------------QVQQP  500
             QQ E+S  W  G  + +    P + YY+  + QNQQP GFR             Q QQ 
Sbjct  688  QQQNEDSAAWHQGQQANSR-VVPGSGYYSFPSHQNQQPPGFRQGQQLQQQQPSQQQQQQQ  746

Query  499  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  329
             Q +   GY  N YHSQ  +SL+H H Q             NA+   K + QQLW N
Sbjct  747  QQQFGGHGYG-NPYHSQAAMSLEHLHHQH--------QQQQNARDASKQTQQQLWPN  794



>gb|KFK28492.1| hypothetical protein AALP_AA7G003100 [Arabis alpina]
Length=796

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 122/237 (51%), Gaps = 43/237 (18%)
 Frame = -1

Query  985  HPYSQPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNSV  812
            +PYSQP +PLGP+ N+ISY FM QSY  YMP  FQQ F  GN    QSLAA+LP YK   
Sbjct  582  NPYSQPGMPLGPYGNLISYQFMPQSYNPYMPSAFQQAFPTGN---HQSLAAMLPQYKTQA  638

Query  811  SVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL-  635
            +   +P     PS YG FG       ++PLN ++A ++    +D L    ++++HL S  
Sbjct  639  TAPPVP----PPSAYG-FGGGAASSNNYPLNSTSAANS---YEDVL----RESNHLASSL  686

Query  634  -QQVENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR-------------QVQQP  500
             QQ E+S  W  G  + +    P + YY+  + QNQQP GFR             Q QQ 
Sbjct  687  QQQNEDSAAWHQGQQANSR-VVPGSGYYSFPSHQNQQPPGFRQGQQLQQQQPSQQQQQQQ  745

Query  499  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  329
             Q +   GY  N YHSQ  +SL+H H Q             NA+   K + QQLW N
Sbjct  746  QQQFGGHGYG-NPYHSQAAMSLEHLHHQH--------QQQQNARDASKQTQQQLWPN  793



>emb|CAB53656.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78817.1| hypothetical protein [Arabidopsis thaliana]
Length=762

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 96/170 (56%), Gaps = 18/170 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAV  836
             L QHLA++PYS QP +PLG + N+ISYPFM Q Y  +M   FQQ F  GN    QSL  +
Sbjct  545   LAQHLALNPYSHQPEMPLGHYGNLISYPFMAQCYNPFMLSAFQQVFPTGN---HQSLVDM  601

Query  835   LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKD  656
             L  YK   +   +P     PS YG FG       +FPLNP++A ++    +D LSSQ+ +
Sbjct  602   LMQYKTQTTAPPVP----PPSAYG-FGGGAVSSNNFPLNPTSAANS---YEDVLSSQFNE  653

Query  655   NHHLMS--LQQVENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR  515
             ++HL S   QQ E +  W  G  + +    P + YY+    QNQQP GFR
Sbjct  654   SNHLASSLQQQNEKTTAWHQGQQANSR-VVPGSGYYSYPGHQNQQPPGFR  702



>ref|NP_193549.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84004.1| uncharacterized protein AT4G18150 [Arabidopsis thaliana]
Length=758

 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 96/170 (56%), Gaps = 18/170 (11%)
 Frame = -1

Query  1006  LPQHLAVHPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAV  836
             L QHLA++PYS QP +PLG + N+ISYPFM Q Y  +M   FQQ F  GN    QSL  +
Sbjct  541   LAQHLALNPYSHQPEMPLGHYGNLISYPFMAQCYNPFMLSAFQQVFPTGN---HQSLVDM  597

Query  835   LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKD  656
             L  YK   +   +P     PS YG FG       +FPLNP++A ++    +D LSSQ+ +
Sbjct  598   LMQYKTQTTAPPVP----PPSAYG-FGGGAVSSNNFPLNPTSAANS---YEDVLSSQFNE  649

Query  655   NHHLMS--LQQVENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR  515
             ++HL S   QQ E +  W  G  + +    P + YY+    QNQQP GFR
Sbjct  650   SNHLASSLQQQNEKTTAWHQGQQANSR-VVPGSGYYSYPGHQNQQPPGFR  698



>ref|XP_006414144.1| hypothetical protein EUTSA_v10027504mg [Eutrema salsugineum]
 gb|ESQ55597.1| hypothetical protein EUTSA_v10027504mg [Eutrema salsugineum]
Length=799

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 125/238 (53%), Gaps = 35/238 (15%)
 Frame = -1

Query  985  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  815
            +PY+ QP +P+G + N+ISYPFM QSY  YMP  FQQ F  GN    Q+LAA+   YKN 
Sbjct  580  NPYAHQPGMPVGHYGNLISYPFMPQSYNPYMPLAFQQAFPTGN---HQTLAAMHLQYKNQ  636

Query  814  VSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHL-MS  638
             +   +P     PS Y  FG       +FPL P+ + ++    +D LSSQ+KD +HL +S
Sbjct  637  ATAPPIP----PPSAY-RFGGGAPSSNNFPLTPTTSANS---YEDVLSSQFKDRNHLALS  688

Query  637  LQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQPS  497
            LQQ  ENS  W  G  S +    P + YY+    Q+QQP GFR             QQ  
Sbjct  689  LQQQNENSAAWHQGQQSNSR-VVPGSGYYSFPGHQSQQPPGFRQAQQLQQQQQPSQQQQQ  747

Query  496  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  323
            Q++   GY  + YHSQ  +SL+H H Q             NA+   K + QQLW N+Y
Sbjct  748  QHFGGHGY-ASPYHSQAAMSLEHLHHQHQ-----HQQQQQNARDASKQTQQQLWPNNY  799



>ref|XP_012087231.1| PREDICTED: uncharacterized protein LOC105646039 [Jatropha curcas]
 gb|KDP46910.1| hypothetical protein JCGZ_10401 [Jatropha curcas]
Length=883

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 110/231 (48%), Gaps = 20/231 (9%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQ--PFAGNSTYQQSLAAV  836
              +PQHL  H YSQ  L L    N  +Y  + Q+Y+ +P   QQ   +  +S +   LA +
Sbjct  663   VVPQHLPAHSYSQSPLSLEELLNWNAYSAVPQTYSGIPSALQQQQAYQDSSAFLDPLAGM  722

Query  835   ---LPNYKNSVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSS  668
                L   +   S SS+P      S YG  GN+    GSF  +PSA  + S+ G +D L S
Sbjct  723   RYNLQQLRGVASRSSIPLSHANVSSYGGLGNSTNFSGSFLNDPSATINRSVVGYNDLLRS  782

Query  667   QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNY  488
             QYK+ ++   L Q  +   W +  GSR +S  P N YYN Q    QP  ++Q Q  SQNY
Sbjct  783   QYKEGNNFTMLHQNHSLSSWDYEPGSRPLSTVPNNGYYNFQG--GQPPMYQQGQLLSQNY  840

Query  487   ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  335
              +    P F HSQ  I      QQQN  D PL    G     P    +QLW
Sbjct  841   GA----PVF-HSQQRIL--REEQQQNLGDLPLSSSQG-----PSKQVRQLW  879



>ref|XP_008362365.1| PREDICTED: uncharacterized protein LOC103426056 [Malus domestica]
Length=843

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 104/209 (50%), Gaps = 21/209 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISY-PFM--HQSYTYMPPGFQQPFAGNSTYQQSLAA  839
              LPQ      Y+QPTL     AN + Y P +   Q+Y+ +PP  QQ + G S +  S A+
Sbjct  624   VLPQCHTARSYAQPTLSYEQLANGMVYKPSIPQAQNYSPVPPNLQQEYVGGSAFHMSGAS  683

Query  838   VLPNY--KNSVSVSSLPHFATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  668
             +  N+   +  SVS LP  A    +G+G FG +    GS   N SA P +    DD    
Sbjct  684   MEYNFPQYSGASVSRLPTSAAAAVTGHGRFGASNNTHGSLLHNASATPGSIPDYDDVFRP  743

Query  667   QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  497
             QYKD +HL +L Q            SRT+ + P   + N+   NQQ +G+RQ Q    P+
Sbjct  744   QYKDGNHLAALYQ-----------SSRTLPSVPDRAFNNLHGHNQQHAGYRQGQAGQLPT  792

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQN  410
             Q    LG+ P+FY SQ  ++ +H  Q+ N
Sbjct  793   QLQNYLGH-PDFYFSQKDVTQEHQRQRLN  820



>ref|XP_008342489.1| PREDICTED: uncharacterized protein LOC103405294 [Malus domestica]
Length=843

 Score = 89.0 bits (219),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 104/209 (50%), Gaps = 21/209 (10%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISY-PFM--HQSYTYMPPGFQQPFAGNSTYQQSLAA  839
              LPQ      Y+QPTL     AN + Y P +   Q+Y+ +PP  QQ + G S +  S A+
Sbjct  624   VLPQCHTARSYAQPTLSYEQLANGMVYKPSIPQAQNYSPVPPNLQQEYVGGSAFHMSGAS  683

Query  838   VLPNY--KNSVSVSSLPHFATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  668
             +  N+   +  SVS LP  A    +G+G FG +    GS   N SA P +    DD    
Sbjct  684   MEYNFPQYSGASVSRLPTSAAAAVTGHGRFGASNNTHGSLLHNASATPGSIPDYDDVFRP  743

Query  667   QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  497
             QYKD +HL +L Q            SRT+ + P   + N+   NQQ +G+RQ Q    P+
Sbjct  744   QYKDGNHLAALYQ-----------SSRTLPSVPDRAFNNLHGHNQQHAGYRQGQAGQLPT  792

Query  496   QNYASLGYNPNFYHSQTGISLDHHHQQQN  410
             Q    LG+ P+FY SQ  ++ +H  Q+ N
Sbjct  793   QLQNYLGH-PDFYFSQKDVTQEHQRQRLN  820



>emb|CDY11787.1| BnaC03g57910D [Brassica napus]
Length=737

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 83/134 (62%), Gaps = 25/134 (19%)
 Frame = -1

Query  676  LSSQYKDNHHLMSLQ----QVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  524
            LSS++  ++H+++LQ    Q ENS MW HGHGSRTMS  PANT+YN+QAQ QQ       
Sbjct  613  LSSKHTRSNHVLALQHQQQQNENSAMWHHGHGSRTMSGVPANTHYNLQAQQQQQLQQTQQ  672

Query  523  ----GFR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV--  365
                G+R   QQ  Q Y S GY+ NFY  QT +SL+   QQQNPRDG        AQV  
Sbjct  673  AAAVGYRQAQQQQQQRYGSYGYS-NFYQFQTEMSLE--RQQQNPRDGA------GAQVGQ  723

Query  364  QPKPSSQQLWQNSY  323
            QP   +QQLWQNSY
Sbjct  724  QPSDQTQQLWQNSY  737



>gb|EMT27654.1| hypothetical protein F775_52320 [Aegilops tauschii]
Length=649

 Score = 85.1 bits (209),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 86/149 (58%), Gaps = 17/149 (11%)
 Frame = -1

Query  1006  LPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV-  836
             LP HLA +HPY+Q  LPLG + N+  YP + QSY Y+PP  +QQ +  +  + Q  AA  
Sbjct  502   LPHHLAALHPYAQGGLPLG-YENMTGYPSLPQSYAYLPPAAYQQAYMNSGLFHQGAAAAP  560

Query  835   -------LPNYKNSVSVSSLPHFATVPSGY-GAFGNTGTIPGSFPLN---PSAAPSTSLG  689
                    +P Y ++V + SLP  A++ S Y G FG    +P +F LN   PSA  +T+ G
Sbjct  561   NSGIKYPMPQYNSNVPLGSLPQPASMLSNYVGGFGTANGMPQNFALNQSNPSA--TTTPG  618

Query  688   IDDGLSSQYKDNHHLMSLQQVENSGMWLH  602
              D  + SQYKD +  MSLQQVE +   +H
Sbjct  619   FDGAMPSQYKDGNPYMSLQQVEPTRERIH  647



>ref|XP_009377414.1| PREDICTED: uncharacterized protein LOC103966021 [Pyrus x bretschneideri]
Length=822

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 105/209 (50%), Gaps = 25/209 (12%)
 Frame = -1

Query  1009  ALPQHLAVHPYSQPTLPLGPFANIISY-PFM--HQSYTYMPPGFQQPFAGNSTYQQSLAA  839
              LPQ      Y+QPTL     AN + Y P M   Q+Y+ +PP  QQ + G S + QS A+
Sbjct  603   VLPQCHTSRSYAQPTLSYEQLANSMVYKPSMPQAQNYSPVPPNLQQEYVGGSAFHQSGAS  662

Query  838   VLPNY--KNSVSVSSLPHFATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  668
             +  N+   +  SVS LP  A    +G+ +FG +    GS   N SA P +    DD    
Sbjct  663   MEYNFPQYSGASVSRLPTSAAAAVTGHVSFGASNNTHGSLLHNASATPGSIPDYDDVFRP  722

Query  667   QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ---VQQPS  497
             QYKD +HL +L Q            SRT+ + P + + N+   NQQ +G+RQ    Q P+
Sbjct  723   QYKDGNHLATLYQ-----------SSRTLPSVPDSAFNNLLGHNQQHAGYRQGRAGQLPT  771

Query  496   --QNYASLGYNPNFYHSQTGISLDHHHQQ  416
               QNY     +P+FY SQ  ++ +H  Q+
Sbjct  772   KLQNYRG---HPDFYFSQKDVTQEHQRQR  797



>gb|KDO60959.1| hypothetical protein CISIN_1g0031902mg, partial [Citrus sinensis]
Length=755

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 89/184 (48%), Gaps = 15/184 (8%)
 Frame = -1

Query  988  VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---LPNYKN  818
            +H Y+Q  LP G   N+I YP M Q  TY+P   Q  +   S +  SLA +   LP Y++
Sbjct  572  LHSYAQSRLPSGKLTNMIGYPSMPQRQTYVPSALQHAYPEASVFHDSLAGMNYNLPQYRS  631

Query  817  SVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS  638
            S ++  LP   +  S YG+F  + T+P    +  +  P           S Y D + L  
Sbjct  632  SGTIGGLPLSNSGLSAYGSFVGSSTLPMGAAVGYNGPP----------QSHYMDGNSL-P  680

Query  637  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY-NPNF  461
             QQ   S  W  G   +  S    + YY++  QNQ   G++  QQ SQ+Y SLGY NPN 
Sbjct  681  RQQHNRSSTWDLGASRQASSMHSDSAYYSLLRQNQHHPGYQVDQQASQHYESLGYPNPNT  740

Query  460  YHSQ  449
            YHS 
Sbjct  741  YHSD  744



>ref|XP_006484854.1| PREDICTED: uncharacterized protein LOC102628559 isoform X1 [Citrus 
sinensis]
Length=840

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 89/184 (48%), Gaps = 15/184 (8%)
 Frame = -1

Query  988  VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---LPNYKN  818
            +H Y+Q  LP G   N+I YP M Q  TY+P   Q  +   S +  SLA +   LP Y++
Sbjct  657  LHSYAQSRLPSGKLTNMIGYPSMPQRQTYVPSALQHAYPEASVFHDSLAGMNYNLPQYRS  716

Query  817  SVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS  638
            S ++  LP   +  S YG+F  + T+P    +  +  P           S Y D + L  
Sbjct  717  SGTIGGLPLSNSGLSAYGSFVGSSTLPMGAAVGYNGPP----------QSHYMDGNSL-P  765

Query  637  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY-NPNF  461
             QQ   S  W  G   +  S    + YY++  QNQ   G++  QQ SQ+Y SLGY NPN 
Sbjct  766  RQQHNRSSTWDLGASRQASSMHSDSAYYSLLRQNQHHPGYQVDQQASQHYESLGYPNPNT  825

Query  460  YHSQ  449
            YHS 
Sbjct  826  YHSD  829



>gb|KDO60960.1| hypothetical protein CISIN_1g0031902mg, partial [Citrus sinensis]
Length=759

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 89/184 (48%), Gaps = 15/184 (8%)
 Frame = -1

Query  988  VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---LPNYKN  818
            +H Y+Q  LP G   N+I YP M Q  TY+P   Q  +   S +  SLA +   LP Y++
Sbjct  576  LHSYAQSRLPSGKLTNMIGYPSMPQRQTYVPSALQHAYPEASVFHDSLAGMNYNLPQYRS  635

Query  817  SVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS  638
            S ++  LP   +  S YG+F  + T+P    +  +  P           S Y D + L  
Sbjct  636  SGTIGGLPLSNSGLSAYGSFVGSSTLPMGAAVGYNGPP----------QSHYMDGNSL-P  684

Query  637  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY-NPNF  461
             QQ   S  W  G   +  S    + YY++  QNQ   G++  QQ SQ+Y SLGY NPN 
Sbjct  685  RQQHNRSSTWDLGASRQASSMHSDSAYYSLLRQNQHHPGYQVDQQASQHYESLGYPNPNT  744

Query  460  YHSQ  449
            YHS 
Sbjct  745  YHSD  748



>ref|XP_006484855.1| PREDICTED: uncharacterized protein LOC102628559 isoform X2 [Citrus 
sinensis]
Length=836

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 89/184 (48%), Gaps = 15/184 (8%)
 Frame = -1

Query  988  VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---LPNYKN  818
            +H Y+Q  LP G   N+I YP M Q  TY+P   Q  +   S +  SLA +   LP Y++
Sbjct  653  LHSYAQSRLPSGKLTNMIGYPSMPQRQTYVPSALQHAYPEASVFHDSLAGMNYNLPQYRS  712

Query  817  SVSVSSLPHFATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS  638
            S ++  LP   +  S YG+F  + T+P    +  +  P           S Y D + L  
Sbjct  713  SGTIGGLPLSNSGLSAYGSFVGSSTLPMGAAVGYNGPP----------QSHYMDGNSL-P  761

Query  637  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY-NPNF  461
             QQ   S  W  G   +  S    + YY++  QNQ   G++  QQ SQ+Y SLGY NPN 
Sbjct  762  RQQHNRSSTWDLGASRQASSMHSDSAYYSLLRQNQHHPGYQVDQQASQHYESLGYPNPNT  821

Query  460  YHSQ  449
            YHS 
Sbjct  822  YHSD  825



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2529774447726