BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5417

Length=979
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010682420.1|  PREDICTED: AP-1 complex subunit mu-2               411   2e-138   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO69520.1|  hypothetical protein CISIN_1g014251mg                   405   7e-138   Citrus sinensis [apfelsine]
ref|XP_010248608.1|  PREDICTED: AP-1 complex subunit mu-2-like          409   1e-137   Nelumbo nucifera [Indian lotus]
ref|XP_009604122.1|  PREDICTED: AP-1 complex subunit mu-2               409   1e-137   Nicotiana tomentosiformis
ref|XP_002511345.1|  clathrin coat assembly protein ap-1, putative      409   2e-137   Ricinus communis
ref|XP_010251124.1|  PREDICTED: AP-1 complex subunit mu-2               408   4e-137   Nelumbo nucifera [Indian lotus]
ref|XP_006847624.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    408   4e-137   Amborella trichopoda
ref|XP_010044585.1|  PREDICTED: AP-1 complex subunit mu-2               408   4e-137   Eucalyptus grandis [rose gum]
gb|KHN13429.1|  AP-1 complex subunit mu-2                               400   4e-137   Glycine soja [wild soybean]
gb|KHN14546.1|  AP-1 complex subunit mu-1-I                             407   5e-137   Glycine soja [wild soybean]
ref|XP_009763320.1|  PREDICTED: AP-1 complex subunit mu-2               407   8e-137   Nicotiana sylvestris
ref|XP_010923038.1|  PREDICTED: AP-1 complex subunit mu-2               407   8e-137   Elaeis guineensis
ref|XP_003517576.1|  PREDICTED: AP-1 complex subunit mu-2-like          407   9e-137   
gb|AFW83687.1|  hypothetical protein ZEAMMB73_283352                    399   1e-136   
ref|XP_004135264.1|  PREDICTED: AP-1 complex subunit mu-2               407   1e-136   Cucumis sativus [cucumbers]
ref|XP_008791180.1|  PREDICTED: AP-1 complex subunit mu-2               407   1e-136   Phoenix dactylifera
ref|XP_006439891.1|  hypothetical protein CICLE_v10023962mg             407   1e-136   Citrus clementina [clementine]
ref|XP_002274463.1|  PREDICTED: AP-1 complex subunit mu-2               407   1e-136   Vitis vinifera
ref|XP_003613166.1|  AP-1 complex subunit mu                            407   1e-136   Medicago truncatula
ref|XP_004489791.1|  PREDICTED: AP-1 complex subunit mu-1-like          407   2e-136   Cicer arietinum [garbanzo]
ref|XP_011086615.1|  PREDICTED: AP-1 complex subunit mu-2               406   2e-136   Sesamum indicum [beniseed]
ref|XP_008446174.1|  PREDICTED: AP-1 complex subunit mu-2               406   2e-136   Cucumis melo [Oriental melon]
ref|XP_003519692.1|  PREDICTED: AP-1 complex subunit mu-2-like          406   3e-136   Glycine max [soybeans]
gb|EYU22519.1|  hypothetical protein MIMGU_mgv1a006868mg                406   3e-136   Erythranthe guttata [common monkey flower]
gb|EYU28424.1|  hypothetical protein MIMGU_mgv1a006870mg                406   3e-136   Erythranthe guttata [common monkey flower]
ref|XP_011071132.1|  PREDICTED: AP-1 complex subunit mu-2               405   3e-136   Sesamum indicum [beniseed]
ref|XP_010475954.1|  PREDICTED: AP-1 complex subunit mu-2-like          405   5e-136   Camelina sativa [gold-of-pleasure]
ref|XP_009623841.1|  PREDICTED: AP-1 complex subunit mu-2               405   7e-136   Nicotiana tomentosiformis
ref|XP_004239119.1|  PREDICTED: AP-1 complex subunit mu-2               405   7e-136   Solanum lycopersicum
ref|XP_006307589.1|  hypothetical protein CARUB_v10009212mg             404   1e-135   Capsella rubella
ref|XP_002889832.1|  clathrin adaptor complexes medium subunit fa...    404   1e-135   Arabidopsis lyrata subsp. lyrata
ref|XP_003552037.1|  PREDICTED: AP-1 complex subunit mu-2-like          404   1e-135   Glycine max [soybeans]
ref|XP_003569636.1|  PREDICTED: AP-1 complex subunit mu-2               404   1e-135   Brachypodium distachyon [annual false brome]
ref|XP_010458434.1|  PREDICTED: AP-1 complex subunit mu-2-like          404   1e-135   Camelina sativa [gold-of-pleasure]
gb|KHN25155.1|  AP-1 complex subunit mu-1-I                             404   2e-135   Glycine soja [wild soybean]
ref|XP_009774686.1|  PREDICTED: AP-1 complex subunit mu-2-like          404   2e-135   Nicotiana sylvestris
emb|CDP13203.1|  unnamed protein product                                404   2e-135   Coffea canephora [robusta coffee]
ref|XP_010553612.1|  PREDICTED: AP-1 complex subunit mu-2               404   2e-135   Tarenaya hassleriana [spider flower]
ref|XP_007157311.1|  hypothetical protein PHAVU_002G059300g             404   3e-135   Phaseolus vulgaris [French bean]
ref|XP_007153765.1|  hypothetical protein PHAVU_003G063300g             403   3e-135   Phaseolus vulgaris [French bean]
ref|XP_003531990.1|  PREDICTED: AP-1 complex subunit mu-2-like          402   5e-135   Glycine max [soybeans]
ref|XP_012085460.1|  PREDICTED: AP-1 complex subunit mu-2               402   5e-135   Jatropha curcas
ref|XP_006646248.1|  PREDICTED: AP-1 complex subunit mu-2-like          402   7e-135   
ref|NP_001140632.1|  hypothetical protein                               402   7e-135   Zea mays [maize]
ref|XP_008239309.1|  PREDICTED: AP-1 complex subunit mu-2-like          402   8e-135   Prunus mume [ume]
ref|XP_011045271.1|  PREDICTED: AP-1 complex subunit mu-2               402   8e-135   Populus euphratica
gb|EPS71689.1|  hypothetical protein M569_03066                         402   9e-135   Genlisea aurea
ref|XP_002314604.1|  clathrin adaptor complexes medium subunit fa...    402   1e-134   Populus trichocarpa [western balsam poplar]
ref|XP_007044745.1|  Clathrin adaptor complexes medium subunit fa...    397   1e-134   
ref|XP_004969676.1|  PREDICTED: AP-1 complex subunit mu-1-like          402   1e-134   Setaria italica
ref|XP_002527911.1|  clathrin coat assembly protein ap-1, putative      397   1e-134   
ref|NP_001288528.1|  AP-1 complex subunit mu-2                          402   1e-134   Zea mays [maize]
ref|XP_009409953.1|  PREDICTED: AP-1 complex subunit mu-2               402   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ97229.1|  predicted protein                                      402   1e-134   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010491832.1|  PREDICTED: AP-1 complex subunit mu-2-like          401   2e-134   Camelina sativa [gold-of-pleasure]
ref|XP_006417426.1|  hypothetical protein EUTSA_v10007700mg             401   2e-134   Eutrema salsugineum [saltwater cress]
ref|NP_001044001.1|  Os01g0703600                                       401   2e-134   
ref|XP_006366366.1|  PREDICTED: AP-1 complex subunit mu-2-like          401   2e-134   Solanum tuberosum [potatoes]
ref|XP_007036353.1|  Clathrin adaptor complexes medium subunit fa...    401   2e-134   
emb|CDY61312.1|  BnaAnng17500D                                          401   3e-134   Brassica napus [oilseed rape]
ref|XP_012080000.1|  PREDICTED: AP-1 complex subunit mu-2-like          400   3e-134   Jatropha curcas
ref|XP_010533915.1|  PREDICTED: AP-1 complex subunit mu-2-like          400   3e-134   Tarenaya hassleriana [spider flower]
gb|EMT15970.1|  AP-1 complex subunit mu-1                               400   3e-134   
emb|CDY54239.1|  BnaC08g49960D                                          400   4e-134   Brassica napus [oilseed rape]
ref|XP_007209161.1|  hypothetical protein PRUPE_ppa006082mg             400   4e-134   Prunus persica
emb|CDX97909.1|  BnaA06g06600D                                          400   5e-134   
gb|KCW86678.1|  hypothetical protein EUGRSUZ_B03301                     407   5e-134   Eucalyptus grandis [rose gum]
emb|CDY19316.1|  BnaC05g08250D                                          400   7e-134   Brassica napus [oilseed rape]
ref|XP_010924114.1|  PREDICTED: AP-1 complex subunit mu-2-like          400   8e-134   Elaeis guineensis
ref|XP_004298991.1|  PREDICTED: AP-1 complex subunit mu-2               400   8e-134   Fragaria vesca subsp. vesca
gb|KFK43365.1|  hypothetical protein AALP_AA1G116700                    399   8e-134   Arabis alpina [alpine rockcress]
ref|XP_010547708.1|  PREDICTED: AP-1 complex subunit mu-2-like          399   9e-134   Tarenaya hassleriana [spider flower]
gb|KDO82237.1|  hypothetical protein CISIN_1g014235mg                   394   9e-134   Citrus sinensis [apfelsine]
ref|XP_003567979.1|  PREDICTED: AP-1 complex subunit mu-2-like          399   9e-134   Brachypodium distachyon [annual false brome]
gb|EAY75520.1|  hypothetical protein OsI_03424                          399   9e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_008392998.1|  PREDICTED: AP-1 complex subunit mu-2               399   1e-133   
gb|KFK40761.1|  hypothetical protein AALP_AA2G037600                    399   2e-133   Arabis alpina [alpine rockcress]
emb|CDM83667.1|  unnamed protein product                                399   2e-133   Triticum aestivum [Canadian hard winter wheat]
gb|KDO82236.1|  hypothetical protein CISIN_1g014235mg                   394   2e-133   Citrus sinensis [apfelsine]
ref|XP_007044744.1|  Clathrin adaptor complexes medium subunit fa...    398   3e-133   Theobroma cacao [chocolate]
ref|XP_011034097.1|  PREDICTED: AP-1 complex subunit mu-2-like          398   3e-133   Populus euphratica
gb|KJB50248.1|  hypothetical protein B456_008G160500                    396   3e-133   Gossypium raimondii
gb|KEH20175.1|  clathrin assembly protein AP47, putative                398   3e-133   Medicago truncatula
gb|KJB31190.1|  hypothetical protein B456_005G180000                    394   4e-133   Gossypium raimondii
ref|XP_006438265.1|  hypothetical protein CICLE_v10031619mg             395   5e-133   
ref|XP_009103973.1|  PREDICTED: AP-1 complex subunit mu-2               398   5e-133   Brassica rapa
emb|CDY63681.1|  BnaA01g35660D                                          397   5e-133   Brassica napus [oilseed rape]
ref|XP_007225645.1|  hypothetical protein PRUPE_ppa006083mg             397   7e-133   Prunus persica
ref|XP_010510910.1|  PREDICTED: AP-1 complex subunit mu-2               397   7e-133   Camelina sativa [gold-of-pleasure]
ref|XP_009148415.1|  PREDICTED: AP-1 complex subunit mu-2-like          397   7e-133   Brassica rapa
ref|XP_006300485.1|  hypothetical protein CARUB_v10020333mg             397   7e-133   Capsella rubella
ref|XP_004237270.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    397   1e-132   Solanum lycopersicum
ref|XP_008340089.1|  PREDICTED: AP-1 complex subunit mu-2-like          397   1e-132   Malus domestica [apple tree]
emb|CDY46183.1|  BnaA01g23050D                                          396   1e-132   Brassica napus [oilseed rape]
ref|NP_176277.1|  protein HAPLESS 13                                    396   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886592.1|  clathrin adaptor complexes medium subunit fa...    396   1e-132   
ref|XP_010100380.1|  AP-1 complex subunit mu-1-I                        396   2e-132   Morus notabilis
gb|KJB31189.1|  hypothetical protein B456_005G180000                    395   2e-132   Gossypium raimondii
ref|XP_008221881.1|  PREDICTED: AP-1 complex subunit mu-2               396   2e-132   Prunus mume [ume]
ref|XP_008389705.1|  PREDICTED: AP-1 complex subunit mu-2               396   2e-132   Malus domestica [apple tree]
ref|XP_006392117.1|  hypothetical protein EUTSA_v10023468mg             396   2e-132   Eutrema salsugineum [saltwater cress]
gb|AFW83685.1|  hypothetical protein ZEAMMB73_283352                    403   2e-132   
ref|XP_006438266.1|  hypothetical protein CICLE_v10031619mg             396   3e-132   Citrus clementina [clementine]
ref|XP_010102500.1|  AP-1 complex subunit mu-1                          395   3e-132   Morus notabilis
ref|XP_004298980.1|  PREDICTED: AP-1 complex subunit mu-2-like          395   3e-132   Fragaria vesca subsp. vesca
gb|KHG12319.1|  AP-1 complex subunit mu-1                               395   4e-132   Gossypium arboreum [tree cotton]
gb|KJB50247.1|  hypothetical protein B456_008G160500                    395   4e-132   Gossypium raimondii
ref|NP_001056201.1|  Os05g0543100                                       395   5e-132   
ref|XP_009359189.1|  PREDICTED: AP-1 complex subunit mu-2               394   8e-132   Pyrus x bretschneideri [bai li]
gb|EPS68502.1|  hypothetical protein M569_06266                         394   9e-132   Genlisea aurea
ref|XP_004509658.1|  PREDICTED: AP-1 complex subunit mu-1-like          394   2e-131   Cicer arietinum [garbanzo]
gb|ABR18420.1|  unknown                                                 393   2e-131   Picea sitchensis
ref|XP_009386436.1|  PREDICTED: AP-1 complex subunit mu-2-like          392   6e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006347435.1|  PREDICTED: AP-1 complex subunit mu-2-like          391   2e-130   Solanum tuberosum [potatoes]
ref|XP_009417102.1|  PREDICTED: AP-1 complex subunit mu-2-like          391   2e-130   
ref|XP_009772293.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    390   3e-130   Nicotiana sylvestris
ref|XP_009772291.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    390   4e-130   Nicotiana sylvestris
ref|XP_002968864.1|  hypothetical protein SELMODRAFT_91068              390   7e-130   
gb|EMT29153.1|  AP-1 complex subunit mu-1                               391   9e-130   
emb|CDY63680.1|  BnaA01g35650D                                          389   1e-129   Brassica napus [oilseed rape]
ref|XP_008792874.1|  PREDICTED: AP-1 complex subunit mu-2-like          398   1e-129   
ref|XP_009609076.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    387   5e-129   Nicotiana tomentosiformis
ref|XP_004241506.1|  PREDICTED: AP-1 complex subunit mu-2-like          387   5e-129   
ref|XP_009609074.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    387   5e-129   Nicotiana tomentosiformis
ref|XP_008374401.1|  PREDICTED: AP-1 complex subunit mu-2-like          387   7e-129   
gb|EMS61432.1|  AP-1 complex subunit mu-1                               386   2e-128   Triticum urartu
ref|XP_001782369.1|  predicted protein                                  384   2e-127   
ref|XP_011071917.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    379   9e-127   Sesamum indicum [beniseed]
ref|XP_001781339.1|  predicted protein                                  381   2e-126   
ref|XP_011071915.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    380   5e-126   Sesamum indicum [beniseed]
ref|XP_010678835.1|  PREDICTED: AP-1 complex subunit mu-2-like          369   8e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_172543.1|  clathrin adaptor complexes medium subunit famil...    367   5e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011624524.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    360   6e-119   Amborella trichopoda
gb|AAF17661.1|AC009398_10  F20B24.16                                    361   6e-119   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01625.1|  AP-1 complex subunit mu-1-I                             361   7e-119   Gossypium arboreum [tree cotton]
ref|XP_006354823.1|  PREDICTED: AP-1 complex subunit mu-2-like          357   2e-117   Solanum tuberosum [potatoes]
gb|EMS46923.1|  AP-1 complex subunit mu-1                               338   3e-108   Triticum urartu
ref|XP_010319601.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    333   4e-108   
ref|XP_005850786.1|  hypothetical protein CHLNCDRAFT_29685              325   2e-104   Chlorella variabilis
emb|CCA17153.1|  Clathrin assembly complex putative                     321   5e-103   Albugo laibachii Nc14
gb|ETP32967.1|  hypothetical protein F442_18448                         320   6e-103   Phytophthora parasitica P10297
ref|XP_008913378.1|  hypothetical protein PPTG_17400                    320   6e-103   Phytophthora parasitica INRA-310
ref|XP_009518106.1|  hypothetical protein PHYSODRAFT_349597             320   6e-103   Phytophthora sojae
gb|AAN71247.1|  LD27989p                                                313   1e-102   Drosophila melanogaster
ref|XP_005785717.1|  Apm1, medium subunit of the adaptin 1 complex      320   1e-102   Emiliania huxleyi CCMP1516
emb|CDI54254.1|  probable clathrin assembly protein AP47                319   2e-102   Melanopsichium pennsylvanicum 4
emb|CCI49557.1|  unnamed protein product                                318   3e-102   Albugo candida
emb|CCI49556.1|  unnamed protein product                                318   3e-102   Albugo candida
gb|EST09503.1|  putative clathrin assembly protein AP47                 319   3e-102   Kalmanozyma brasiliensis GHG001
ref|XP_003748057.1|  PREDICTED: AP-1 complex subunit mu-1-like          318   4e-102   Galendromus occidentalis
gb|KIZ03697.1|  AP-1 complex subunit mu-1                               318   5e-102   Monoraphidium neglectum
emb|CCF51403.1|  probable clathrin assembly protein AP47                318   5e-102   Ustilago hordei
ref|XP_011408446.1|  PREDICTED: AP-1 complex subunit mu-1-like          311   6e-102   Amphimedon queenslandica
gb|KHN82492.1|  AP-1 complex subunit mu-1-I                             317   8e-102   Toxocara canis
emb|CBQ73883.1|  probable clathrin assembly protein AP47                318   1e-101   Sporisorium reilianum SRZ2
gb|EFX86177.1|  hypothetical protein DAPPUDRAFT_222170                  317   1e-101   Daphnia pulex
ref|XP_008875643.1|  hypothetical protein H310_10930                    317   1e-101   Aphanomyces invadans
ref|XP_001359566.1|  GA21750                                            316   3e-101   Drosophila pseudoobscura pseudoobscura
dbj|GAC93824.1|  potential clathrin-associated protein                  320   3e-101   Pseudozyma hubeiensis SY62
ref|XP_011390066.1|  putative clathrin assembly protein AP47            316   5e-101   Ustilago maydis 521
ref|XP_009041591.1|  hypothetical protein AURANDRAFT_70425              315   6e-101   Aureococcus anophagefferens
ref|XP_001998648.1|  GI23520                                            315   7e-101   Drosophila mojavensis
ref|XP_002070012.1|  GK11256                                            315   7e-101   Drosophila willistoni
ref|NP_649906.1|  adaptor protein complex 1, mu subunit                 315   7e-101   Drosophila melanogaster
ref|WP_028824236.1|  hypothetical protein                               309   9e-101   
ref|XP_007877975.1|  hypothetical protein PFL1_02271                    315   9e-101   Anthracocystis flocculosa PF-1
gb|KDO31695.1|  AP-1 complex subunit mu-1                               315   1e-100   Saprolegnia parasitica CBS 223.65
ref|XP_001990364.1|  clathrin associated protein 47                     315   1e-100   Drosophila grimshawi
ref|XP_008614336.1|  AP-1 complex subunit mu-1                          315   1e-100   Saprolegnia diclina VS20
ref|XP_001637219.1|  predicted protein                                  315   1e-100   Nematostella vectensis
gb|AFK36986.1|  unknown                                                 305   1e-100   Lotus japonicus
gb|ETN70109.1|  adaptor complexe medium subunit family protein          314   1e-100   Necator americanus
gb|ERG87092.1|  ap-1 complex subunit mu-1-i                             314   1e-100   
gb|KKA69242.1|  hypothetical protein PRIPAC_16034                       315   2e-100   
emb|CDJ83045.1|  Clathrin adaptor domain containing protein             313   3e-100   Haemonchus contortus [red stomach worm]
gb|EKC25539.1|  AP-1 complex subunit mu-1                               313   3e-100   Crassostrea gigas
ref|XP_002158238.1|  PREDICTED: AP-1 complex subunit mu-1-like          313   4e-100   Hydra vulgaris
ref|XP_001732521.1|  hypothetical protein MGL_0296                      313   5e-100   Malassezia globosa CBS 7966
ref|XP_003385149.1|  PREDICTED: AP-1 complex subunit mu-1-like          313   5e-100   Amphimedon queenslandica
gb|EYB89248.1|  hypothetical protein Y032_0234g3148                     313   7e-100   Ancylostoma ceylanicum
ref|XP_011414129.1|  PREDICTED: AP-1 complex subunit mu-1               312   8e-100   Crassostrea gigas
ref|XP_009015103.1|  hypothetical protein HELRODRAFT_98900              312   8e-100   Helobdella robusta
ref|XP_011176465.1|  PREDICTED: AP-1 complex subunit mu-1               312   9e-100   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004518112.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    312   9e-100   
ref|XP_005181067.1|  PREDICTED: AP-1 complex subunit mu-1               312   1e-99    Musca domestica
ref|XP_001696311.1|  Mu1-Adaptin                                        312   1e-99    Chlamydomonas reinhardtii
gb|KDN38638.1|  putative clathrin assembly protein AP47                 312   2e-99    Tilletiaria anomala UBC 951
emb|CBJ29677.1|  Clathrin assembly complex, medium subunit              311   2e-99    Ectocarpus siliculosus
gb|ESA11631.1|  hypothetical protein GLOINDRAFT_96718                   309   3e-99    
gb|KIJ33567.1|  hypothetical protein M422DRAFT_183082                   307   5e-99    Sphaerobolus stellatus SS14
ref|XP_002411827.1|  clathrin coat assembly protein, putative           311   5e-99    Ixodes scapularis [blacklegged tick]
emb|CCV00015.1|  unnamed protein product                                311   5e-99    Malassezia sympodialis ATCC 42132
ref|NP_001251914.1|  Protein UNC-101, isoform c                         305   5e-99    Caenorhabditis elegans [roundworm]
ref|XP_001661031.1|  AAEL010704-PA                                      310   6e-99    
gb|ETN64452.1|  clathrin coat assembly protein ap-1                     310   6e-99    Anopheles darlingi [American malaria mosquito]
ref|XP_317947.4|  AGAP011374-PA                                         310   6e-99    Anopheles gambiae str. PEST
ref|XP_008560877.1|  PREDICTED: AP-1 complex subunit mu-1               310   6e-99    Microplitis demolitor
ref|XP_009039824.1|  hypothetical protein AURANDRAFT_72236              310   8e-99    Aureococcus anophagefferens
ref|XP_002945806.1|  hypothetical protein VOLCADRAFT_108841             310   8e-99    Volvox carteri f. nagariensis
gb|ELT98131.1|  hypothetical protein CAPTEDRAFT_178783                  310   8e-99    Capitella teleta
ref|XP_005110316.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    310   1e-98    Aplysia californica
ref|XP_002179260.1|  predicted protein                                  310   1e-98    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003428199.1|  PREDICTED: AP-1 complex subunit mu-1               309   1e-98    Nasonia vitripennis
ref|XP_011498712.1|  PREDICTED: AP-1 complex subunit mu-1               309   1e-98    Ceratosolen solmsi marchali
gb|EXX50896.1|  Apm1p                                                   310   1e-98    Rhizophagus irregularis DAOM 197198w
ref|XP_001942784.1|  PREDICTED: AP-1 complex subunit mu-1               309   2e-98    Acyrthosiphon pisum
ref|XP_002113923.1|  hypothetical protein TRIADDRAFT_50452              309   2e-98    Trichoplax adhaerens
gb|EHJ64804.1|  hypothetical protein KGM_02865                          309   2e-98    
ref|XP_011303754.1|  PREDICTED: AP-1 complex subunit mu-1               308   2e-98    Fopius arisanus
ref|XP_003398021.1|  PREDICTED: AP-1 complex subunit mu-1-like          308   2e-98    
emb|CBY41102.1|  unnamed protein product                                308   3e-98    Oikopleura dioica
ref|XP_002423855.1|  clathrin coat assembly protein ap-1, putative      309   3e-98    Pediculus humanus corporis [human body lice]
gb|EGI59321.1|  AP-1 complex subunit mu-1                               307   3e-98    Acromyrmex echinatior
ref|XP_003484471.1|  PREDICTED: AP-1 complex subunit mu-1-like          308   3e-98    
ref|XP_011863908.1|  PREDICTED: AP-1 complex subunit mu-1               308   3e-98    Vollenhovia emeryi
ref|XP_004923800.1|  PREDICTED: AP-1 complex subunit mu-1-like          308   3e-98    Bombyx mori [silk moth]
ref|XP_004365235.1|  AP-1 complex subunit mu-1                          308   4e-98    Capsaspora owczarzaki ATCC 30864
ref|XP_011169377.1|  PREDICTED: AP-1 complex subunit mu-1-like          308   4e-98    Solenopsis invicta [imported red fire ant]
dbj|BAM18015.1|  clathrin coat assembly protein ap-1                    308   4e-98    Papilio xuthus [Chinese swallowtail]
ref|XP_003484470.1|  PREDICTED: AP-1 complex subunit mu-1-like          308   4e-98    
ref|XP_011690741.1|  PREDICTED: AP-1 complex subunit mu-1               308   4e-98    Wasmannia auropunctata
ref|XP_012061450.1|  PREDICTED: AP-1 complex subunit mu-1               308   5e-98    Atta cephalotes
ref|XP_011332351.1|  PREDICTED: AP-1 complex subunit mu-1               308   5e-98    Ooceraea biroi
ref|XP_003249906.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    308   5e-98    Apis mellifera [bee]
ref|XP_011141637.1|  PREDICTED: AP-1 complex subunit mu-1               308   5e-98    Harpegnathos saltator
gb|EFO28029.2|  AP-1 complex subunit mu-1-I                             307   5e-98    Loa loa
gb|AEE62403.1|  unknown                                                 308   6e-98    Dendroctonus ponderosae
ref|XP_011064332.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    308   6e-98    Acromyrmex echinatior
ref|XP_003700057.1|  PREDICTED: AP-1 complex subunit mu-1               307   7e-98    Megachile rotundata
ref|XP_009043800.1|  hypothetical protein LOTGIDRAFT_205544             307   8e-98    Lottia gigantea
gb|ACO12360.1|  AP-1 complex subunit mu-1                               307   8e-98    Lepeophtheirus salmonis
ref|XP_011562253.1|  PREDICTED: AP-1 complex subunit mu-1               307   9e-98    Plutella xylostella [cabbage moth]
gb|EGT35242.1|  hypothetical protein CAEBREN_14107                      307   1e-97    Caenorhabditis brenneri
ref|XP_003097680.1|  CRE-UNC-101 protein                                307   1e-97    Caenorhabditis remanei
ref|XP_002640613.1|  Hypothetical protein CBG08724                      307   1e-97    Caenorhabditis briggsae
ref|NP_001006851.1|  adaptor-related protein complex 1, mu 2 subunit    307   1e-97    Xenopus tropicalis [western clawed frog]
ref|XP_003136033.1|  AP-1 complex subunit mu-1                          307   1e-97    
emb|CDP94008.1|  Protein Bm13789, isoform c                             307   1e-97    
ref|XP_968639.1|  PREDICTED: AP-1 complex subunit mu-1                  306   1e-97    Tribolium castaneum [rust-red flour beetle]
ref|XP_003889932.1|  AP-1 complex subunit mu-1                          303   2e-97    Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|EDL78305.1|  rCG31866, isoform CRA_b                                 303   2e-97    Rattus norvegicus [brown rat]
ref|XP_007433201.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    303   2e-97    
ref|XP_003690372.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    308   2e-97    
pdb|4EN2|M  Chain M, Hiv-1 Nef In Complex With Mhc-I Cytoplasmic ...    301   2e-97    Human immunodeficiency virus 1
ref|XP_007433202.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    303   2e-97    
ref|NP_001040675.1|  Protein UNC-101, isoform a                         306   3e-97    Caenorhabditis elegans [roundworm]
gb|KDD76988.1|  adaptor complexes medium subunit domain-containin...    318   4e-97    Helicosporidium sp. ATCC 50920
ref|XP_008561429.1|  PREDICTED: AP-1 complex subunit mu-2               303   5e-97    Galeopterus variegatus [Malayan flying lemur]
ref|NP_001084934.1|  uncharacterized protein LOC431991                  305   5e-97    Xenopus laevis [clawed frog]
ref|XP_789616.3|  PREDICTED: AP-1 complex subunit mu-1 isoform X2       305   5e-97    Strongylocentrotus purpuratus [purple urchin]
emb|CEF68429.1|  AP-47                                                  304   6e-97    Strongyloides ratti
ref|XP_011676192.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    305   6e-97    Strongylocentrotus purpuratus [purple urchin]
emb|CDS06625.1|  Putative AP-1 complex subunit mu-1                     305   7e-97    Lichtheimia ramosa
ref|XP_006510013.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    304   7e-97    Mus musculus [mouse]
ref|XP_002122488.1|  PREDICTED: AP-1 complex subunit mu-1               305   7e-97    Ciona intestinalis [sea vase]
gb|EWM27656.1|  ap-1 complex subunit mu-1-like isoform 1                305   8e-97    Nannochloropsis gaditana
gb|ERG81662.1|  ap-1 complex subunit mu-1-i                             304   9e-97    
emb|CDS07968.1|  Putative AP-1 complex subunit mu-1                     305   9e-97    Lichtheimia ramosa
ref|NP_001086866.1|  adaptor-related protein complex 1, mu 2 subunit    305   9e-97    Xenopus laevis [clawed frog]
emb|CEF67920.1|  AP-47                                                  306   9e-97    Strongyloides ratti
ref|XP_006680441.1|  hypothetical protein BATDEDRAFT_37174              305   9e-97    Batrachochytrium dendrobatidis JAM81
emb|CDH49035.1|  clathrin adaptor mu subunit                            305   1e-96    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007316774.1|  hypothetical protein SERLADRAFT_463796             305   1e-96    Serpula lacrymans var. lacrymans S7.9
ref|XP_008332791.1|  PREDICTED: AP-1 complex subunit mu-1               304   1e-96    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010952555.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   1e-96    Camelus bactrianus [camel]
dbj|GAK65594.1|  clathrin adaptor mu subunit                            317   1e-96    Moesziomyces antarcticus
ref|XP_003448533.1|  PREDICTED: AP-1 complex subunit mu-1               304   1e-96    Oreochromis niloticus
ref|XP_005806343.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    304   1e-96    Xiphophorus maculatus
gb|KIH53230.1|  adaptor complexe medium subunit family protein          298   1e-96    Ancylostoma duodenale
ref|XP_003975436.1|  PREDICTED: AP-1 complex subunit mu-1               304   1e-96    Takifugu rubripes [tiger puffer]
ref|XP_010976634.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   1e-96    Camelus dromedarius [camel]
ref|XP_004311234.1|  PREDICTED: AP-1 complex subunit mu-2               303   2e-96    
ref|XP_008848254.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    304   2e-96    Nannospalax galili
gb|ELW67094.1|  AP-1 complex subunit mu-1                               301   2e-96    Tupaia chinensis
ref|XP_003796571.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 4     301   2e-96    
ref|XP_009292424.1|  PREDICTED: AP-1 complex subunit mu-1               304   2e-96    
ref|XP_001520622.2|  PREDICTED: AP-1 complex subunit mu-2               298   2e-96    
ref|XP_008249777.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    303   2e-96    
ref|XP_005087143.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X4    301   2e-96    
ref|XP_007433200.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    304   2e-96    
ref|XP_003275994.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 3     301   2e-96    
ref|XP_008960092.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X4    303   2e-96    
emb|CDH59177.1|  ap-1 complex subunit mu-1                              304   2e-96    
gb|EFB12978.1|  hypothetical protein PANDA_010309                       303   2e-96    
gb|AAA72418.1|  unnamed protein product                                 303   2e-96    
ref|XP_006008165.1|  PREDICTED: AP-1 complex subunit mu-1-like          300   2e-96    
ref|XP_005806342.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    304   2e-96    
ref|XP_004748487.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   3e-96    
ref|XP_006184915.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   3e-96    
ref|XP_010952553.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    303   3e-96    
ref|XP_005346948.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    303   3e-96    
ref|XP_007107324.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   3e-96    
ref|XP_006875163.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   3e-96    
ref|XP_004277412.1|  PREDICTED: AP-1 complex subunit mu-2               303   3e-96    
ref|XP_010826657.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   3e-96    
ref|NP_001102466.1|  AP-1 complex subunit mu-2                          303   3e-96    
ref|XP_002921414.1|  PREDICTED: AP-1 complex subunit mu-2               303   3e-96    
ref|XP_011287387.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    303   3e-96    
ref|XP_003230562.2|  PREDICTED: AP-1 complex subunit mu-1               303   3e-96    
sp|Q9WVP1.3|AP1M2_MOUSE  RecName: Full=AP-1 complex subunit mu-2;...    303   3e-96    
ref|NP_033808.2|  AP-1 complex subunit mu-2 isoform 2                   303   3e-96    
ref|XP_002602503.1|  hypothetical protein BRAFLDRAFT_266579             303   3e-96    
ref|XP_005078606.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   3e-96    
ref|XP_008706308.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   3e-96    
ref|NP_001029683.1|  AP-1 complex subunit mu-2                          303   3e-96    
ref|XP_008275536.1|  PREDICTED: AP-1 complex subunit mu-1               303   4e-96    
ref|XP_007079414.1|  PREDICTED: AP-1 complex subunit mu-2               303   4e-96    
ref|XP_004398930.1|  PREDICTED: AP-1 complex subunit mu-2               303   4e-96    
ref|XP_003809630.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   4e-96    
ref|XP_006068423.1|  PREDICTED: cyclin-dependent kinase 4 inhibit...    303   4e-96    
ref|XP_006741115.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   4e-96    
ref|XP_006510012.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    302   4e-96    
ref|XP_007460738.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    303   4e-96    
gb|KIK44711.1|  hypothetical protein CY34DRAFT_802396                   303   4e-96    
ref|XP_008066225.1|  PREDICTED: AP-1 complex subunit mu-2               302   4e-96    
ref|XP_006898834.1|  PREDICTED: AP-1 complex subunit mu-2               303   4e-96    
ref|XP_004008570.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   4e-96    
ref|XP_005346946.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    303   4e-96    
gb|EJW82791.1|  AP-1 complex subunit mu-1                               300   5e-96    
ref|NP_989033.1|  adaptor-related protein complex 1, mu 1 subunit       303   5e-96    
ref|XP_005970301.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X5    303   5e-96    
ref|XP_004595558.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    303   5e-96    
ref|XP_009898920.1|  PREDICTED: AP-1 complex subunit mu-1               302   5e-96    
ref|XP_008486041.1|  PREDICTED: AP-1 complex subunit mu-1               303   5e-96    
ref|XP_006068424.1|  PREDICTED: cyclin-dependent kinase 4 inhibit...    303   5e-96    
ref|XP_002741221.1|  PREDICTED: AP-1 complex subunit mu-1               302   6e-96    
ref|XP_001491944.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    303   6e-96    
ref|XP_008529547.1|  PREDICTED: AP-1 complex subunit mu-1               301   6e-96    
ref|XP_005279112.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   6e-96    
ref|XP_006509601.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   6e-96    
ref|XP_008156043.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   6e-96    
ref|XP_006987069.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    303   6e-96    
ref|XP_005682517.1|  PREDICTED: AP-1 complex subunit mu-2               302   7e-96    
ref|XP_004689085.1|  PREDICTED: AP-1 complex subunit mu-2               302   7e-96    
ref|NP_001037704.1|  AP-1 complex subunit mu-1                          302   8e-96    
gb|KHN79706.1|  AP-1 complex subunit mu-1-I                             302   8e-96    
ref|XP_002293836.1|  mu subunit of tetrameric clathrin adaptor co...    303   8e-96    
ref|XP_007394620.1|  hypothetical protein PHACADRAFT_254106             303   8e-96    
ref|XP_008848253.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    302   9e-96    
ref|XP_011378588.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    302   9e-96    
ref|XP_004616624.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    302   1e-95    
ref|XP_004060052.1|  PREDICTED: AP-1 complex subunit mu-2               302   1e-95    
ref|XP_003798005.1|  PREDICTED: AP-1 complex subunit mu-2               302   1e-95    
ref|NP_005489.2|  AP-1 complex subunit mu-2 isoform 2                   302   1e-95    
ref|XP_007885277.1|  PREDICTED: AP-1 complex subunit mu-1-like          302   1e-95    
ref|XP_004378403.1|  PREDICTED: AP-1 complex subunit mu-2               302   1e-95    
ref|XP_003760513.1|  PREDICTED: AP-1 complex subunit mu-2               302   1e-95    
dbj|BAD96666.1|  adaptor-related protein complex 1, mu 2 subunit ...    302   1e-95    
ref|XP_009816798.1|  PREDICTED: AP-1 complex subunit mu-1               301   1e-95    
ref|XP_005612002.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    302   1e-95    
ref|XP_007072084.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    301   1e-95    
ref|XP_009945548.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   1e-95    
gb|KFV61684.1|  AP-1 complex subunit mu-1                               302   1e-95    
ref|XP_009561136.1|  PREDICTED: AP-1 complex subunit mu-1               301   1e-95    
ref|XP_010153963.1|  PREDICTED: AP-1 complex subunit mu-1               301   1e-95    
ref|XP_009164262.1|  hypothetical protein T265_01872                    295   1e-95    
ref|XP_005336193.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    302   1e-95    
ref|XP_011759472.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   1e-95    
ref|XP_008985504.1|  PREDICTED: AP-1 complex subunit mu-2               301   1e-95    
ref|XP_005405663.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    301   1e-95    
ref|NP_001007887.1|  AP-1 complex subunit mu-1                          301   1e-95    
gb|KFP68355.1|  AP-1 complex subunit mu-1                               301   1e-95    
gb|EIE87124.1|  AP-1 complex subunit mu-1                               301   1e-95    
ref|XP_004595611.1|  PREDICTED: AP-1 complex subunit mu-1               301   1e-95    
ref|XP_006122524.1|  PREDICTED: AP-1 complex subunit mu-1               301   1e-95    
gb|KFP39668.1|  AP-1 complex subunit mu-1                               301   1e-95    
ref|XP_008960091.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    301   1e-95    
ref|XP_007367606.1|  clathrin adaptor mu subunit                        302   1e-95    
ref|XP_008935054.1|  PREDICTED: AP-1 complex subunit mu-1               301   1e-95    
ref|NP_115882.1|  AP-1 complex subunit mu-1 isoform 2                   301   1e-95    
ref|XP_006875162.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   1e-95    
ref|XP_005346947.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    301   1e-95    
gb|KDQ32677.1|  hypothetical protein PLEOSDRAFT_1051618                 302   1e-95    
ref|XP_007627286.1|  PREDICTED: AP-1 complex subunit mu-1               301   1e-95    
gb|EFB19077.1|  hypothetical protein PANDA_000492                       301   1e-95    
gb|KFP52165.1|  AP-1 complex subunit mu-1                               301   1e-95    
ref|XP_003464289.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   1e-95    
ref|NP_031482.1|  AP-1 complex subunit mu-1                             301   1e-95    
ref|XP_005087140.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   1e-95    
gb|KFP91414.1|  AP-1 complex subunit mu-1                               301   1e-95    
ref|XP_009470168.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    302   1e-95    
ref|XP_009097580.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   1e-95    
ref|XP_005141602.1|  PREDICTED: AP-1 complex subunit mu-1               301   1e-95    
gb|KFR04824.1|  AP-1 complex subunit mu-1                               301   1e-95    
ref|XP_004900367.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    301   1e-95    
gb|EMP24052.1|  AP-1 complex subunit mu-1                               303   1e-95    
ref|XP_005531660.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   1e-95    
ref|XP_004715515.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   2e-95    
gb|KDE04565.1|  AP-1 complex subunit mu-1                               302   2e-95    
gb|KFQ44767.1|  AP-1 complex subunit mu-1                               301   2e-95    
ref|XP_009489602.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    301   2e-95    
ref|XP_008102017.1|  PREDICTED: AP-1 complex subunit mu-2               301   2e-95    
ref|XP_003275992.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 1     301   2e-95    
ref|XP_007899257.1|  PREDICTED: AP-1 complex subunit mu-1               301   2e-95    
ref|XP_005436488.1|  PREDICTED: AP-1 complex subunit mu-1               301   2e-95    
gb|KFV57165.1|  AP-1 complex subunit mu-1                               301   2e-95    
ref|XP_009996126.1|  PREDICTED: AP-1 complex subunit mu-1               301   2e-95    
gb|KFO84065.1|  AP-1 complex subunit mu-1                               301   2e-95    
gb|KFO77603.1|  AP-1 complex subunit mu-1                               301   2e-95    
gb|KFV14949.1|  AP-1 complex subunit mu-1                               301   2e-95    
ref|XP_005994174.1|  PREDICTED: AP-1 complex subunit mu-2               301   2e-95    
ref|XP_004442690.1|  PREDICTED: AP-1 complex subunit mu-2               301   2e-95    
ref|XP_004748486.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   2e-95    
gb|ELK28705.1|  AP-1 complex subunit mu-2                               300   2e-95    
ref|XP_004384483.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 1     301   2e-95    
ref|XP_004632905.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    301   2e-95    
ref|XP_010826656.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   2e-95    
ref|XP_005029147.1|  PREDICTED: AP-1 complex subunit mu-1               301   2e-95    
ref|XP_005856743.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   2e-95    
ref|XP_010869805.1|  PREDICTED: AP-1 complex subunit mu-1               301   2e-95    
ref|XP_005001206.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   2e-95    
ref|XP_004715514.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   2e-95    
ref|XP_004666024.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   2e-95    
ref|XP_006028960.1|  PREDICTED: AP-1 complex subunit mu-1               301   2e-95    
ref|XP_003432952.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   2e-95    
gb|KFO13668.1|  AP-1 complex subunit mu-1                               302   2e-95    
gb|KFU89722.1|  AP-1 complex subunit mu-1                               301   2e-95    
ref|XP_007169036.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   2e-95    
ref|XP_005078605.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   2e-95    
ref|NP_001103770.1|  AP-1 complex subunit mu-2 isoform 1                301   2e-95    
ref|XP_006736131.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   2e-95    
gb|EIE83851.1|  AP-1 complex subunit mu-1                               300   2e-95    
ref|XP_005495262.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   2e-95    
ref|XP_005604151.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    300   2e-95    
gb|KFD56950.1|  hypothetical protein M513_02207                         301   2e-95    
ref|XP_006184914.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   2e-95    
ref|XP_004688709.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   2e-95    
gb|KFQ82180.1|  AP-1 complex subunit mu-1                               301   2e-95    
gb|ELR52276.1|  AP-1 complex subunit mu-1                               301   2e-95    
ref|XP_007993426.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    299   2e-95    
ref|XP_004404638.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 1     301   2e-95    
ref|XP_001165482.2|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   2e-95    
ref|XP_004423057.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 1     301   2e-95    
ref|XP_006161599.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    301   2e-95    
ref|XP_004873351.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X6    301   2e-95    
gb|KIP05432.1|  hypothetical protein PHLGIDRAFT_128873                  301   2e-95    
ref|XP_008931609.1|  PREDICTED: AP-1 complex subunit mu-1               301   2e-95    
ref|NP_001123996.1|  AP-1 complex subunit mu-1 isoform 1                301   2e-95    
ref|XP_011287393.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    301   2e-95    
ref|XP_003461299.1|  PREDICTED: AP-1 complex subunit mu-2               301   2e-95    
ref|XP_008706307.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   2e-95    
ref|XP_008985713.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    301   2e-95    
ref|XP_005208805.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   2e-95    
dbj|GAA97543.1|  hypothetical protein E5Q_04221                         301   2e-95    
ref|XP_011808650.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   2e-95    
gb|KFP31645.1|  AP-1 complex subunit mu-1                               301   2e-95    
gb|EPQ03306.1|  AP-1 complex subunit mu-2                               300   2e-95    
ref|XP_011759418.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   2e-95    
ref|XP_005901524.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    301   2e-95    
ref|XP_008156278.1|  PREDICTED: AP-1 complex subunit mu-2               301   2e-95    
gb|KFQ07286.1|  AP-1 complex subunit mu-1                               301   3e-95    
ref|XP_007303298.1|  clathrin adaptor mu subunit                        301   3e-95    
ref|XP_006741114.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   3e-95    
ref|XP_004873353.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X8    301   3e-95    
ref|XP_853941.2|  PREDICTED: AP-1 complex subunit mu-2                  302   3e-95    
ref|XP_003144659.1|  clathrin-associated protein AP47                   300   3e-95    
ref|XP_003275993.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 2     301   3e-95    
ref|XP_001750591.1|  hypothetical protein                               301   3e-95    
ref|XP_007410099.1|  hypothetical protein MELLADRAFT_48387              301   3e-95    
gb|KFO28757.1|  AP-1 complex subunit mu-2                               300   3e-95    
dbj|GAN07517.1|  clathrin adaptor, mu subunit                           301   3e-95    
ref|XP_004595557.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   3e-95    
ref|XP_005962957.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    301   3e-95    
ref|XP_005962956.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    301   3e-95    
gb|KFP06348.1|  AP-1 complex subunit mu-1                               301   3e-95    
ref|XP_007769768.1|  clathrin adaptor mu subunit                        301   3e-95    
gb|EHH29767.1|  hypothetical protein EGK_10273                          301   3e-95    
ref|XP_012033279.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   3e-95    
ref|XP_006068422.1|  PREDICTED: cyclin-dependent kinase 4 inhibit...    301   3e-95    
ref|XP_005241808.1|  PREDICTED: AP-1 complex subunit mu-1               301   3e-95    
ref|XP_006105801.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    301   3e-95    
ref|NP_001089449.1|  adaptor-related protein complex 1, mu 1 subunit    300   3e-95    
gb|EHH59323.1|  hypothetical protein EGM_09405                          301   3e-95    
ref|XP_005970300.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X4    301   3e-95    
ref|XP_005859262.1|  PREDICTED: AP-1 complex subunit mu-2               300   4e-95    
ref|XP_011378586.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    301   4e-95    
ref|XP_005333099.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    300   4e-95    
ref|XP_010372061.1|  PREDICTED: AP-1 complex subunit mu-2               300   4e-95    
ref|XP_004873352.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X7    301   4e-95    
ref|XP_007430264.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    300   4e-95    
ref|XP_005612003.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    300   4e-95    
ref|XP_008704610.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    300   4e-95    
gb|EPS93225.1|  clathrin adaptor mu subunit                             301   4e-95    
ref|XP_003363865.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    300   4e-95    
ref|XP_008072171.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    300   4e-95    
ref|XP_003213355.2|  PREDICTED: AP-1 complex subunit mu-1               301   4e-95    
ref|XP_006905939.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    300   4e-95    
ref|XP_011525917.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    300   4e-95    
pdb|1W63|M  Chain M, Ap1 Clathrin Adaptor Core                          300   4e-95    
ref|XP_006765888.1|  PREDICTED: AP-1 complex subunit mu-2               300   5e-95    
ref|XP_001901415.1|  Clathrin coat assembly protein AP47                300   5e-95    
ref|XP_008043916.1|  clathrin adaptor mu subunit                        301   5e-95    
ref|XP_011378587.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    300   5e-95    
ref|XP_010889296.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    300   6e-95    
ref|NP_001287816.1|  AP-1 complex subunit mu-2 isoform 1                300   6e-95    
ref|XP_005962955.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    300   6e-95    
ref|XP_004616623.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    300   6e-95    
ref|XP_007183650.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    300   6e-95    
ref|XP_007430263.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    300   6e-95    
dbj|BAD93045.1|  adaptor-related protein complex 1, mu 1 subunit ...    301   7e-95    



>ref|XP_010682420.1| PREDICTED: AP-1 complex subunit mu-2 [Beta vulgaris subsp. vulgaris]
Length=428

 Score =   411 bits (1057),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  221  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLV  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPN+RTSMGS++YAPE
Sbjct  281  WVEAQIERHSRSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNIRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPGGKEYMLRAEF LPSITS+E TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGGKEYMLRAEFSLPSITSDEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>gb|KDO69520.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
 gb|KDO69521.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
Length=308

 Score =   405 bits (1042),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  101  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  160

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS+ YAPE
Sbjct  161  WVEAQIERHSRSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSARYAPE  220

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  221  NDALVWKIKSFPGNKEYMLRAEFSLPSITAEEAAPERKAPIRVKFEIPYFTVSGIQVRYL  280

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  281  KIIEKSGYQALPWVRYITMAGEYELRLM  308



>ref|XP_010248608.1| PREDICTED: AP-1 complex subunit mu-2-like [Nelumbo nucifera]
Length=428

 Score =   409 bits (1052),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIEFMVKARSQFKERSTA NVEIE+PVP DATNPN+RTSMGS++YAPE
Sbjct  281  WVEAQVERHSRSRIEFMVKARSQFKERSTATNVEIELPVPSDATNPNIRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DALIWKIKSFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALIWKIKSFPGGKEYMLRAEFSLPSITAEEAAPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_009604122.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana tomentosiformis]
Length=426

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+ KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  219  LLEAQGRNAKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLL  278

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DATNP+VRTSMGSSTYAPE
Sbjct  279  WVEAQVERHSRSRMEILVKARSQFKERSTATNVEIELPVPTDATNPDVRTSMGSSTYAPE  338

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKIKSFPGGKEYMLRAEFRLPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  339  KDALIWKIKSFPGGKEYMLRAEFRLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  399  KIIEKSGYQALPWVRYITMAGEYELRL  425



>ref|XP_002511345.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
 gb|EEF51947.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
Length=428

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIEFMVKARSQFKERSTA NVEIE+PVP DATNPN+R+SMGS+TYAPE
Sbjct  281  WVEAQVERHSRSRIEFMVKARSQFKERSTATNVEIELPVPSDATNPNIRSSMGSATYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEF+LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGNKEYMLRAEFKLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_010251124.1| PREDICTED: AP-1 complex subunit mu-2 [Nelumbo nucifera]
Length=428

 Score =   408 bits (1049),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS++YAPE
Sbjct  281  WVEAQVERHSRSRVELMVKARSQFKERSTATNVEIELPVPSDATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DALIWKIKSFPGGKEYMLRAEF LPSITSE+  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALIWKIKSFPGGKEYMLRAEFGLPSITSEDAAPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_006847624.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Amborella trichopoda]
 gb|ERN09205.1| hypothetical protein AMTR_s00014p00250090 [Amborella trichopoda]
Length=428

 Score =   408 bits (1048),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPLI
Sbjct  221  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS+TYAPE
Sbjct  281  WVEAQVERHSRSRIEIMVKARSQFKERSTATNVEIELPVPSDATNPNVRTSMGSATYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+AL+WKIKSFPGGKEYMLRA+F LPSIT+EE TPE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KEALLWKIKSFPGGKEYMLRAQFSLPSITAEEATPEKKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_010044585.1| PREDICTED: AP-1 complex subunit mu-2 [Eucalyptus grandis]
Length=428

 Score =   408 bits (1048),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIE MVKARSQFKERSTA NVEIE+PVP D+TNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVERHSRSRIEIMVKARSQFKERSTATNVEIELPVPADSTNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGGKEYMLRAEFSLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KHN13429.1| AP-1 complex subunit mu-2 [Glycine soja]
Length=220

 Score =   400 bits (1028),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGK+IDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  13   LLEAQGRTTKGKSIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLV  72

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HS+SRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS++YAPE
Sbjct  73   WVEAQVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSASYAPE  132

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEF LPSI  EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  133  KDALIWKIRSFPGGKEYMLRAEFHLPSIVDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  192

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  193  KIIEKSGYQALPWVRYITMAGEYELRLI  220



>gb|KHN14546.1| AP-1 complex subunit mu-1-I, partial [Glycine soja]
Length=406

 Score =   407 bits (1046),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  199  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  258

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEA VE+HS+SRIE MVKARSQFKERSTA NVEIE+PVPVDATNPNVRTSMGS++YAPE
Sbjct  259  WVEASVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPVDATNPNVRTSMGSASYAPE  318

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSIT EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  319  KDALIWKIRSFPGGKEYMLRAEFRLPSITDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  378

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  379  KVIEKSGYQALPWVRYITMAGEYELRLI  406



>ref|XP_009763320.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana sylvestris]
Length=426

 Score =   407 bits (1046),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+ KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  219  LLEAQGRNAKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLL  278

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DATNP+VRTSMGSSTYAPE
Sbjct  279  WVEAQVERHSRSRMEILVKARSQFKERSTATNVEIELPVPTDATNPDVRTSMGSSTYAPE  338

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKIKSFPGGKEYMLRAEFRLPSIT+EE TPERK PIRVKFEIPYFTVSGIQVRYL
Sbjct  339  KDALIWKIKSFPGGKEYMLRAEFRLPSITAEEATPERKTPIRVKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  399  KIIEKSGYQALPWVRYITMAGEYELRL  425



>ref|XP_010923038.1| PREDICTED: AP-1 complex subunit mu-2 [Elaeis guineensis]
Length=428

 Score =   407 bits (1046),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVERHSRSRIEIMVKARSQFKERSTATNVEIELPVPSDATNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGGKEYMLRAEFSLPSITAEEATPEKKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003517576.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   407 bits (1046),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEA VE+HS+SRIE MVKARSQFKERSTA NVEIE+PVPVDATNPNVRTSMGS++YAPE
Sbjct  281  WVEASVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPVDATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSIT EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFRLPSITDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KVIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|AFW83687.1| hypothetical protein ZEAMMB73_283352 [Zea mays]
Length=227

 Score =   399 bits (1026),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  20   LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  79

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSRIE MVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  80   WVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  139

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  140  RDAMVWKIKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPYFTVSGIQVRYL  199

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  200  KIIEKSGYQALPWVRYITMAGEYELRLI  227



>ref|XP_004135264.1| PREDICTED: AP-1 complex subunit mu-2 [Cucumis sativus]
 gb|KGN51772.1| hypothetical protein Csa_5G599290 [Cucumis sativus]
Length=428

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHS+SRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS++YAPE
Sbjct  281  WVEAQVERHSKSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL WKI+SFPGGKEYMLRAEFRLPSITSEE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALCWKIRSFPGGKEYMLRAEFRLPSITSEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_008791180.1| PREDICTED: AP-1 complex subunit mu-2 [Phoenix dactylifera]
Length=428

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLV  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVERHSRSRIEIMVKARSQFKERSTATNVEIELPVPSDATNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGGKEYMLRAEFSLPSITAEEATPEKKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_006439891.1| hypothetical protein CICLE_v10023962mg [Citrus clementina]
 ref|XP_006476855.1| PREDICTED: AP-1 complex subunit mu-2-like [Citrus sinensis]
 gb|ESR53131.1| hypothetical protein CICLE_v10023962mg [Citrus clementina]
 gb|KDO69517.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
Length=428

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQIERHSRSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSARYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGNKEYMLRAEFSLPSITAEEAAPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_002274463.1| PREDICTED: AP-1 complex subunit mu-2 [Vitis vinifera]
 emb|CBI23375.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPN+RTSMGS+ YAPE
Sbjct  281  WVEAQVERHSRSRIEIMVKARSQFKERSTATNVEIELPVPSDATNPNIRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALLWKIKSFPGGKEYMLRAEFSLPSITAEEGAPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003613166.1| AP-1 complex subunit mu [Medicago truncatula]
 gb|AES96124.1| clathrin assembly protein AP47, putative [Medicago truncatula]
 gb|AFK41114.1| unknown [Medicago truncatula]
Length=428

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEA VE+HS+SRIE MVKARSQFKERSTA NVEIE+PVPVDATNPNVRTSMGS++YAPE
Sbjct  281  WVEANVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPVDATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSIT EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFRLPSITDEEAAPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_004489791.1| PREDICTED: AP-1 complex subunit mu-1-like [Cicer arietinum]
Length=428

 Score =   407 bits (1045),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL
Sbjct  220  LLLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPL  279

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE+HS+SRIE MVKARSQFKERSTA NVEIE+PVPVDATNPNVRTSMGS++YAP
Sbjct  280  IWVEANVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPVDATNPNVRTSMGSASYAP  339

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            EKDALIWKI+SFPGGKEYMLRAEFRLPSIT EE  PERKAPIRVKFEIPYFTVSGIQVRY
Sbjct  340  EKDALIWKIRSFPGGKEYMLRAEFRLPSITDEEAAPERKAPIRVKFEIPYFTVSGIQVRY  399

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  400  LKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_011086615.1| PREDICTED: AP-1 complex subunit mu-2 [Sesamum indicum]
Length=428

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNP+VR+SMGS++YAPE
Sbjct  281  WVEAQVERHSRSRIEIMVKARSQFKERSTATNVEIEMPVPPDATNPSVRSSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEFRLPSITSEE TP+RKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALVWKIKSFPGGKEYMLRAEFRLPSITSEEATPDRKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRL  427



>ref|XP_008446174.1| PREDICTED: AP-1 complex subunit mu-2 [Cucumis melo]
Length=428

 Score =   406 bits (1043),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHS+SRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS++YAPE
Sbjct  281  WVEAQVERHSKSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL WKI+SFPGGKEYMLRAEFRLPSITSEE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  HDALCWKIRSFPGGKEYMLRAEFRLPSITSEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003519692.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
 gb|KHN00382.1| AP-1 complex subunit mu-1-I [Glycine soja]
Length=428

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEA VE+HS+SRIE MVKARSQFKERSTA NVEIE+PVPVDATNPNVRTSMGS++YAPE
Sbjct  281  WVEANVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPVDATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFHLPSITDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|EYU22519.1| hypothetical protein MIMGU_mgv1a006868mg [Erythranthe guttata]
Length=428

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGK+IDLDDIKFHQCVRLARFENDRTISF+PPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKSIDLDDIKFHQCVRLARFENDRTISFVPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHS+SRIE  VKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVERHSKSRIEITVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             D+L+WKIKSFPGGKEYMLRAEFRLPSITSEE+TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDSLVWKIKSFPGGKEYMLRAEFRLPSITSEESTPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|EYU28424.1| hypothetical protein MIMGU_mgv1a006870mg [Erythranthe guttata]
Length=428

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIEF VKARSQFKERSTA NVEIE+PVP D+TNPNVRTSMGS++YAPE
Sbjct  281  WVEAQVERHSRSRIEFTVKARSQFKERSTATNVEIELPVPPDSTNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEFRLPSI SEE+ PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGGKEYMLRAEFRLPSIESEESGPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_011071132.1| PREDICTED: AP-1 complex subunit mu-2 [Sesamum indicum]
Length=428

 Score =   405 bits (1042),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+EAQVERHSRSRIE M+KARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WIEAQVERHSRSRIEIMLKARSQFKERSTATNVEIELPVPPDATNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKIKSFPGGKEYMLRAEFRLPSI S+E+  ERKAP+RVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIKSFPGGKEYMLRAEFRLPSIQSDESAAERKAPVRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_010475954.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   405 bits (1041),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NPNVRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPNVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE+TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEESTPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_009623841.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana tomentosiformis]
Length=426

 Score =   405 bits (1040),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL TQVKPL
Sbjct  218  MLLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLGTQVKPL  277

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PV  DATNPNVRTSMGSSTYAP
Sbjct  278  IWVEAQVERHSRSRMEIVVKARSQFKERSTATNVEIELPVATDATNPNVRTSMGSSTYAP  337

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            EKDALIWKIKSFPGGKEYMLRAEF LPSIT+EE+ PERKAPIRVKFEIPYFTVSGIQVRY
Sbjct  338  EKDALIWKIKSFPGGKEYMLRAEFTLPSITAEESAPERKAPIRVKFEIPYFTVSGIQVRY  397

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  398  LKIIEKSGYQALPWVRYITMAGEYELRLI  426



>ref|XP_004239119.1| PREDICTED: AP-1 complex subunit mu-2 [Solanum lycopersicum]
 ref|XP_006357615.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=426

 Score =   405 bits (1040),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL TQVKPLI
Sbjct  219  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLGTQVKPLI  278

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PV  DATNPNVRTSMGSSTYAPE
Sbjct  279  WVEAQVERHSRSRMEIVVKARSQFKERSTATNVEIELPVATDATNPNVRTSMGSSTYAPE  338

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKIKSFPGGKEYMLRAEF LPSIT+EE+ PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  339  KDALIWKIKSFPGGKEYMLRAEFTLPSITAEESVPERKAPIRVKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  399  KIIEKSGYQALPWVRYITMAGEYELRLV  426



>ref|XP_006307589.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 ref|XP_006307590.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 gb|EOA40487.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 gb|EOA40488.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
Length=428

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NPNVRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPNVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_002889832.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66091.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=428

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NPNVRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPNVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_003552037.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGK+IDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  221  LLEAQGRTTKGKSIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLV  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HS+SRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS++YAPE
Sbjct  281  WVEAQVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSI  EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFRLPSIVDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003569636.1| PREDICTED: AP-1 complex subunit mu-2 [Brachypodium distachyon]
Length=429

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIEFMVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+TYAPE
Sbjct  282  WVEAQVEKHSRSRIEFMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSATYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPGGKEYM RAEF LPSI +EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  RDAMVWKIKSFPGGKEYMCRAEFSLPSIAAEEGGPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KIIEKSGYQALPWVRYITMAGEYELRLL  429



>ref|XP_010458434.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   404 bits (1038),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVE+E+PVP DA+NPNVRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEMELPVPTDASNPNVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE+TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEESTPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>gb|KHN25155.1| AP-1 complex subunit mu-1-I [Glycine soja]
Length=428

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGK+IDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  221  LLEAQGRTTKGKSIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLV  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HS+SRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS++YAPE
Sbjct  281  WVEAQVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSI  EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFRLPSIVDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009774686.1| PREDICTED: AP-1 complex subunit mu-2-like [Nicotiana sylvestris]
Length=426

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL TQVKPL
Sbjct  218  MLLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLGTQVKPL  277

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PV  DATNPNVRTSMGSSTYAP
Sbjct  278  IWVEAQVERHSRSRMEIVVKARSQFKERSTATNVEIELPVATDATNPNVRTSMGSSTYAP  337

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            EKDALIWKIKSFPGGKEYMLRAEF LPSIT+EE+ PERKAPIRVKFEIPYFTVSG+QVRY
Sbjct  338  EKDALIWKIKSFPGGKEYMLRAEFTLPSITAEESAPERKAPIRVKFEIPYFTVSGMQVRY  397

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  398  LKIIEKSGYQALPWVRYITMAGEYELRLI  426



>emb|CDP13203.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE+PVP DATNPN+RTSMGSSTYAPE
Sbjct  281  WVEAQVERHSRSRMEMTVKARSQFKERSTATNVEIELPVPSDATNPNIRTSMGSSTYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGGKEYMLRAEFTLPSITAEEPLPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_010553612.1| PREDICTED: AP-1 complex subunit mu-2 [Tarenaya hassleriana]
Length=428

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NPNVRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPQDASNPNVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_007157311.1| hypothetical protein PHAVU_002G059300g [Phaseolus vulgaris]
 gb|ESW29305.1| hypothetical protein PHAVU_002G059300g [Phaseolus vulgaris]
Length=428

 Score =   404 bits (1037),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEA VE+HS+SR+E MVKARSQFKERSTA NVEIE+PVPVDATNPNVRTSMGS++YAPE
Sbjct  281  WVEASVEKHSKSRMEIMVKARSQFKERSTATNVEIELPVPVDATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSIT E+ TPERKAPI VKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFRLPSITDEDATPERKAPINVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_007153765.1| hypothetical protein PHAVU_003G063300g [Phaseolus vulgaris]
 gb|ESW25759.1| hypothetical protein PHAVU_003G063300g [Phaseolus vulgaris]
Length=428

 Score =   403 bits (1036),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE HS+SRIE MVK RSQFKERSTA NVEIE+PVP DATNPNVRTSMGS++YAPE
Sbjct  281  WVEAQVENHSKSRIEIMVKTRSQFKERSTATNVEIELPVPADATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSI  EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFRLPSIIDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003531990.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGK+IDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  221  LLEAQGRTTKGKSIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLV  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HS+SRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRTSMGS++YAPE
Sbjct  281  WVEAQVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEF LPSI  EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFHLPSIVDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_012085460.1| PREDICTED: AP-1 complex subunit mu-2 [Jatropha curcas]
 gb|KDP26640.1| hypothetical protein JCGZ_17798 [Jatropha curcas]
Length=428

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E MVKARSQFKERSTA NVEIE+PVP DA+NPNVRTSMGS++YAPE
Sbjct  281  WVEAQVERHSRSRVEIMVKARSQFKERSTATNVEIEIPVPTDASNPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALMWKIKSFPGGKEYMLRAEFNLPSITAEEGVPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_006646248.1| PREDICTED: AP-1 complex subunit mu-2-like [Oryza brachyantha]
Length=435

 Score =   402 bits (1034),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL+
Sbjct  228  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLV  287

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSRIE MVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  288  WVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  347

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WK+KSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  348  RDAMVWKVKSFPGGKEYMCRAEFSLPSITAEEAAPEKKAPIRVKFEIPYFTVSGIQVRYL  407

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  408  KIIEKSGYQALPWVRYITMAGEYELRLI  435



>ref|NP_001140632.1| hypothetical protein [Zea mays]
 gb|ACF84213.1| unknown [Zea mays]
 gb|ACN28896.1| unknown [Zea mays]
 gb|ACR35886.1| unknown [Zea mays]
 gb|AFW83686.1| hypothetical protein ZEAMMB73_283352 [Zea mays]
Length=429

 Score =   402 bits (1034),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSRIE MVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  282  WVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  RDAMVWKIKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_008239309.1| PREDICTED: AP-1 complex subunit mu-2-like [Prunus mume]
Length=428

 Score =   402 bits (1033),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE  VKARSQ+KERSTA NVEI +PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVEKHSRSRIEITVKARSQYKERSTATNVEIHLPVPADATNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEFRLPSITSEE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALVWKIKSFPGNKEYMLRAEFRLPSITSEEAVPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_011045271.1| PREDICTED: AP-1 complex subunit mu-2 [Populus euphratica]
 ref|XP_011045272.1| PREDICTED: AP-1 complex subunit mu-2 [Populus euphratica]
Length=428

 Score =   402 bits (1033),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E MVKARSQFKERSTA NVEIE+PV VD +NPN+RTSMGS++YAPE
Sbjct  281  WVEAQVERHSRSRVEIMVKARSQFKERSTATNVEIELPVAVDVSNPNIRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALLWKIKSFPGGKEYMLRAEFSLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|EPS71689.1| hypothetical protein M569_03066, partial [Genlisea aurea]
Length=430

 Score =   402 bits (1033),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  223  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGTFDLMTYRLSTQVKPLI  282

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE MVKARSQFKERSTA NVEIE+PVP D+TNPNVRTSMGS++YAPE
Sbjct  283  WVEAQVEKHSRSRIEVMVKARSQFKERSTATNVEIELPVPPDSTNPNVRTSMGSASYAPE  342

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEFRLPSI SEE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  343  SDALVWKIKSFPGGKEYMLRAEFRLPSIASEEAGPEKKAPIRVKFEIPYFTVSGIQVRYL  402

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  403  KIIEKSGYQALPWVRYITMAGEYELRLI  430



>ref|XP_002314604.1| clathrin adaptor complexes medium subunit family protein [Populus 
trichocarpa]
 gb|EEF00775.1| clathrin adaptor complexes medium subunit family protein [Populus 
trichocarpa]
Length=428

 Score =   402 bits (1033),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E MVKARSQFKERSTA NVEIE+PV VD +NPN+RTSMGS++YAPE
Sbjct  281  WVEAQVERHSRSRVEIMVKARSQFKERSTATNVEIELPVSVDVSNPNIRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALLWKIKSFPGGKEYMLRAEFSLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_007044745.1| Clathrin adaptor complexes medium subunit family protein isoform 
2 [Theobroma cacao]
 gb|EOY00577.1| Clathrin adaptor complexes medium subunit family protein isoform 
2 [Theobroma cacao]
Length=308

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  101  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  160

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKARSQFKERSTA NVEI VPVP DA++PNVRTSMGS+ YAPE
Sbjct  161  WVEAQVEKHSRSRVEIMVKARSQFKERSTATNVEIAVPVPADASSPNVRTSMGSAAYAPE  220

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  221  SDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  280

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  281  KIIEKSGYQALPWVRYITMAGEYELRLI  308



>ref|XP_004969676.1| PREDICTED: AP-1 complex subunit mu-1-like [Setaria italica]
Length=429

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSRIE MVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  282  WVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WK+KSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  RDAMVWKVKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_002527911.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
 gb|EEF34468.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
Length=309

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  102  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  161

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE+PVP DA+NPNVRTSMGS++YAPE
Sbjct  162  WVEAQVERHSRSRVEITVKARSQFKERSTATNVEIELPVPTDASNPNVRTSMGSASYAPE  221

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYM+RAEF LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  222  NDALMWKIKSFPGGKEYMMRAEFSLPSITAEEGAPERKAPIRVKFEIPYFTVSGIQVRYL  281

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  282  KIIEKSGYQALPWVRYITMAGEYELRLI  309



>ref|NP_001288528.1| AP-1 complex subunit mu-2 [Zea mays]
 ref|XP_002456218.1| hypothetical protein SORBIDRAFT_03g032290 [Sorghum bicolor]
 gb|ACN34099.1| unknown [Zea mays]
 gb|EES01338.1| hypothetical protein SORBIDRAFT_03g032290 [Sorghum bicolor]
 tpg|DAA57960.1| TPA: hypothetical protein ZEAMMB73_448798 [Zea mays]
Length=429

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSRIE MVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  282  WVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WK+KSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  RDAMVWKVKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_009409953.1| PREDICTED: AP-1 complex subunit mu-2 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKP I
Sbjct  221  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPPI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPN+RTSMGS+TYAPE
Sbjct  281  WVEAQIERHSRSRIEIMVKARSQFKERSTATNVEIEIPVPSDATNPNIRTSMGSATYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYM RAEF  PSIT+EE TPE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGGKEYMCRAEFSFPSITAEEATPEKKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>dbj|BAJ97229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRL RFENDRTISF+PPDG+FDLMTYRLTTQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLTRFENDRTISFVPPDGAFDLMTYRLTTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE MVKARSQFKERST  NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  282  WVEAQVEKHSRSRIEIMVKARSQFKERSTGTNVEIEVPVPYDATNPNIRTSMGSAAYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPGGKEYM RAEF LPSITSEE TPE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  RDAMVWKIKSFPGGKEYMCRAEFSLPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KVIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_010491832.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRPTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NPNVRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPNVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE+TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEESTPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGY ALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYHALPWVRYITMAGEYELRLM  428



>ref|XP_006417426.1| hypothetical protein EUTSA_v10007700mg [Eutrema salsugineum]
 gb|ESQ35779.1| hypothetical protein EUTSA_v10007700mg [Eutrema salsugineum]
Length=428

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS++YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|NP_001044001.1| Os01g0703600 [Oryza sativa Japonica Group]
 dbj|BAF05915.1| Os01g0703600 [Oryza sativa Japonica Group]
 gb|EAZ13244.1| hypothetical protein OsJ_03168 [Oryza sativa Japonica Group]
Length=429

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSRIE MVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  282  WVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WK+KSFPGGK+YM RAEF LPSIT+EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  RDAMVWKVKSFPGGKDYMCRAEFSLPSITAEEAAPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_006366366.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=426

 Score =   401 bits (1030),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+ KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+F++MTYRL+TQVKPL+
Sbjct  219  LLEAQGRNAKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFEVMTYRLSTQVKPLV  278

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHS+SR+E +VKARSQFKERSTA NVEIE+PVP DATNP+VRTSMGSSTYAPE
Sbjct  279  WVEAQVERHSKSRVEILVKARSQFKERSTATNVEIELPVPTDATNPDVRTSMGSSTYAPE  338

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKIKSFPGGKEYMLRAEF+LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  339  KDALIWKIKSFPGGKEYMLRAEFKLPSITAEEAVPERKAPIRVKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  399  KIIEKSGYQALPWVRYITMAGEYELRL  425



>ref|XP_007036353.1| Clathrin adaptor complexes medium subunit family protein [Theobroma 
cacao]
 gb|EOY20854.1| Clathrin adaptor complexes medium subunit family protein [Theobroma 
cacao]
Length=429

 Score =   401 bits (1030),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE MVKARSQFKERSTA NVEIE+PVP DATN N RTSMGS+ YAPE
Sbjct  282  WVEAQVEKHSRSRIEIMVKARSQFKERSTATNVEIELPVPADATNLNTRTSMGSARYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEFRLPSIT+EE  PERKAP+RVKFEIPYFTVSGIQVRYL
Sbjct  342  NDALVWKIKSFPGNKEYMLRAEFRLPSITAEEAAPERKAPVRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  402  KIIEKSGYQALPWVRYITMAGEYELRLM  429



>emb|CDY61312.1| BnaAnng17500D [Brassica napus]
Length=428

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_012080000.1| PREDICTED: AP-1 complex subunit mu-2-like [Jatropha curcas]
 gb|KDP31052.1| hypothetical protein JCGZ_11428 [Jatropha curcas]
Length=428

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE MVKARSQFKERSTA NVEIE+PVP D+TNPN+RTSMGS+TYAPE
Sbjct  281  WVEAQVEKHSRSRIEIMVKARSQFKERSTATNVEIELPVPSDSTNPNIRTSMGSATYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEF  PSIT+EE TP+R+API VKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGNKEYMLRAEFSFPSITAEEATPQRRAPISVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_010533915.1| PREDICTED: AP-1 complex subunit mu-2-like [Tarenaya hassleriana]
Length=428

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NPNVRTS+GS++YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPQDASNPNVRTSLGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALAWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLL  428



>gb|EMT15970.1| AP-1 complex subunit mu-1 [Aegilops tauschii]
Length=406

 Score =   400 bits (1027),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPLI
Sbjct  199  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLI  258

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE M+KARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  259  WVEAQVEKHSRSRIELMIKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  318

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WK+KSFPGGKEYM RAEF LPSI++EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  319  RDAMVWKVKSFPGGKEYMCRAEFSLPSISAEEAVPEKKAPIRVKFEIPYFTVSGIQVRYL  378

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  379  KIIEKSGYQALPWVRYITMAGEYELRLI  406



>emb|CDY54239.1| BnaC08g49960D [Brassica napus]
Length=428

 Score =   400 bits (1029),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPS+T+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSVTAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_007209161.1| hypothetical protein PRUPE_ppa006082mg [Prunus persica]
 gb|EMJ10360.1| hypothetical protein PRUPE_ppa006082mg [Prunus persica]
Length=428

 Score =   400 bits (1028),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE  VKARSQ+KERSTA NVEI +PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVEKHSRSRIEITVKARSQYKERSTATNVEIHLPVPADATNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEFRLPSITSEE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALVWKIKSFPGNKEYMLRAEFRLPSITSEEAVPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGY ALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYHALPWVRYITMAGEYELRLM  428



>emb|CDX97909.1| BnaA06g06600D [Brassica napus]
Length=428

 Score =   400 bits (1028),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KVIEKSGYQALPWVRYITMAGEYELRLM  428



>gb|KCW86678.1| hypothetical protein EUGRSUZ_B03301 [Eucalyptus grandis]
Length=628

 Score =   407 bits (1046),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  421  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  480

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSRIE MVKARSQFKERSTA NVEIE+PVP D+TNPNVRTSMGS+ YAPE
Sbjct  481  WVEAQVERHSRSRIEIMVKARSQFKERSTATNVEIELPVPADSTNPNVRTSMGSAAYAPE  540

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  541  NDALVWKIKSFPGGKEYMLRAEFSLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  600

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  601  KIIEKSGYQALPWVRYITMAGEYELRLI  628



>emb|CDY19316.1| BnaC05g08250D [Brassica napus]
Length=428

 Score =   400 bits (1027),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPS+T+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSVTAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KVIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_010924114.1| PREDICTED: AP-1 complex subunit mu-2-like [Elaeis guineensis]
Length=428

 Score =   400 bits (1027),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISF+PPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFVPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WV+AQ+ERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DA NPNVRTS+GS+ YAPE
Sbjct  281  WVDAQIERHSRSRIEIMVKARSQFKERSTATNVEIELPVPSDAINPNVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGSKEYMLRAEFSLPSITAEEATPEKKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_004298991.1| PREDICTED: AP-1 complex subunit mu-2 [Fragaria vesca subsp. vesca]
Length=428

 Score =   400 bits (1027),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISF+PPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFVPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHS+SRIE +VKARSQFKERSTA NVEIEVPV  DATNPN+RTS+GS+TYAPE
Sbjct  281  WVEAQIERHSKSRIEILVKARSQFKERSTATNVEIEVPVQTDATNPNIRTSLGSATYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DALIWKI+SFPGGKEY+LRAEF LPS+T+EE+TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALIWKIRSFPGGKEYLLRAEFHLPSVTAEESTPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KFK43365.1| hypothetical protein AALP_AA1G116700 [Arabis alpina]
Length=428

 Score =   399 bits (1026),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIEKHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_010547708.1| PREDICTED: AP-1 complex subunit mu-2-like [Tarenaya hassleriana]
Length=428

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA +VEIE+PVP DA+NPNVRTS+GS+ Y PE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATSVEIELPVPQDASNPNVRTSLGSAAYVPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>gb|KDO82237.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=284

 Score =   394 bits (1012),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPL
Sbjct  76   ILLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPL  135

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PV  DA+NP+VRTSMGS++Y P
Sbjct  136  IWVEAQVERHSRSRVEILVKARSQFKERSTATNVEIELPVSSDASNPDVRTSMGSASYVP  195

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            E +ALIWKI+SFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRY
Sbjct  196  EDEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRY  255

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGY ALPWVRYITMAGEYELRL+
Sbjct  256  LKIIEKSGYHALPWVRYITMAGEYELRLI  284



>ref|XP_003567979.1| PREDICTED: AP-1 complex subunit mu-2-like [Brachypodium distachyon]
Length=429

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRL RFENDRTISF+PPDG+FDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRTTKGKAIDLDDIKFHQCVRLTRFENDRTISFVPPDGAFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E  VKARSQFKERSTA NVEIEVPVP D+TNPN+RTSMGS+ YAPE
Sbjct  282  WVEAQVEKHSRSRVEITVKARSQFKERSTATNVEIEVPVPCDSTNPNIRTSMGSAAYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DAL+WKIKSFPGGKEYM RAEF LPSITSEE TPE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  RDALVWKIKSFPGGKEYMCRAEFSLPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KVIEKSGYQALPWVRYITMAGEYELRLI  429



>gb|EAY75520.1| hypothetical protein OsI_03424 [Oryza sativa Indica Group]
Length=429

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSRIE MVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  282  WVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A++WK+KSFPGGK+YM RAEF LPSIT+EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  REAMVWKVKSFPGGKDYMCRAEFSLPSITAEEAAPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_008392998.1| PREDICTED: AP-1 complex subunit mu-2 [Malus domestica]
Length=428

 Score =   399 bits (1026),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGK+IDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKSIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE HSRSRIEF VKARSQ+KERSTA NVEIE+PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVENHSRSRIEFTVKARSQYKERSTATNVEIELPVPADATNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DAL+WK+KSFPG KEYMLRAEF LPSIT+EE  PER+APIRVKFEIPYFTVSGIQVRYL
Sbjct  341  RDALVWKVKSFPGNKEYMLRAEFMLPSITAEEAVPERRAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLM  428



>gb|KFK40761.1| hypothetical protein AALP_AA2G037600 [Arabis alpina]
Length=428

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>emb|CDM83667.1| unnamed protein product [Triticum aestivum]
Length=429

 Score =   399 bits (1024),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPLI
Sbjct  222  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE  +KARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  282  WVEAQVEKHSRSRIELTIKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WK+KSFPGGKEYM RAEF LPSI++EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  RDAMVWKVKSFPGGKEYMCRAEFSLPSISAEEAVPEKKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  402  KIIEKSGYQALPWVRYITMAGEYELRLI  429



>gb|KDO82236.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=309

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPL
Sbjct  101  ILLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPL  160

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PV  DA+NP+VRTSMGS++Y P
Sbjct  161  IWVEAQVERHSRSRVEILVKARSQFKERSTATNVEIELPVSSDASNPDVRTSMGSASYVP  220

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            E +ALIWKI+SFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRY
Sbjct  221  EDEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRY  280

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGY ALPWVRYITMAGEYELRL+
Sbjct  281  LKIIEKSGYHALPWVRYITMAGEYELRLI  309



>ref|XP_007044744.1| Clathrin adaptor complexes medium subunit family protein isoform 
1 [Theobroma cacao]
 gb|EOY00576.1| Clathrin adaptor complexes medium subunit family protein isoform 
1 [Theobroma cacao]
Length=428

 Score =   398 bits (1023),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKARSQFKERSTA NVEI VPVP DA++PNVRTSMGS+ YAPE
Sbjct  281  WVEAQVEKHSRSRVEIMVKARSQFKERSTATNVEIAVPVPADASSPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_011034097.1| PREDICTED: AP-1 complex subunit mu-2-like [Populus euphratica]
Length=428

 Score =   398 bits (1023),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKA+SQFKERSTA NVEIE+PVPVDA+NPN+RTSMGS++YAPE
Sbjct  281  WVEAQVEKHSRSRVEIMVKAKSQFKERSTATNVEIELPVPVDASNPNIRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSF GGKEYMLRAEF L SIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALMWKIKSFSGGKEYMLRAEFSLSSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KJB50248.1| hypothetical protein B456_008G160500 [Gossypium raimondii]
Length=368

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  161  LLEAQGRVTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  220

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKARSQ+KERSTA NVEI VPVP DA++PN+RTSMGS+ YAPE
Sbjct  221  WVEAQVEKHSRSRVEIMVKARSQYKERSTATNVEIAVPVPTDASSPNIRTSMGSAAYAPE  280

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  281  NDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  340

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  341  KIIEKSGYQALPWVRYITMAGEYELRLI  368



>gb|KEH20175.1| clathrin assembly protein AP47, putative [Medicago truncatula]
Length=428

 Score =   398 bits (1022),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL 
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLF  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HS+SRIE  VKARSQFKERSTA NVEIE+PVP DAT PNVRTSMGS+ YAPE
Sbjct  281  WVEAQVEKHSKSRIEITVKARSQFKERSTATNVEIELPVPADATTPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSIT EE  PERKAPIR+KFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFRLPSITDEEAAPERKAPIRLKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KJB31190.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=339

 Score =   394 bits (1013),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  132  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  191

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKARSQFKERSTA NVEI VPVP DA++PNVRTSMGS+ YAPE
Sbjct  192  WVEAQVEKHSRSRVEIMVKARSQFKERSTATNVEIMVPVPADASSPNVRTSMGSAAYAPE  251

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT EE T ERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  252  NDALLWKIRSFPGGKEYMLRAEFTLPSITDEEATQERKAPIRVKFEIPYFTVSGIQVRYL  311

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  312  KIIEKSGYQALPWVRYITMAGEYELRLI  339



>ref|XP_006438265.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|ESR51505.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|KDO82235.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=358

 Score =   395 bits (1015),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPLI
Sbjct  151  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLI  210

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PV  DA+NP+VRTSMGS++Y PE
Sbjct  211  WVEAQVERHSRSRVEILVKARSQFKERSTATNVEIELPVSSDASNPDVRTSMGSASYVPE  270

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             +ALIWKI+SFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  271  DEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  330

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGY ALPWVRYITMAGEYELRL+
Sbjct  331  KIIEKSGYHALPWVRYITMAGEYELRLI  358



>ref|XP_009103973.1| PREDICTED: AP-1 complex subunit mu-2 [Brassica rapa]
Length=428

 Score =   398 bits (1022),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHS+SR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSKSRVEMLVKARSQFKERSTATNVEIELPVPADASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>emb|CDY63681.1| BnaA01g35660D [Brassica napus]
Length=428

 Score =   397 bits (1021),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHS+SR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSKSRVEMLVKARSQFKERSTATNVEIELPVPADASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_007225645.1| hypothetical protein PRUPE_ppa006083mg [Prunus persica]
 gb|EMJ26844.1| hypothetical protein PRUPE_ppa006083mg [Prunus persica]
Length=428

 Score =   397 bits (1020),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISF+PPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFVPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHS+SRIE +VKARSQFKERSTA NVEIEVPV  DATNP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSKSRIEILVKARSQFKERSTATNVEIEVPVLSDATNPEVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DALIWKI+SFPGGKEYMLRAEFRLPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALIWKIRSFPGGKEYMLRAEFRLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_010510910.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
 ref|XP_010418020.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
 ref|XP_010473257.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
Length=428

 Score =   397 bits (1020),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E HSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS++YAPE
Sbjct  281  WVEAQIESHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_009148415.1| PREDICTED: AP-1 complex subunit mu-2-like [Brassica rapa]
Length=428

 Score =   397 bits (1020),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF L SIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLTSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYITMAGEYELRLM
Sbjct  401  KVIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_006300485.1| hypothetical protein CARUB_v10020333mg [Capsella rubella]
 gb|EOA33383.1| hypothetical protein CARUB_v10020333mg [Capsella rubella]
Length=428

 Score =   397 bits (1020),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E HSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS++YAPE
Sbjct  281  WVEAQIESHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_004237270.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Solanum lycopersicum]
Length=426

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+ KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+F++MTYRL+TQVKPL+
Sbjct  219  LLEAQGRNAKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFEVMTYRLSTQVKPLV  278

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHS+SR+E +VKARSQFKERSTA NV+IE+PVP DATNP+VRTSMGSSTYAPE
Sbjct  279  WVEAQVERHSKSRVEILVKARSQFKERSTATNVQIELPVPTDATNPDVRTSMGSSTYAPE  338

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKIKSFPGGKEYMLRAEF LPSI++EE  PERK+PIRVKFEIPYFTVSGIQVRYL
Sbjct  339  KDALIWKIKSFPGGKEYMLRAEFSLPSISAEEAVPERKSPIRVKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  399  KIIEKSGYQALPWVRYITMAGEYELRL  425



>ref|XP_008340089.1| PREDICTED: AP-1 complex subunit mu-2-like [Malus domestica]
Length=428

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISF+PPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFVPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE Q+ERHS+SRIE +VKARSQFKERSTA NVEIEVPV  DATNP+VRTS+GS+ YAPE
Sbjct  281  WVECQIERHSKSRIEILVKARSQFKERSTATNVEIEVPVVSDATNPDVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DALIWKI+SFPGGKEYMLRAEFRLPS+T+EE+TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALIWKIRSFPGGKEYMLRAEFRLPSVTAEESTPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>emb|CDY46183.1| BnaA01g23050D [Brassica napus]
Length=428

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHS+SR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSKSRVEMLVKARSQFKERSTATNVEIELPVPADASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG K+YMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKDYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|NP_176277.1| protein HAPLESS 13 [Arabidopsis thaliana]
 sp|O22715.1|AP1M2_ARATH RecName: Full=AP-1 complex subunit mu-2; AltName: Full=Adaptor 
protein complex AP-1 subunit mu-2; AltName: Full=Adaptor protein-1 
mu-adaptin 2; AltName: Full=Adaptor-related protein 
complex 1 subunit mu-2; AltName: Full=At-muB2-Ad; AltName: 
Full=Clathrin assembly protein complex 1 mu-2 medium chain; 
AltName: Full=Mu1-adaptin 2; AltName: Full=Protein HAPLESS 13 
[Arabidopsis thaliana]
 gb|AAB71967.1| putative Clathrin Coat Assembly protein [Arabidopsis thaliana]
 gb|AAM20503.1| clathrin adaptor medium chain protein MU1B, putative [Arabidopsis 
thaliana]
 gb|AAN72155.1| clathrin adaptor medium chain protein MU1B, putative [Arabidopsis 
thaliana]
 gb|AEE33731.1| protein HAPLESS 13 [Arabidopsis thaliana]
Length=428

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E HSRSR+E ++KARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS++YAPE
Sbjct  281  WVEAQIESHSRSRVEMLIKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_002886592.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62851.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=428

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E HSRSR+E ++KARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS++YAPE
Sbjct  281  WVEAQIESHSRSRVEMLIKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_010100380.1| AP-1 complex subunit mu-1-I [Morus notabilis]
 gb|EXB82514.1| AP-1 complex subunit mu-1-I [Morus notabilis]
Length=428

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPL+
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLV  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHS+SR+E +VKARSQFKERSTA NVEIEVPVP DATNP+VRTSMGS+ YAPE
Sbjct  281  WVEAQVERHSKSRVEILVKARSQFKERSTATNVEIEVPVPYDATNPDVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIRSFPGGKEYMLRAEFCLPSITAEEGAPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KJB31189.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=407

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  200  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  259

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKARSQFKERSTA NVEI VPVP DA++PNVRTSMGS+ YAPE
Sbjct  260  WVEAQVEKHSRSRVEIMVKARSQFKERSTATNVEIMVPVPADASSPNVRTSMGSAAYAPE  319

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT EE T ERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  320  NDALLWKIRSFPGGKEYMLRAEFTLPSITDEEATQERKAPIRVKFEIPYFTVSGIQVRYL  379

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  380  KIIEKSGYQALPWVRYITMAGEYELRLI  407



>ref|XP_008221881.1| PREDICTED: AP-1 complex subunit mu-2 [Prunus mume]
Length=428

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISF+PPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFVPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHS+SRIE +VKARSQFKERSTA NVEIEVPV  DATNP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSKSRIEILVKARSQFKERSTATNVEIEVPVLSDATNPEVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DALIWKI+SFPGGKEYMLRAEFRLPSIT+EE TPER+APIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALIWKIRSFPGGKEYMLRAEFRLPSITAEEATPERRAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_008389705.1| PREDICTED: AP-1 complex subunit mu-2 [Malus domestica]
Length=428

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISF+PPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFVPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE Q+ERHS+SRIE +VKARSQFKERSTA NVEIEVPV  DATNP+VRTS+GS+ YAPE
Sbjct  281  WVECQIERHSKSRIEILVKARSQFKERSTATNVEIEVPVVSDATNPDVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DALIWKI+SFPGGKEYMLRAEFRLPS+T+EE+TPERKAP+RVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALIWKIRSFPGGKEYMLRAEFRLPSVTAEESTPERKAPVRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_006392117.1| hypothetical protein EUTSA_v10023468mg [Eutrema salsugineum]
 gb|ESQ29403.1| hypothetical protein EUTSA_v10023468mg [Eutrema salsugineum]
Length=428

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E HSRSR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIESHSRSRVEMLVKARSQFKERSTATNVEIELPVPTDASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG KEYMLRAEF LPS+T+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKEYMLRAEFHLPSVTAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>gb|AFW83685.1| hypothetical protein ZEAMMB73_283352 [Zea mays]
Length=632

 Score =   403 bits (1035),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  425  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  484

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+E+HSRSRIE MVKARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  485  WVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  544

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  545  RDAMVWKIKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPYFTVSGIQVRYL  604

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  605  KIIEKSGYQALPWVRYITMAGEYELRLI  632



>ref|XP_006438266.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 ref|XP_006483945.1| PREDICTED: AP-1 complex subunit mu-2-like [Citrus sinensis]
 gb|ESR51506.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|KDO82234.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=428

 Score =   396 bits (1017),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPLI
Sbjct  221  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E +VKARSQFKERSTA NVEIE+PV  DA+NP+VRTSMGS++Y PE
Sbjct  281  WVEAQVERHSRSRVEILVKARSQFKERSTATNVEIELPVSSDASNPDVRTSMGSASYVPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             +ALIWKI+SFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  DEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGY ALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYHALPWVRYITMAGEYELRLI  428



>ref|XP_010102500.1| AP-1 complex subunit mu-1 [Morus notabilis]
 gb|EXB93564.1| AP-1 complex subunit mu-1 [Morus notabilis]
Length=428

 Score =   395 bits (1016),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+ KGKAIDLDDIKFHQCVRLARF+NDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTMKGKAIDLDDIKFHQCVRLARFDNDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE  VKARSQFKERSTA NVEIE+PVP D+TNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVEKHSRSRIEITVKARSQFKERSTATNVEIELPVPSDSTNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEF LPSIT+E+  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALVWKIKSFPGNKEYMLRAEFSLPSITAEDAAPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_004298980.1| PREDICTED: AP-1 complex subunit mu-2-like [Fragaria vesca subsp. 
vesca]
Length=428

 Score =   395 bits (1016),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+ KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTAKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIEF VKARSQ+KERSTA NVEI++PVP DATNPNVRTSMGS+ YAPE
Sbjct  281  WVEAQVEKHSRSRIEFTVKARSQYKERSTATNVEIDLPVPADATNPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DAL+WKIKSFPG KEYMLRAEF LPSI +E+  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  RDALVWKIKSFPGNKEYMLRAEFSLPSIVAEDAVPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQ+LPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQSLPWVRYITMAGEYELRLI  428



>gb|KHG12319.1| AP-1 complex subunit mu-1 [Gossypium arboreum]
 gb|KJB31186.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=428

 Score =   395 bits (1016),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKARSQFKERSTA NVEI VPVP DA++PNVRTSMGS+ YAPE
Sbjct  281  WVEAQVEKHSRSRVEIMVKARSQFKERSTATNVEIMVPVPADASSPNVRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT EE T ERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALLWKIRSFPGGKEYMLRAEFTLPSITDEEATQERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KJB50247.1| hypothetical protein B456_008G160500 [Gossypium raimondii]
Length=428

 Score =   395 bits (1015),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRVTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKARSQ+KERSTA NVEI VPVP DA++PN+RTSMGS+ YAPE
Sbjct  281  WVEAQVEKHSRSRVEIMVKARSQYKERSTATNVEIAVPVPTDASSPNIRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  NDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|NP_001056201.1| Os05g0543100 [Oryza sativa Japonica Group]
 gb|AAU43995.1| putative clathrin [Oryza sativa Japonica Group]
 dbj|BAF18115.1| Os05g0543100 [Oryza sativa Japonica Group]
 dbj|BAG89382.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79627.1| hypothetical protein OsI_20841 [Oryza sativa Indica Group]
 gb|EEE64556.1| hypothetical protein OsJ_19408 [Oryza sativa Japonica Group]
Length=430

 Score =   395 bits (1015),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  223  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  282

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRI+  VK RSQFKERSTA NVEIEVPVP D+TNPN+RTSMGS+ YAPE
Sbjct  283  WVEAQVEKHSRSRIQITVKTRSQFKERSTATNVEIEVPVPEDSTNPNIRTSMGSAAYAPE  342

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPGGKEYM RAEF LPSITSE+  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  343  RDAMVWKIKSFPGGKEYMCRAEFSLPSITSEDGMPEKKAPIRVKFEIPYFTVSGIQVRYL  402

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  403  KIIEKSGYQALPWVRYITMAGEYELRLI  430



>ref|XP_009359189.1| PREDICTED: AP-1 complex subunit mu-2 [Pyrus x bretschneideri]
Length=428

 Score =   394 bits (1013),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISF+PPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLEDIKFHQCVRLARFENDRTISFVPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE Q+ERHS+SRIE +VKARSQFKERSTA NVEIEVPV  DATNP+VRTS+GS+ YAPE
Sbjct  281  WVECQIERHSKSRIEILVKARSQFKERSTATNVEIEVPVVSDATNPDVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DALIWKI+SFPGGKEYMLRAEF LPS+T+EE+TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  SDALIWKIRSFPGGKEYMLRAEFHLPSVTAEESTPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLV  428



>gb|EPS68502.1| hypothetical protein M569_06266, partial [Genlisea aurea]
Length=430

 Score =   394 bits (1013),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR T GKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  222  LLEAQGRDTNGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  281

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E  VKARSQFKERS A NVEIE+PVP DATNPN+RTSMGS+ Y PE
Sbjct  282  WVEAQVEKHSRSRVEVTVKARSQFKERSNATNVEIELPVPADATNPNIRTSMGSAAYTPE  341

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL WKIKSFPGGKEYMLRAEFRLPSITSEE+ PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  342  NDALSWKIKSFPGGKEYMLRAEFRLPSITSEESGPERKAPIRVKFEIPYFTVSGIQVRYL  401

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYIT+AGEYELRL+
Sbjct  402  KIIEKSGYQALPWVRYITVAGEYELRLL  429



>ref|XP_004509658.1| PREDICTED: AP-1 complex subunit mu-1-like [Cicer arietinum]
Length=428

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL 
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLF  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HS+SRIE  VKARSQFKERSTA NVEIE+PVP DAT PNVRTSMGS++YAPE
Sbjct  281  WVEAQVEKHSKSRIEITVKARSQFKERSTATNVEIELPVPADATTPNVRTSMGSASYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDALIWKI+SFPGGKEYMLRAEFRLPSIT EE  PERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALIWKIRSFPGGKEYMLRAEFRLPSITDEEAPPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYIT  GEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITTGGEYELRLI  428



>gb|ABR18420.1| unknown [Picea sitchensis]
Length=428

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARF NDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFGNDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+EF VKARSQFKERSTA NVEIE+PVP DAT P VRTSMGSS YAPE
Sbjct  281  WVEAQVERHSRSRVEFTVKARSQFKERSTATNVEIELPVPADATTPIVRTSMGSSVYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+AL+WKIKSFPGGKEYMLRA+F LPSI++EE+ PE++APIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KEALLWKIKSFPGGKEYMLRAQFSLPSISAEESIPEKRAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELR++
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRMI  428



>ref|XP_009386436.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
Length=428

 Score =   392 bits (1007),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKP I
Sbjct  221  LLEAQGRTTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGTFDLMTYRLSTQVKPPI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQV+RHSRSRIE MVKARSQFKERSTA +VEIE+PVP DATNP++RTSMGS+ YAPE
Sbjct  281  WVEAQVDRHSRSRIEMMVKARSQFKERSTATSVEIELPVPSDATNPSIRTSMGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPGGKEYM RAEF LPSIT+E+  PERKAPIRVKFEIPYFT+SGIQVRYL
Sbjct  341  HDALVWKIKSFPGGKEYMCRAEFSLPSITAEDAIPERKAPIRVKFEIPYFTISGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_006347435.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=428

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR TKGK+IDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRPTKGKSIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE+PVP DA +PN+RTSMG +TYAPE
Sbjct  281  WVEAQVERHSRSRVEMSVKARSQFKERSTATNVEIELPVPSDAMSPNIRTSMGYATYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPG K+YMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  RDAVVWKIKSFPGNKDYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009417102.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417110.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
Length=428

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             LLE QGR+TKGKAIDLDDIKFHQCVRL+RFENDRTISFIPPDGSFDLMTYRL+TQVKP 
Sbjct  220  LLLETQGRTTKGKAIDLDDIKFHQCVRLSRFENDRTISFIPPDGSFDLMTYRLSTQVKPP  279

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            +WVEAQVE+HSRSRIE +VKARSQFKERSTA NVEIE+PVP DA +PNVRTSMGS+ YAP
Sbjct  280  VWVEAQVEKHSRSRIEILVKARSQFKERSTATNVEIELPVPSDAIHPNVRTSMGSAKYAP  339

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            E DAL+WKIKSFPGGKEYM RAEF LPSIT+EE TPE+KAPIRVKFEIPYFTVSGIQVRY
Sbjct  340  ENDALVWKIKSFPGGKEYMCRAEFSLPSITAEEATPEKKAPIRVKFEIPYFTVSGIQVRY  399

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  400  LKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009772293.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Nicotiana 
sylvestris]
Length=421

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             +LEAQGR TKGK+IDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL
Sbjct  213  LILEAQGRPTKGKSIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPL  272

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE+PVP DA NPN+RTSMG +TYAP
Sbjct  273  IWVEAQVERHSRSRVEMSVKARSQFKERSTAMNVEIELPVPSDAMNPNIRTSMGYATYAP  332

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            E+DA++WKIKSFPG KEYMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPYFTVSGIQVRY
Sbjct  333  ERDAVVWKIKSFPGNKEYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPYFTVSGIQVRY  392

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRY TMAGEYELRL+
Sbjct  393  LKIIEKSGYQALPWVRYKTMAGEYELRLV  421



>ref|XP_009772291.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009772292.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
sylvestris]
Length=428

 Score =   390 bits (1002),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             +LEAQGR TKGK+IDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL
Sbjct  220  LILEAQGRPTKGKSIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPL  279

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE+PVP DA NPN+RTSMG +TYAP
Sbjct  280  IWVEAQVERHSRSRVEMSVKARSQFKERSTAMNVEIELPVPSDAMNPNIRTSMGYATYAP  339

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            E+DA++WKIKSFPG KEYMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPYFTVSGIQVRY
Sbjct  340  ERDAVVWKIKSFPGNKEYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPYFTVSGIQVRY  399

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRY TMAGEYELRL+
Sbjct  400  LKIIEKSGYQALPWVRYKTMAGEYELRLV  428



>ref|XP_002968864.1| hypothetical protein SELMODRAFT_91068 [Selaginella moellendorffii]
 ref|XP_002974107.1| hypothetical protein SELMODRAFT_100170 [Selaginella moellendorffii]
 gb|EFJ25062.1| hypothetical protein SELMODRAFT_100170 [Selaginella moellendorffii]
 gb|EFJ29980.1| hypothetical protein SELMODRAFT_91068 [Selaginella moellendorffii]
Length=431

 Score =   390 bits (1001),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 199/209 (95%), Gaps = 1/209 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQV-KPL  773
            LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQV +PL
Sbjct  221  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVVRPL  280

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E+ VKARSQFKERSTA NVEIE+P+P DAT PNVRTSMGSS YAP
Sbjct  281  IWVEAQVERHSRSRVEYAVKARSQFKERSTATNVEIELPLPADATTPNVRTSMGSSVYAP  340

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            EK+AL+WKIKSFPGGKEYMLRA+F LPSI SEE+ PE++APIRVKFEIPYFTVSGIQVRY
Sbjct  341  EKEALVWKIKSFPGGKEYMLRAQFGLPSIVSEESVPEKRAPIRVKFEIPYFTVSGIQVRY  400

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRYIT AGEYELR++
Sbjct  401  LKIIEKSGYQALPWVRYITTAGEYELRMI  429



>gb|EMT29153.1| AP-1 complex subunit mu-1 [Aegilops tauschii]
Length=481

 Score =   391 bits (1005),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/221 (84%), Positives = 198/221 (90%), Gaps = 13/221 (6%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRL RFENDRTISF+PPDG+FDLMTYRLTTQVKPLI
Sbjct  261  LLEAQGRATKGKAIDLDDIKFHQCVRLTRFENDRTISFVPPDGAFDLMTYRLTTQVKPLI  320

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE MVKARSQFKERST  NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  321  WVEAQVEKHSRSRIEIMVKARSQFKERSTGTNVEIEVPVPYDATNPNIRTSMGSAAYAPE  380

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGI-----  425
            +DA++WKIKSFPGGKEYM RAEF LPSITSEE TPE+K PIRVKFEIPYFTVSGI     
Sbjct  381  RDAMVWKIKSFPGGKEYMCRAEFSLPSITSEEATPEKKTPIRVKFEIPYFTVSGIQSCIL  440

Query  424  --------QVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  326
                    QVRYLK+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  441  LIYHVIPLQVRYLKVIEKSGYQALPWVRYITMAGEYELRLI  481



>emb|CDY63680.1| BnaA01g35650D [Brassica napus]
Length=433

 Score =   389 bits (999),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDL+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRTTKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQ+ERHS+SR+E +VKARSQFKERSTA NVEIE+PVP DA+NP VRTS+GS+ YAPE
Sbjct  281  WVEAQIERHSKSRVEMLVKARSQFKERSTATNVEIELPVPADASNPTVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIKSFPG K+YMLRAEF LPSIT+EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KDALVWKIKSFPGNKDYMLRAEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEY  341
            KIIEKSGYQALPWVRYITMAGEY
Sbjct  401  KIIEKSGYQALPWVRYITMAGEY  423



>ref|XP_008792874.1| PREDICTED: AP-1 complex subunit mu-2-like [Phoenix dactylifera]
Length=708

 Score =   398 bits (1022),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISF+PPDGSFDLMTYRL+TQVKPLI
Sbjct  501  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFVPPDGSFDLMTYRLSTQVKPLI  560

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WV+AQ+ERHSRSRIE MVKARSQFKERSTA NVEIE PVP DA NPNVRTSMGS+ YAPE
Sbjct  561  WVDAQIERHSRSRIEIMVKARSQFKERSTATNVEIEFPVPSDAINPNVRTSMGSAAYAPE  620

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  621  NDALVWKIKSFPGNKEYMLRAEFSLPSITAEEATPEKKAPIRVKFEIPYFTVSGIQVRYL  680

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  681  KIIEKSGYQALPWVRYITMAGEYELRLI  708



>ref|XP_009609076.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=421

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             +LEAQ R TKGK+IDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL
Sbjct  213  LILEAQDRPTKGKSIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPL  272

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE+PVP DA NPN+RTSMG + YAP
Sbjct  273  IWVEAQVERHSRSRVEMSVKARSQFKERSTATNVEIELPVPSDAMNPNIRTSMGYAKYAP  332

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            E+DA++WKIKSFPG K+YMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPYFTVSGIQVRY
Sbjct  333  ERDAVVWKIKSFPGNKDYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPYFTVSGIQVRY  392

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  393  LKIIEKSGYQALPWVRYITMAGEYELRLI  421



>ref|XP_004241506.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum lycopersicum]
 ref|XP_010322540.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum lycopersicum]
Length=428

 Score =   387 bits (995),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR TKGK+IDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRPTKGKSIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE+PVP DA +P +RTSMG +TYAPE
Sbjct  281  WVEAQVERHSRSRVEMSVKARSQFKERSTATNVEIELPVPSDAMSPIIRTSMGYATYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPG K+YMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  RDAVVWKIKSFPGNKDYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009609074.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009609075.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=428

 Score =   387 bits (995),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  952  FLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
             +LEAQ R TKGK+IDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPL
Sbjct  220  LILEAQDRPTKGKSIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPL  279

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE+PVP DA NPN+RTSMG + YAP
Sbjct  280  IWVEAQVERHSRSRVEMSVKARSQFKERSTATNVEIELPVPSDAMNPNIRTSMGYAKYAP  339

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            E+DA++WKIKSFPG K+YMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPYFTVSGIQVRY
Sbjct  340  ERDAVVWKIKSFPGNKDYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPYFTVSGIQVRY  399

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRLM  326
            LKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  400  LKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_008374401.1| PREDICTED: AP-1 complex subunit mu-2-like [Malus domestica]
Length=428

 Score =   387 bits (994),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQG+++KGK+IDLDDIKFHQCVRL+RFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGQTSKGKSIDLDDIKFHQCVRLSRFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE HSR RIEF VKARSQ+K+RSTA NVEIE+PVP DATNPNVRTS+GS+ YAPE
Sbjct  281  WVEAQVENHSRXRIEFTVKARSQYKDRSTATNVEIELPVPADATNPNVRTSIGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DAL+WKIKSFPG KEYMLR+EF LPSIT+EE  PER+APIRVKFEIPYFTVSGIQVRYL
Sbjct  341  RDALVWKIKSFPGNKEYMLRSEFTLPSITAEEAVPERRAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  401  KIIEKSGYQALPWVRYITMAGEYELRL  427



>gb|EMS61432.1| AP-1 complex subunit mu-1 [Triticum urartu]
Length=420

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL TQVKPLI
Sbjct  199  LLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLI  258

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE M+KARSQFKERSTA NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  259  WVEAQVEKHSRSRIELMIKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPE  318

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WK+KSFPGGKEYM RAEF LPSI++EE  PE+KAPIRVKFEIPYFTVSGIQVRYL
Sbjct  319  RDAMVWKVKSFPGGKEYMCRAEFSLPSISAEEAVPEKKAPIRVKFEIPYFTVSGIQVRYL  378

Query  409  KIIEKSGYQALPWVRYITMA  350
            KIIEKSGYQALPWVRYITMA
Sbjct  379  KIIEKSGYQALPWVRYITMA  398



>ref|XP_001782369.1| predicted protein [Physcomitrella patens]
 gb|EDQ52823.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   384 bits (985),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRL RFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRATKGKAIDLDDIKFHQCVRLTRFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+EFM+KARSQFKERSTA NVEIE+PVP DA+ P VRTSMG++ YAPE
Sbjct  281  WVEAQVERHSRSRVEFMIKARSQFKERSTASNVEIELPVPSDASTPAVRTSMGTAVYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+ALIWKIKSFPGGKEYM+RA+F LPSI +EET  E++ PIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KEALIWKIKSFPGGKEYMMRAKFGLPSIEAEETVVEKRPPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT AGEYELR+
Sbjct  401  KIIEKSGYQALPWVRYITTAGEYELRI  427



>ref|XP_011071917.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Sesamum 
indicum]
Length=368

 Score =   379 bits (974),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQ R+TKGKAIDLDD+KFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  161  LLEAQDRATKGKAIDLDDVKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  220

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEA VER+SRSR+E  VKA+SQFKERSTA NV IE+PVP DATNP++RTSMG++ YAPE
Sbjct  221  WVEALVERYSRSRVEMTVKAKSQFKERSTATNVTIELPVPSDATNPSIRTSMGTAKYAPE  280

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEFRLPSI SE+   +RKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  281  TDALLWKIKSFPGNKEYMLRAEFRLPSIVSEDAVADRKAPIRVKFEIPYFTVSGIQVRYL  340

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAG+YELRL+
Sbjct  341  KIIEKSGYQALPWVRYITMAGDYELRLI  368



>ref|XP_001781339.1| predicted protein [Physcomitrella patens]
 gb|EDQ53867.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   381 bits (978),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGRSTKGKAIDLDDIKFHQCVRL RFENDRTISFIPPDG+FDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRSTKGKAIDLDDIKFHQCVRLTRFENDRTISFIPPDGAFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+EFM+KARSQFKERSTA NVEIE+PVP DA+ P VRTSMG++ YAPE
Sbjct  281  WVEAQVERHSRSRVEFMIKARSQFKERSTASNVEIELPVPADASTPAVRTSMGTAVYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+ALIWKIKSFPGGKEYM+RA+F LPSI +E+   E++ PIRVKFEIPYFTVSGIQVRYL
Sbjct  341  KEALIWKIKSFPGGKEYMMRAKFGLPSIEAEDVVIEKRPPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT AGEYELR+
Sbjct  401  KIIEKSGYQALPWVRYITTAGEYELRI  427



>ref|XP_011071915.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Sesamum 
indicum]
 ref|XP_011071916.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Sesamum 
indicum]
Length=428

 Score =   380 bits (975),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQ R+TKGKAIDLDD+KFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQDRATKGKAIDLDDVKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEA VER+SRSR+E  VKA+SQFKERSTA NV IE+PVP DATNP++RTSMG++ YAPE
Sbjct  281  WVEALVERYSRSRVEMTVKAKSQFKERSTATNVTIELPVPSDATNPSIRTSMGTAKYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKIKSFPG KEYMLRAEFRLPSI SE+   +RKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  341  TDALLWKIKSFPGNKEYMLRAEFRLPSIVSEDAVADRKAPIRVKFEIPYFTVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAG+YELRL+
Sbjct  401  KIIEKSGYQALPWVRYITMAGDYELRLI  428



>ref|XP_010678835.1| PREDICTED: AP-1 complex subunit mu-2-like [Beta vulgaris subsp. 
vulgaris]
Length=428

 Score =   369 bits (947),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQG++TKGKAID++DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGQTTKGKAIDMEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+EAQ+ER+S SR+E M+KARSQFK+RS A NVEI++PVP DATNP +RTSMGS+TY PE
Sbjct  281  WIEAQLERYSTSRVEIMIKARSQFKDRSYANNVEIDLPVPPDATNPKIRTSMGSATYKPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             D ++WKI+SFPG KEY+LRAEFRLPS++S++  PERK P+RVKFEIPYFT+SGIQVRYL
Sbjct  341  NDTILWKIRSFPGNKEYLLRAEFRLPSVSSDDGVPERKVPVRVKFEIPYFTISGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            K+IEKSGYQALPWVRYIT AGEYE+RL
Sbjct  401  KVIEKSGYQALPWVRYITAAGEYEIRL  427



>ref|NP_172543.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
 sp|Q9SAC9.1|AP1M1_ARATH RecName: Full=AP-1 complex subunit mu-1; AltName: Full=Adaptor 
protein complex AP-1 subunit mu-1; AltName: Full=Adaptor protein-1 
mu-adaptin 1; AltName: Full=Adaptor-related protein 
complex 1 subunit mu-1; AltName: Full=At-muB1-Ad; AltName: 
Full=Clathrin assembly protein complex 1 mu-1 medium chain; 
AltName: Full=Mu1-adaptin 1 [Arabidopsis thaliana]
 gb|AAD31340.1|AC007354_13 Similar to gb|L26291 clathrin-associated protein unc-101 from 
Caenorhabditis elegans and is a member of the PF|00928 Adapter 
complexes medium subunit family [Arabidopsis thaliana]
 gb|AEE28635.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
Length=428

 Score =   367 bits (942),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+ KGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRAIKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEA +ERHSRSR+E +VKARSQFK+RS A +VEIE+PVP DA NP+VRTS+GS+ YAPE
Sbjct  281  WVEAHIERHSRSRVEMLVKARSQFKDRSYATSVEIELPVPTDAYNPDVRTSLGSAAYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKI+ F G KE+ L+A+F LPSI +EE TPERKAPIRVKFEIP F VSGIQVRYL
Sbjct  341  KDALVWKIQYFYGNKEHTLKADFHLPSIAAEEATPERKAPIRVKFEIPKFIVSGIQVRYL  400

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQA PWVRYITMAGEYELRLM
Sbjct  401  KIIEKSGYQAHPWVRYITMAGEYELRLM  428



>ref|XP_011624524.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Amborella trichopoda]
Length=392

 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 194/218 (89%), Gaps = 1/218 (0%)
 Frame = -1

Query  976  VNLV*MTEFLLEAQGRSTKGKAIDLDDIK-FHQCVRLARFENDRTISFIPPDGSFDLMTY  800
            +++V     L+ + G+  +   +    ++ + +CVRLARFENDRTISFIPPDGSFDLMTY
Sbjct  175  LDVVESVNILVNSNGQIIRSDVVGALKMRTYLRCVRLARFENDRTISFIPPDGSFDLMTY  234

Query  799  RLTTQVKPLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRT  620
            RL TQVKPLIWVEAQVERHSRSRIE MVKARSQFKERSTA NVEIE+PVP DATNPNVRT
Sbjct  235  RLNTQVKPLIWVEAQVERHSRSRIEIMVKARSQFKERSTATNVEIELPVPSDATNPNVRT  294

Query  619  SMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYF  440
            SMGS+TYAPEK+AL+WKIKSFPGGKEYMLRA+F LPSIT+EE TPE+KAPIRVKFEIPYF
Sbjct  295  SMGSATYAPEKEALLWKIKSFPGGKEYMLRAQFSLPSITAEEATPEKKAPIRVKFEIPYF  354

Query  439  TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  326
            TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  355  TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  392



>gb|AAF17661.1|AC009398_10 F20B24.16 [Arabidopsis thaliana]
Length=411

 Score =   361 bits (926),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 190/212 (90%), Gaps = 4/212 (2%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQV----  782
            LLEAQGR+ KGKAIDL+DIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL+TQV    
Sbjct  200  LLEAQGRAIKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVLECV  259

Query  781  KPLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSST  602
            KPLIWVEA +ERHSRSR+E +VKARSQFK+RS A +VEIE+PVP DA NP+VRTS+GS+ 
Sbjct  260  KPLIWVEAHIERHSRSRVEMLVKARSQFKDRSYATSVEIELPVPTDAYNPDVRTSLGSAA  319

Query  601  YAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQ  422
            YAPEKDAL+WKI+ F G KE+ L+A+F LPSI +EE TPERKAPIRVKFEIP F VSGIQ
Sbjct  320  YAPEKDALVWKIQYFYGNKEHTLKADFHLPSIAAEEATPERKAPIRVKFEIPKFIVSGIQ  379

Query  421  VRYLKIIEKSGYQALPWVRYITMAGEYELRLM  326
            VRYLKIIEKSGYQA PWVRYITMAGEYELRLM
Sbjct  380  VRYLKIIEKSGYQAHPWVRYITMAGEYELRLM  411



>gb|KHG01625.1| AP-1 complex subunit mu-1-I [Gossypium arboreum]
Length=417

 Score =   361 bits (927),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 187/208 (90%), Gaps = 11/208 (5%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR TKGKAIDL+DIKFHQ           TISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  221  LLEAQGRVTKGKAIDLEDIKFHQ-----------TISFIPPDGSFDLMTYRLSTQVKPLI  269

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSR+E MVKARSQ+KERSTA NVEI +PVP DA++PN+RTSMGS+ YAPE
Sbjct  270  WVEAQVEKHSRSRVEIMVKARSQYKERSTATNVEIAMPVPTDASSPNIRTSMGSAAYAPE  329

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPYFTVSGIQVRYL
Sbjct  330  NDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPYFTVSGIQVRYL  389

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  KIIEKSGYQALPWVRYITMAGEYELRLI  417



>ref|XP_006354823.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=385

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR TKGK+IDLDDI  + CV LARFENDRTISFIPPDGSFDLMTYRL+TQVKPLI
Sbjct  180  LLEAQGRPTKGKSIDLDDI--NMCVCLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLI  237

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHSRSR+E  VKARSQFKERSTA NVEIE PVP DA +P +RTSMG +TYAPE
Sbjct  238  WVEAQVERHSRSRVEMPVKARSQFKERSTATNVEIEFPVPSDAMSPIIRTSMGYATYAPE  297

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +DA++WKIKSFPG  +YMLRAEFRL S+ SE+T P+RKA IRVKFEIPYFTVSGIQVRYL
Sbjct  298  RDAVVWKIKSFPGNTDYMLRAEFRLSSVISEDTPPDRKASIRVKFEIPYFTVSGIQVRYL  357

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRY TMAGEYELRL+
Sbjct  358  KIIEKSGYQALPWVRYKTMAGEYELRLI  385



>gb|EMS46923.1| AP-1 complex subunit mu-1 [Triticum urartu]
Length=539

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+TKGKAIDLDDIKFHQCVRL RFENDRTISF+PPDG+FDLMTYRLTTQVKPLI
Sbjct  310  LLEAQGRATKGKAIDLDDIKFHQCVRLTRFENDRTISFVPPDGAFDLMTYRLTTQVKPLI  369

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE+HSRSRIE MVKARSQFKERST  NVEIEVPVP DATNPN+RTSMGS+ YAPE
Sbjct  370  WVEAQVEKHSRSRIEIMVKARSQFKERSTGTNVEIEVPVPYDATNPNIRTSMGSAAYAPE  429

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQ  422
            +DA++WKIKSFPGGKEYM RAEF LPSITSEE TPE+KAPIRVKFEIPYFTVSGIQ
Sbjct  430  RDAMVWKIKSFPGGKEYMCRAEFSLPSITSEEATPEKKAPIRVKFEIPYFTVSGIQ  485



>ref|XP_010319601.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Solanum lycopersicum]
Length=404

 Score =   333 bits (854),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            LLEAQGR+ KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDG+F++MTYRL+TQVKPL+
Sbjct  219  LLEAQGRNAKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGAFEVMTYRLSTQVKPLV  278

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVERHS+SR+E +VKARSQFKERSTA NV+IE+PVP DATNP+VRTSMGSSTYAPE
Sbjct  279  WVEAQVERHSKSRVEILVKARSQFKERSTATNVQIELPVPTDATNPDVRTSMGSSTYAPE  338

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQ  422
            KDALIWKIKSFPGGKEYMLRAEF LPSI++EE  PERK+PIRVKFEIPYFTVSGIQ
Sbjct  339  KDALIWKIKSFPGGKEYMLRAEFSLPSISAEEAVPERKSPIRVKFEIPYFTVSGIQ  394



>ref|XP_005850786.1| hypothetical protein CHLNCDRAFT_29685 [Chlorella variabilis]
 gb|EFN58684.1| hypothetical protein CHLNCDRAFT_29685 [Chlorella variabilis]
Length=438

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L EAQGR+ + KA+DL+D+KFHQCVRLA FE DRTISFIPPDG+FDLMTYRL+  +KPLI
Sbjct  229  LFEAQGRTGRQKAVDLEDMKFHQCVRLASFERDRTISFIPPDGAFDLMTYRLSQNIKPLI  288

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE QV++HSRSR E++VKARSQFKERSTA +VEI +P+P DA +P VRTS G++ YAPE
Sbjct  289  WVECQVDKHSRSRTEYLVKARSQFKERSTATSVEILLPLPPDAISPTVRTSQGTAVYAPE  348

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            KDAL+WKIK+FPGG+E++LR +F LPS+ +E+    R  PI+VKFEIPY++VSGIQ+RYL
Sbjct  349  KDALVWKIKNFPGGREFLLRCKFGLPSVAAEDEAQGRLPPIKVKFEIPYYSVSGIQIRYL  408

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            K+IE+SGYQALPWVRY+T AG YE+R+
Sbjct  409  KVIERSGYQALPWVRYLTQAGSYEIRM  435



>emb|CCA17153.1| Clathrin assembly complex putative [Albugo laibachii Nc14]
Length=424

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  949  LLEAQGR-STKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            L EA GR S+KGKA++++DIKFHQCVRLARFE DRTISFIPPDG FDLMTYRL+T VKPL
Sbjct  217  LFEATGRASSKGKAVEMEDIKFHQCVRLARFETDRTISFIPPDGEFDLMTYRLSTHVKPL  276

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE HSRSRIE+MVKA+SQFK RS A NVEI +PVP D  +P+ ++S+GS TY P
Sbjct  277  IWVEAVVEPHSRSRIEYMVKAKSQFKSRSIANNVEIVIPVPPDVDSPSFKSSIGSVTYVP  336

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            ++DA +W IK F G KEY++RA F LPS+ +EET  + KAPI+VKFEIPYFTVSGIQVRY
Sbjct  337  DRDAFVWTIKQFNGAKEYLMRAHFGLPSLNNEETE-DWKAPIQVKFEIPYFTVSGIQVRY  395

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKIIEKSGYQALPWVRYIT  GEY+LR+
Sbjct  396  LKIIEKSGYQALPWVRYITQNGEYQLRM  423



>gb|ETP32967.1| hypothetical protein F442_18448 [Phytophthora parasitica P10297]
Length=425

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -1

Query  949  LLEAQGRST-KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            L EA GRS+ KGKA++++DIKFHQCVRLARFE+DRTISFIPPDG FDLMTYRL T VKPL
Sbjct  217  LFEATGRSSSKGKAVEMEDIKFHQCVRLARFESDRTISFIPPDGEFDLMTYRLATHVKPL  276

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE HSRSRIE+MVKA+SQFK RS A NVEI +PVP D  +P+ + S+GS TY P
Sbjct  277  IWVEAVVEPHSRSRIEYMVKAKSQFKSRSIANNVEIVIPVPPDVDSPSFKCSIGSVTYVP  336

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            ++DA++W IK F G +EY++RA F LPS+ + E T + KAPI+VKFEIPYFTVSGIQVRY
Sbjct  337  DRDAIVWSIKQFNGSREYLMRAHFGLPSVDNHEATDDWKAPIQVKFEIPYFTVSGIQVRY  396

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  397  LKIIEKSGYQALPWVRYITQNGDYQLRM  424



>ref|XP_008913378.1| hypothetical protein PPTG_17400 [Phytophthora parasitica INRA-310]
 gb|ETI34967.1| hypothetical protein F443_18647 [Phytophthora parasitica P1569]
 gb|ETK75253.1| hypothetical protein L915_18128 [Phytophthora parasitica]
 gb|ETL28680.1| hypothetical protein L916_18030 [Phytophthora parasitica]
 gb|ETL81909.1| hypothetical protein L917_17848 [Phytophthora parasitica]
 gb|ETM35135.1| hypothetical protein L914_17933 [Phytophthora parasitica]
 gb|ETN01277.1| hypothetical protein PPTG_17400 [Phytophthora parasitica INRA-310]
 gb|ETO63720.1| hypothetical protein F444_18642 [Phytophthora parasitica P1976]
 gb|ETP04788.1| hypothetical protein F441_18507 [Phytophthora parasitica CJ01A1]
Length=425

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -1

Query  949  LLEAQGRST-KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            L EA GRS+ KGKA++++DIKFHQCVRLARFE+DRTISFIPPDG FDLMTYRL T VKPL
Sbjct  217  LFEATGRSSSKGKAVEMEDIKFHQCVRLARFESDRTISFIPPDGEFDLMTYRLATHVKPL  276

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE HSRSRIE+MVKA+SQFK RS A NVEI +PVP D  +P+ + S+GS TY P
Sbjct  277  IWVEAVVEPHSRSRIEYMVKAKSQFKSRSIANNVEIVIPVPPDVDSPSFKCSIGSVTYVP  336

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            ++DA++W IK F G +EY++RA F LPS+ + E T + KAPI+VKFEIPYFTVSGIQVRY
Sbjct  337  DRDAIVWSIKQFNGSREYLMRAHFGLPSVDNHEATDDWKAPIQVKFEIPYFTVSGIQVRY  396

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  397  LKIIEKSGYQALPWVRYITQNGDYQLRM  424



>ref|XP_009518106.1| hypothetical protein PHYSODRAFT_349597 [Phytophthora sojae]
 gb|EGZ22818.1| hypothetical protein PHYSODRAFT_349597 [Phytophthora sojae]
Length=425

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -1

Query  949  LLEAQGRST-KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            L EA GRS+ KGKA++++DIKFHQCVRLARFE+DRTISFIPPDG FDLMTYRL T VKPL
Sbjct  217  LFEATGRSSSKGKAVEMEDIKFHQCVRLARFESDRTISFIPPDGEFDLMTYRLATHVKPL  276

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE HSRSRIE+MVKA+SQFK RS A NVEI +PVP D  +P+ + S+GS TY P
Sbjct  277  IWVEAVVEPHSRSRIEYMVKAKSQFKSRSIANNVEIVIPVPPDVDSPSFKCSIGSVTYVP  336

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            ++DA++W IK F G +EY++RA F LPS+ + E T + KAPI+VKFEIPYFTVSGIQVRY
Sbjct  337  DRDAIVWSIKQFNGSREYLMRAHFGLPSVDNHEATDDWKAPIQVKFEIPYFTVSGIQVRY  396

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  397  LKIIEKSGYQALPWVRYITQNGDYQLRM  424



>gb|AAN71247.1| LD27989p [Drosophila melanogaster]
Length=225

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 176/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  20   LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  78

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  79   WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPE  138

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW IKSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPYFT SGIQVRYL
Sbjct  139  QNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPYFTTSGIQVRYL  197

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  198  KIIEKSGYQALPWVRYITQNGDYQLR  223



>ref|XP_005785717.1| Apm1, medium subunit of the adaptin 1 complex [Emiliania huxleyi 
CCMP1516]
 ref|XP_005785718.1| Adaptor protein 1 medium subunit [Emiliania huxleyi CCMP1516]
 gb|EOD33288.1| Apm1, medium subunit of the adaptin 1 complex [Emiliania huxleyi 
CCMP1516]
 gb|EOD33289.1| Adaptor protein 1 medium subunit [Emiliania huxleyi CCMP1516]
Length=428

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 179/215 (83%), Gaps = 7/215 (3%)
 Frame = -1

Query  955  EFLLEAQGRST------KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRL  794
            + L EA GR T      KGKA++++DIKFHQCVRLARFENDRTISFIPPDG F+LM+YRL
Sbjct  214  KLLFEATGRRTGGRGLSKGKAVEMEDIKFHQCVRLARFENDRTISFIPPDGEFELMSYRL  273

Query  793  TTQVKPLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSM  614
             TQVKPLIW+EA VE HS SRIE+M+KA+SQFK+RSTA NVEI VPVP DA  P+ +TS+
Sbjct  274  NTQVKPLIWIEAVVEPHSHSRIEYMIKAKSQFKQRSTANNVEIVVPVPADADTPSFKTSI  333

Query  613  GSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTV  434
            G+  YAPE+DA++W IK F GGKEY++RA F LPS+++EE   + K PI VKFEIPYFTV
Sbjct  334  GTVKYAPERDAIVWSIKQFHGGKEYLMRAHFGLPSVSNEEEKKD-KPPITVKFEIPYFTV  392

Query  433  SGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  329
            SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  393  SGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  427



>emb|CDI54254.1| probable clathrin assembly protein AP47, partial [Melanopsichium 
pennsylvanicum 4]
Length=426

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E  GR+ +GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  220  MFENTGRAARGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTQVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VERH  SRIEFMVK ++QFK RSTA NVEI +PVP DA  P  R ++GS  YAPE
Sbjct  280  WAEAIVERHEGSRIEFMVKVKAQFKRRSTANNVEIHIPVPDDADTPKFRAAIGSVVYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A++WKIK   GGKE+++RA F LPS+ SE+T  +R+API +KFEIPYFTVSGIQVRYL
Sbjct  340  KSAMVWKIKQLGGGKEFLMRAHFGLPSVKSEDTV-DRRAPISIKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQHGEYDLR  424



>emb|CCI49557.1| unnamed protein product [Albugo candida]
Length=404

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  949  LLEAQGR-STKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            L EA GR S+KGKA++++DIKFHQCVRLARFE DRTISFIPPDG FDLMTYRL+T VKPL
Sbjct  197  LFEATGRASSKGKAVEMEDIKFHQCVRLARFETDRTISFIPPDGEFDLMTYRLSTHVKPL  256

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE HSRSRIE+MVKA+SQFK RS A NVEI +PVP D  +P+ ++S+G+ TY P
Sbjct  257  IWVEAVVEPHSRSRIEYMVKAKSQFKSRSIANNVEIVIPVPPDVDSPSFKSSIGNVTYVP  316

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            ++DA +W IK F G KEY++RA F LPS+ +EET  + KAPI+VKFEIPYFTVSGIQVRY
Sbjct  317  DRDAFVWTIKQFNGAKEYLMRAHFGLPSLNNEETD-DWKAPIQVKFEIPYFTVSGIQVRY  375

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  376  LKIIEKSGYQALPWVRYITQNGDYQLRM  403



>emb|CCI49556.1| unnamed protein product [Albugo candida]
Length=408

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  949  LLEAQGR-STKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            L EA GR S+KGKA++++DIKFHQCVRLARFE DRTISFIPPDG FDLMTYRL+T VKPL
Sbjct  201  LFEATGRASSKGKAVEMEDIKFHQCVRLARFETDRTISFIPPDGEFDLMTYRLSTHVKPL  260

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE HSRSRIE+MVKA+SQFK RS A NVEI +PVP D  +P+ ++S+G+ TY P
Sbjct  261  IWVEAVVEPHSRSRIEYMVKAKSQFKSRSIANNVEIVIPVPPDVDSPSFKSSIGNVTYVP  320

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            ++DA +W IK F G KEY++RA F LPS+ +EET  + KAPI+VKFEIPYFTVSGIQVRY
Sbjct  321  DRDAFVWTIKQFNGAKEYLMRAHFGLPSLNNEETD-DWKAPIQVKFEIPYFTVSGIQVRY  379

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  380  LKIIEKSGYQALPWVRYITQNGDYQLRM  407



>gb|EST09503.1| putative clathrin assembly protein AP47 [Pseudozyma brasiliensis 
GHG001]
Length=439

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E+ GR+ +GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  220  MFESTGRAARGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTQVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VERH  SRIEFMVK ++QFK RSTA NVEI +PVP DA  P  R + GS  YAPE
Sbjct  280  WAEAIVERHEGSRIEFMVKVKAQFKRRSTANNVEIHIPVPDDADTPKFRAATGSVVYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A++WKIK   GGKE+++RA F LPS+ SEE   +R+API +KFEIPYFTVSGIQVRYL
Sbjct  340  KSAMVWKIKQLGGGKEFLMRAHFGLPSVKSEEVV-DRRAPISIKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQHGEYDLR  424



>ref|XP_003748057.1| PREDICTED: AP-1 complex subunit mu-1-like [Metaseiulus occidentalis]
Length=426

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 174/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  222  LFESTGRG-KNKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  280

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+MVKARSQFK RSTA NVEI VPVP+DA +P  +T++GS  YAPE
Sbjct  281  WIESVIERHAHSRVEYMVKARSQFKRRSTANNVEIIVPVPMDADSPKFKTTIGSCKYAPE  340

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A IW IKSFPGGKEY++RA F LPS+ SEE   E +API VKFEIPYFT SGIQVRYL
Sbjct  341  RSACIWTIKSFPGGKEYLMRAHFNLPSVESEEL--EARAPIEVKFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>gb|KIZ03697.1| AP-1 complex subunit mu-1 [Monoraphidium neglectum]
Length=426

 Score =   318 bits (815),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L EAQGR+ + KA++++DI+FHQCVRLARFENDRTISFIPPDG+FDLMTYRL+  +KPL+
Sbjct  219  LFEAQGRTNRQKAVEMEDIRFHQCVRLARFENDRTISFIPPDGNFDLMTYRLSQNIKPLV  278

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE  VE  SRSR +++VKARSQFKERS A NVEI +P+P DA  P  R S G++ YAPE
Sbjct  279  WVECLVEHPSRSRTDYVVKARSQFKERSAATNVEIILPLPQDAIVPQSRCSQGTAVYAPE  338

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+IW IKSFPGGKEY+LR  F LPS+ +EE    +  PI+VKFEIPYFTVSG+QVRYL
Sbjct  339  RSAMIWTIKSFPGGKEYLLRVNFNLPSVEAEEEVHGKMPPIKVKFEIPYFTVSGLQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYIT AG YE+R+M
Sbjct  399  KVIEKSGYQALPWVRYITTAGNYEIRMM  426



>emb|CCF51403.1| probable clathrin assembly protein AP47 [Ustilago hordei]
Length=439

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E  GR+ +GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  220  MFENTGRAARGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTQVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VERH  SRIEFMVK ++QFK RSTA NVEI +PVP DA  P  R ++GS+ YAPE
Sbjct  280  WAEAIVERHEGSRIEFMVKVKAQFKRRSTANNVEIHIPVPDDADTPKFRAAIGSAVYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A++WKIK   GGKE+++RA F LPS+ SE+T  +R+ PI +KFEIPYFTVSGIQVRYL
Sbjct  340  KSAMVWKIKQLGGGKEFLMRAHFGLPSVKSEDTV-DRRTPISIKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQHGEYDLR  424



>ref|XP_011408446.1| PREDICTED: AP-1 complex subunit mu-1-like [Amphimedon queenslandica]
Length=224

 Score =   311 bits (796),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  955  EFLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKP  776
            + L E  GR T+ KA++L+D+KFHQCVRL+RFENDRTISF+PPDG F+LM+YRL TQVKP
Sbjct  18   KILFENTGR-TRSKAVELEDVKFHQCVRLSRFENDRTISFVPPDGEFELMSYRLNTQVKP  76

Query  775  LIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYA  596
            LIWVE+ +ERHS SR+E+++KA+ QFK RSTA +VEI +PVP DA  P  R + G++TYA
Sbjct  77   LIWVESVIERHSHSRVEYLIKAKGQFKRRSTANDVEILIPVPADADTPRHRCTAGTATYA  136

Query  595  PEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVR  416
            PEK+AL WKIKSFPGGKEY+LRA F LPS+ SEE   E + PI VKFEIPYFT SGIQVR
Sbjct  137  PEKNALSWKIKSFPGGKEYVLRAHFGLPSVQSEEG--EGRPPISVKFEIPYFTTSGIQVR  194

Query  415  YLKIIEKSGYQALPWVRYITMAGEYELR  332
            YLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  195  YLKIIEKSGYQALPWVRYITQNGDYQLR  222



>gb|KHN82492.1| AP-1 complex subunit mu-1-I [Toxocara canis]
Length=417

 Score =   317 bits (813),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 176/208 (85%), Gaps = 3/208 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  213  LFESSGRG-KNKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLMTVVKPLI  271

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+EA VERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +TS+GS  YAPE
Sbjct  272  WIEAVVERHTHSRVEYMIKAKSQFKRRSTANNVEISIPVPSDADSPKFKTSIGSVKYAPE  331

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A +W IKSFPGGKEY++RA F LPS+ SE+   E K P++VKFEIPYFT SGIQVRYL
Sbjct  332  QNAFVWTIKSFPGGKEYLMRAHFNLPSVQSEDV--EGKPPMKVKFEIPYFTTSGIQVRYL  389

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYIT  G+Y+LR+M
Sbjct  390  KIIEKSGYQALPWVRYITQNGDYQLRMM  417



>emb|CBQ73883.1| probable clathrin assembly protein AP47 [Sporisorium reilianum 
SRZ2]
Length=439

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E  GR+ +GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  220  MFENTGRAARGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTQVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VERH  SRIEFMVK ++QFK RSTA NVEI +PVP DA  P  R ++GS  YAPE
Sbjct  280  WAEAIVERHEGSRIEFMVKVKAQFKRRSTANNVEIHIPVPDDADTPKFRAAIGSVVYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A++WKIK   GGKE+++RA F LPS+ SE+T  +R+ PI +KFEIPYFTVSGIQVRYL
Sbjct  340  KSAMVWKIKQLGGGKEFLMRAHFGLPSVKSEDTV-DRRTPISIKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQHGEYDLR  424



>gb|EFX86177.1| hypothetical protein DAPPUDRAFT_222170 [Daphnia pulex]
Length=422

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA +VE+ VPVP DA +P  +TS+GS  Y PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANHVEVVVPVPADADSPKFKTSVGSVKYVPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++ LIW IKSFPGGKEY++RA F LPS+TSEET  E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNVLIWSIKSFPGGKEYLMRAHFGLPSVTSEET--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_008875643.1| hypothetical protein H310_10930 [Aphanomyces invadans]
 gb|ETV95892.1| hypothetical protein H310_10930 [Aphanomyces invadans]
Length=430

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 177/213 (83%), Gaps = 4/213 (2%)
 Frame = -1

Query  955  EFLLEAQGRST--KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQV  782
            + L EA GRS+  KGKA++++DIKFHQCVRLARFE DRTISFIPPDG FDLMTYRLTT V
Sbjct  217  KMLFEATGRSSSSKGKAVEMEDIKFHQCVRLARFETDRTISFIPPDGEFDLMTYRLTTHV  276

Query  781  KPLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSST  602
            KPLIWVEA VE HSRSRIE+MVK +SQFK RS A NVEI +PVP D  +P+ + S+GS T
Sbjct  277  KPLIWVEAVVEPHSRSRIEYMVKTKSQFKSRSIANNVEIVIPVPPDVDSPSFKCSIGSVT  336

Query  601  YAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEET--TPERKAPIRVKFEIPYFTVSG  428
            Y P++DA++W IK F G +EY++RA F LPSI++  T  T E KAPI+VKFEIPYFTVSG
Sbjct  337  YVPDRDAIVWTIKQFNGSREYLMRAHFGLPSISNTNTAATDEWKAPIQVKFEIPYFTVSG  396

Query  427  IQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  329
            IQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  397  IQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  429



>ref|XP_001359566.1| GA21750 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002017486.1| GL21499 [Drosophila persimilis]
 gb|EAL28715.1| GA21750 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW34586.1| GL21499 [Drosophila persimilis]
Length=426

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 176/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  221  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  280  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW +KSFPGGKEY++RA F LPS+ SEE T E K PI+V+FEIPYFT SGIQVRYL
Sbjct  340  QNAIIWTVKSFPGGKEYLMRAHFGLPSVESEENT-EGKPPIQVRFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>dbj|GAC93824.1| potential clathrin-associated protein [Pseudozyma hubeiensis 
SY62]
Length=549

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E  GR+ +GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  330  MFENTGRAARGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTQVKPLI  389

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VERH  SRIEFMVK ++QFK RSTA NVEI +PVP DA  P  R + GS  YAPE
Sbjct  390  WAEAIVERHEGSRIEFMVKVKAQFKRRSTANNVEIHIPVPDDADTPKFRAATGSVVYAPE  449

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A++WKIK   GGKE+++RA F LPS+ SEET  +R+ PI +KFEIPYFTVSGIQVRYL
Sbjct  450  KSAMVWKIKQLGGGKEFLMRAHFGLPSVKSEETV-DRRTPISIKFEIPYFTVSGIQVRYL  508

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  509  KIVEKSGYQALPWVRYITQHGEYDLR  534



>ref|XP_011390066.1| putative clathrin assembly protein AP47 [Ustilago maydis 521]
 gb|KIS68390.1| putative clathrin assembly protein AP47 [Ustilago maydis 521]
Length=439

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E  GR+ +GK+I+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  220  MFENTGRAARGKSIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTQVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA +ERH  SRIEFMVK ++QFK RSTA NVEI +PVP DA  P  R ++GS  YAPE
Sbjct  280  WAEAIIERHEGSRIEFMVKVKAQFKRRSTANNVEIHIPVPDDADTPKFRAAIGSVVYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A++WKIK   GGKE+++RA F LPS+ SE+T  +R+ PI +KFEIPYFTVSGIQVRYL
Sbjct  340  KSAMVWKIKQLGGGKEFLMRAHFGLPSVKSEDTV-DRRTPISIKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQHGEYDLR  424



>ref|XP_009041591.1| hypothetical protein AURANDRAFT_70425 [Aureococcus anophagefferens]
 gb|EGB03736.1| hypothetical protein AURANDRAFT_70425 [Aureococcus anophagefferens]
Length=400

 Score =   315 bits (806),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 179/211 (85%), Gaps = 4/211 (2%)
 Frame = -1

Query  955  EFLLEAQGRS-TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVK  779
            + + EA GRS T+GKA++L+DIKFHQCVRLARFENDRTISFIPPDG FDLMTYRLTTQVK
Sbjct  191  KLMFEATGRSMTRGKAVELEDIKFHQCVRLARFENDRTISFIPPDGEFDLMTYRLTTQVK  250

Query  778  PLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTY  599
            PLIWVEA VE HS SRIE+MVKA+SQFK RS A  V+I +PVP D  +P+ ++S+GS TY
Sbjct  251  PLIWVEAVVEPHSHSRIEYMVKAKSQFKSRSVANGVDIVIPVPHDVDSPSFKSSIGSVTY  310

Query  598  APEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPER-KAPIRVKFEIPYFTVSGIQ  422
             P+++A++W IK F G +EY++RA F LPS++SE+  PE  KAPI +KFEIPYFTVSGIQ
Sbjct  311  LPDRNAIVWSIKQFNGSREYLMRAHFGLPSVSSED--PEHWKAPIEIKFEIPYFTVSGIQ  368

Query  421  VRYLKIIEKSGYQALPWVRYITMAGEYELRL  329
            VRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  369  VRYLKIIEKSGYQALPWVRYITQNGDYQLRM  399



>ref|XP_001998648.1| GI23520 [Drosophila mojavensis]
 ref|XP_002056361.1| GJ10271 [Drosophila virilis]
 gb|EDW14109.1| GI23520 [Drosophila mojavensis]
 gb|EDW59473.1| GJ10271 [Drosophila virilis]
Length=426

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 176/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  221  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  280  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW IKSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPYFT SGIQVRYL
Sbjct  340  QNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_002070012.1| GK11256 [Drosophila willistoni]
 gb|EDW80998.1| GK11256 [Drosophila willistoni]
Length=426

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 176/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  221  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  280  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW IKSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPYFT SGIQVRYL
Sbjct  340  QNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|NP_649906.1| adaptor protein complex 1, mu subunit [Drosophila melanogaster]
 ref|XP_001954851.1| GF16536 [Drosophila ananassae]
 ref|XP_001980806.1| GG17361 [Drosophila erecta]
 ref|XP_002031881.1| GM26246 [Drosophila sechellia]
 ref|XP_002096960.1| GE24766 [Drosophila yakuba]
 ref|XP_002104108.1| GD20786 [Drosophila simulans]
 gb|AAF14247.1|AF110231_1 clathrin-associated adaptor complex AP-1 medium chain [Drosophila 
melanogaster]
 emb|CAA06918.1| clathrin-associated protein [Drosophila melanogaster]
 gb|AAF54399.1| adaptor protein complex 1, mu subunit [Drosophila melanogaster]
 gb|AAL13850.1| LD31377p [Drosophila melanogaster]
 gb|EDV43412.1| GF16536 [Drosophila ananassae]
 gb|EDV49764.1| GG17361 [Drosophila erecta]
 gb|EDW42867.1| GM26246 [Drosophila sechellia]
 gb|EDW96672.1| GE24766 [Drosophila yakuba]
 gb|EDX13611.1| GD20786 [Drosophila simulans]
 gb|ACL85571.1| AP-47-PA, partial [synthetic construct]
 gb|ACL90447.1| AP-47-PA [synthetic construct]
Length=426

 Score =   315 bits (807),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 176/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  221  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  280  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW IKSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPYFT SGIQVRYL
Sbjct  340  QNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|WP_028824236.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-P07]
Length=248

 Score =   309 bits (791),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 177/211 (84%), Gaps = 4/211 (2%)
 Frame = -1

Query  955  EFLLEAQGRS-TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVK  779
            + + EA GRS  +GKA++L+DIKFHQCVRLARFENDRTISFIPPDG FDLMTYRLTTQVK
Sbjct  39   KLMFEATGRSIARGKAVELEDIKFHQCVRLARFENDRTISFIPPDGEFDLMTYRLTTQVK  98

Query  778  PLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTY  599
            PLIWVEA VE HS SRIE+MVKA+SQFK RS A +V+I +PVP D  +P+ ++S+GS +Y
Sbjct  99   PLIWVEAVVEPHSHSRIEYMVKAKSQFKSRSVANSVDIVIPVPHDVDSPSFKSSIGSVSY  158

Query  598  APEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPER-KAPIRVKFEIPYFTVSGIQ  422
             P+++ +IW IK F G +EY++RA F LPS++ E   P+R KAPI V+FEIPYFTVSGIQ
Sbjct  159  LPDRNVIIWSIKQFNGAREYLMRAHFGLPSVSGE--NPDRWKAPIEVRFEIPYFTVSGIQ  216

Query  421  VRYLKIIEKSGYQALPWVRYITMAGEYELRL  329
            VRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  217  VRYLKIIEKSGYQALPWVRYITQNGDYQLRM  247



>ref|XP_007877975.1| hypothetical protein PFL1_02271 [Pseudozyma flocculosa PF-1]
 gb|EPQ30155.1| hypothetical protein PFL1_02271 [Pseudozyma flocculosa PF-1]
Length=439

 Score =   315 bits (808),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E  GR+ +GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  220  MFENTGRAARGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTQVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA +ERH  SRIEFMVK ++QFK RSTA NVEI +PVP DA  P  R + GS +YAPE
Sbjct  280  WAEAIIERHEGSRIEFMVKVKAQFKRRSTANNVEIHIPVPDDADTPKFRAATGSVSYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A++WKIK   GGKE+++RA F LPS+ +EE   +R+ PI VKFEIPYFTVSGIQVRYL
Sbjct  340  KSAMVWKIKQLGGGKEFLMRAHFGLPSVKNEEML-DRRTPISVKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQHGEYDLR  424



>gb|KDO31695.1| AP-1 complex subunit mu-1 [Saprolegnia parasitica CBS 223.65]
Length=431

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = -1

Query  955  EFLLEAQGRST---KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQ  785
            + L EA GRST   KGKA++++DIKFHQCVRLARFE DRTISFIPPDG FDLMTYRL T 
Sbjct  217  KMLFEATGRSTTSSKGKAVEMEDIKFHQCVRLARFETDRTISFIPPDGEFDLMTYRLNTH  276

Query  784  VKPLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSS  605
            VKPLIWVEA VE HSRSRIE+M+K +SQFK RS A NVEI +PVP D  +P+ + S+GS 
Sbjct  277  VKPLIWVEAVVEPHSRSRIEYMIKTKSQFKSRSIANNVEIVIPVPPDVDSPSFKCSIGSV  336

Query  604  TYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEE--TTPERKAPIRVKFEIPYFTVS  431
            TY P++DA++W IK F G +EY +RA F LPSIT+    T+ E KAPI+VKFEIPYFTVS
Sbjct  337  TYVPDRDAIVWTIKQFNGSREYAMRAHFGLPSITNSNTATSDEWKAPIQVKFEIPYFTVS  396

Query  430  GIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  329
            GIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  397  GIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  430



>ref|XP_001990364.1| clathrin associated protein 47 [Drosophila grimshawi]
 gb|EDV93426.1| clathrin associated protein 47 [Drosophila grimshawi]
Length=426

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 176/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  221  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  280  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW +KSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPYFT SGIQVRYL
Sbjct  340  QNAIIWTVKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_008614336.1| AP-1 complex subunit mu-1 [Saprolegnia diclina VS20]
 gb|EQC32395.1| AP-1 complex subunit mu-1 [Saprolegnia diclina VS20]
Length=431

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = -1

Query  955  EFLLEAQGRST---KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQ  785
            + L EA GRST   KGKA++++DIKFHQCVRLARFE DRTISFIPPDG FDLMTYRL T 
Sbjct  217  KMLFEATGRSTTSSKGKAVEMEDIKFHQCVRLARFETDRTISFIPPDGEFDLMTYRLNTH  276

Query  784  VKPLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSS  605
            VKPLIWVEA VE HSRSRIE+M+K +SQFK RS A NVEI +PVP D  +P+ + S+GS 
Sbjct  277  VKPLIWVEAVVEPHSRSRIEYMIKTKSQFKSRSIANNVEIVIPVPPDVDSPSFKCSIGSV  336

Query  604  TYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEE--TTPERKAPIRVKFEIPYFTVS  431
            TY P++DA++W IK F G +EY +RA F LPSIT+    T+ E KAPI+VKFEIPYFTVS
Sbjct  337  TYVPDRDAIVWTIKQFNGSREYAMRAHFGLPSITNSNTATSDEWKAPIQVKFEIPYFTVS  396

Query  430  GIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  329
            GIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  397  GIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  430



>ref|XP_001637219.1| predicted protein [Nematostella vectensis]
 gb|EDO45156.1| predicted protein [Nematostella vectensis]
Length=423

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 176/208 (85%), Gaps = 3/208 (1%)
 Frame = -1

Query  955  EFLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKP  776
            + L E  GR  K KA++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKP
Sbjct  217  KILFENTGRG-KSKAVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKP  275

Query  775  LIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYA  596
            LIW+E+ +ERHS SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++G+  YA
Sbjct  276  LIWIESVIERHSHSRVEYMIKAKSQFKRRSTANNVEIHIPVPADADSPKFKTTVGNIKYA  335

Query  595  PEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVR  416
            PE++ +IW IKSFPGGKE+++RA F LPS+ SEET  E + PI++KFEIPYFTVSGIQVR
Sbjct  336  PEQNVVIWNIKSFPGGKEFLMRAHFNLPSVDSEET--EGRPPIKLKFEIPYFTVSGIQVR  393

Query  415  YLKIIEKSGYQALPWVRYITMAGEYELR  332
            YLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  394  YLKIIEKSGYQALPWVRYITQNGDYQLR  421



>gb|AFK36986.1| unknown [Lotus japonicus]
Length=161

 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/161 (91%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  808  MTYRLTTQVKPLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPN  629
            MTYRL+TQVKPLIWVEA VE+HS+SRIE MVKARSQFKERSTA NVEIE+PVPVDA NPN
Sbjct  1    MTYRLSTQVKPLIWVEATVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPVDAMNPN  60

Query  628  VRTSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEI  449
            VRTSMGS+ YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT+EE TPERKAPIRVKFEI
Sbjct  61   VRTSMGSAAYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITAEEATPERKAPIRVKFEI  120

Query  448  PYFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  326
            PYFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  121  PYFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  161



>gb|ETN70109.1| adaptor complexe medium subunit family protein [Necator americanus]
Length=422

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 172/207 (83%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RF+NDRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  218  LFEGSGRG-KSKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGAFELMSYRLTTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  VERHS SR+EFMVKA+SQFK RSTA NVEI +PVP DA +P  +TS+GS  YAPE
Sbjct  277  WIETNVERHSHSRVEFMVKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGSVRYAPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IKSFPGGKEY+L A F LPS+  EE   E + PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAFVWTIKSFPGGKEYLLSAHFSLPSVVGEEV--EGRPPIKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEY++R+
Sbjct  395  KIIEKSGYQALPWVRYITQNGEYQMRM  421



>gb|ERG87092.1| ap-1 complex subunit mu-1-i [Ascaris suum]
Length=422

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 174/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM YRL T VKPLI
Sbjct  218  LFESSGRG-KNKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMNYRLMTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+EA VERH+ SR+EFM+KA+SQFK RSTA NVEI +PVP DA +P  +TS+G+  Y PE
Sbjct  277  WIEAVVERHTHSRVEFMIKAKSQFKRRSTANNVEISIPVPSDADSPKFKTSIGTVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A +W IKSFPGGKEY++RA F LPS+ S++   E K P++VKFEIPYFT SGIQVRYL
Sbjct  337  QNAFVWTIKSFPGGKEYLMRAHFNLPSVQSDDV--EGKPPMKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYIT  G+Y+LR+M
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLRMM  422



>gb|KKA69242.1| hypothetical protein PRIPAC_16034 [Pristionchus pacificus]
Length=442

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 173/207 (84%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K KA++L+D+KFHQCVRL+RF+NDRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  238  LFEGSGRG-KSKAVELEDVKFHQCVRLSRFDNDRTISFIPPDGAFELMSYRLTTLVKPLI  296

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  VERHS SR+EFMVKA+SQFK RSTA NVEI +PVP DA +P  +TS+G+  YAPE
Sbjct  297  WIETSVERHSHSRVEFMVKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSVGAVKYAPE  356

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IKSFPGGKEY+L A F LPS++SE+   + + PI VKFEIPYFT SGIQVRYL
Sbjct  357  QSAFVWSIKSFPGGKEYLLSAHFALPSVSSEDA--DARPPISVKFEIPYFTTSGIQVRYL  414

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEY+LR+
Sbjct  415  KIIEKSGYQALPWVRYITQNGEYQLRM  441



>emb|CDJ83045.1| Clathrin adaptor domain containing protein [Haemonchus contortus]
 emb|CDJ81258.1| Clathrin adaptor domain containing protein [Haemonchus contortus]
Length=422

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 172/207 (83%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RF+NDRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  218  LFEGSGRG-KSKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGAFELMSYRLTTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  +ERHS SR+EFM+KA+SQFK RSTA NVEI +PVP DA +P  +TS+G+  YAPE
Sbjct  277  WIETNIERHSHSRVEFMIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGAVRYAPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IKSFPGGKEY+L A F LPS+  EE   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAFVWTIKSFPGGKEYLLSAHFSLPSVVGEEV--EGKPPIKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEY++R+
Sbjct  395  KIIEKSGYQALPWVRYITQNGEYQMRM  421



>gb|EKC25539.1| AP-1 complex subunit mu-1 [Crassostrea gigas]
Length=396

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  192  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  250

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAP+
Sbjct  251  WVESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIIPVPADADSPKFKTTVGSCKYAPD  310

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             +A+IW +KSFPGGKEY++RA F LPS+ +EE+  E + PI VKFEIPYFTVSGIQVRYL
Sbjct  311  MNAVIWTVKSFPGGKEYLMRAHFGLPSVIAEES--EGRPPIHVKFEIPYFTVSGIQVRYL  368

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  369  KIIEKSGYQALPWVRYITQNGDYQLR  394



>ref|XP_002158238.1| PREDICTED: AP-1 complex subunit mu-1-like [Hydra vulgaris]
Length=423

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 177/208 (85%), Gaps = 3/208 (1%)
 Frame = -1

Query  955  EFLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKP  776
            + L +  GRS K KA++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL TQVKP
Sbjct  216  KILFDNTGRS-KSKAVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQVKP  274

Query  775  LIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYA  596
            LIW+E+ +ERHS SR+E+M+KA+SQFK+RSTA NVEI +PVP+DA +P  +TS+G+  YA
Sbjct  275  LIWIESVIERHSHSRVEYMIKAKSQFKKRSTANNVEISIPVPLDADSPKFKTSVGTVKYA  334

Query  595  PEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVR  416
            PEK ++IW IKSF GGKE+++RA F LPS+ +EE+  E + PI VKFEIPYFTVSGIQVR
Sbjct  335  PEKSSIIWTIKSFQGGKEFLMRAHFGLPSVEAEES--ESRPPITVKFEIPYFTVSGIQVR  392

Query  415  YLKIIEKSGYQALPWVRYITMAGEYELR  332
            YLKIIEKSGYQALPWVRYIT  G+Y LR
Sbjct  393  YLKIIEKSGYQALPWVRYITQNGDYSLR  420



>ref|XP_001732521.1| hypothetical protein MGL_0296 [Malassezia globosa CBS 7966]
 gb|EDP45307.1| hypothetical protein MGL_0296 [Malassezia globosa CBS 7966]
Length=439

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E+ GRST+GK+I+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL TQ+KPLI
Sbjct  220  MFESMGRSTRGKSIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQIKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VERH  SRIEFMVK ++QFK RSTA NVEI + VP DA +P  R ++GS +YAPE
Sbjct  280  WAEAVVERHEGSRIEFMVKVKAQFKRRSTANNVEILINVPDDADSPKFRAAIGSVSYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
              A++WKIK   GGKEY++RA F LPS+  EE+   R+ PI VKFEIPYFTVSGIQVRYL
Sbjct  340  LSAMVWKIKQLSGGKEYLMRAHFGLPSVQDEESIV-RRTPINVKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQNGEYDLR  424



>ref|XP_003385149.1| PREDICTED: AP-1 complex subunit mu-1-like [Amphimedon queenslandica]
Length=422

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  955  EFLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKP  776
            + L E  GR T+ KA++L+D+KFHQCVRL+RFENDRTISF+PPDG F+LM+YRL TQVKP
Sbjct  216  KILFENTGR-TRSKAVELEDVKFHQCVRLSRFENDRTISFVPPDGEFELMSYRLNTQVKP  274

Query  775  LIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYA  596
            LIWVE+ +ERHS SR+E+++KA+ QFK RSTA +VEI +PVP DA  P  R + G++TYA
Sbjct  275  LIWVESVIERHSHSRVEYLIKAKGQFKRRSTANDVEILIPVPADADTPRHRCTAGTATYA  334

Query  595  PEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVR  416
            PEK+AL WKIKSFPGGKEY+LRA F LPS+ SEE   E + PI VKFEIPYFT SGIQVR
Sbjct  335  PEKNALSWKIKSFPGGKEYVLRAHFGLPSVQSEEG--EGRPPISVKFEIPYFTTSGIQVR  392

Query  415  YLKIIEKSGYQALPWVRYITMAGEYELR  332
            YLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  393  YLKIIEKSGYQALPWVRYITQNGDYQLR  420



>gb|EYB89248.1| hypothetical protein Y032_0234g3148 [Ancylostoma ceylanicum]
Length=422

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 172/207 (83%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RF+NDRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  218  LFEGSGRG-KSKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGAFELMSYRLTTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  VERHS SR+EFM+KA+SQFK RSTA NVEI +PVP DA +P  +TS+G+  YAPE
Sbjct  277  WIETNVERHSHSRVEFMIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGAVRYAPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IKSFPGGKEY+L A F LPS+  EE   E + PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAFVWTIKSFPGGKEYLLSAHFSLPSVVGEEM--EGRPPIKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEY++R+
Sbjct  395  KIIEKSGYQALPWVRYITQNGEYQMRM  421



>ref|XP_011414129.1| PREDICTED: AP-1 complex subunit mu-1 [Crassostrea gigas]
Length=422

 Score =   312 bits (800),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAP+
Sbjct  277  WVESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIIPVPADADSPKFKTTVGSCKYAPD  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             +A+IW +KSFPGGKEY++RA F LPS+ +EE+  E + PI VKFEIPYFTVSGIQVRYL
Sbjct  337  MNAVIWTVKSFPGGKEYLMRAHFGLPSVIAEES--EGRPPIHVKFEIPYFTVSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_009015103.1| hypothetical protein HELRODRAFT_98900 [Helobdella robusta]
 gb|ESO07007.1| hypothetical protein HELRODRAFT_98900 [Helobdella robusta]
Length=422

 Score =   312 bits (800),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RF+NDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI VPVPVDA +P  +T+ GS  Y+PE
Sbjct  277  WVESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIVPVPVDADSPKFKTTCGSCKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+IW IKSFPGGK+Y++RA F LPS+T+E++  E K PI V FEIPYFTVSG+QVRYL
Sbjct  337  QSAVIWTIKSFPGGKDYLMRAHFGLPSVTAEDS--EGKPPIHVHFEIPYFTVSGVQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_011176465.1| PREDICTED: AP-1 complex subunit mu-1 [Bactrocera cucurbitae]
 ref|XP_011208228.1| PREDICTED: AP-1 complex subunit mu-1 [Bactrocera dorsalis]
 ref|XP_011208229.1| PREDICTED: AP-1 complex subunit mu-1 [Bactrocera dorsalis]
Length=426

 Score =   312 bits (800),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 174/206 (84%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  221  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH  SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  280  WIESVIERHVHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW IKSFPGGKEY++RA F LPS+ SE+   E K PI+V+FEIPYFT SGIQVRYL
Sbjct  340  QNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNN-EGKPPIQVRFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_004518112.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X1 [Ceratitis 
capitata]
 ref|XP_004518113.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X2 [Ceratitis 
capitata]
 ref|XP_004518114.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X3 [Ceratitis 
capitata]
Length=426

 Score =   312 bits (800),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 174/206 (84%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  221  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH  SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  280  WIESVIERHVHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW IKSFPGGKEY++RA F LPS+ SE+   E K PI+V+FEIPYFT SGIQVRYL
Sbjct  340  QNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNN-EGKPPIQVRFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_005181067.1| PREDICTED: AP-1 complex subunit mu-1 [Musca domestica]
 ref|XP_011291494.1| PREDICTED: AP-1 complex subunit mu-1 [Musca domestica]
Length=426

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 174/206 (84%), Gaps = 2/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  221  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH  SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  280  WIESVIERHEHSRVEYMIKAKSQFKRRSTANNVEIIIPVPADADSPKFKTTIGSCKYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW IKSFPGGKEY++RA F LPS+ SE++  E K PI+V FEIPYFT SGIQVRYL
Sbjct  340  QNAVIWTIKSFPGGKEYLMRAHFGLPSVKSEDSL-EGKPPIQVHFEIPYFTTSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  399  KIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_001696311.1| Mu1-Adaptin [Chlamydomonas reinhardtii]
 gb|EDP08288.1| Mu1-Adaptin [Chlamydomonas reinhardtii]
Length=425

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+QGRS+K K+++L+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYR++  +KPLI
Sbjct  218  LFESQGRSSKQKSVELEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRISQNIKPLI  277

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
             V+  VER SRSR E++VKARSQFKERS A  VEI +P+P DA +P+++ S GS+ Y PE
Sbjct  278  MVDCIVERPSRSRTEYLVKARSQFKERSQANTVEIMLPLPADAISPSMKCSQGSAAYVPE  337

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K AL+W IKSFPGGKEY LR  F LPS+ +E+    +  PI+VKFEIP+FTVSG+QVRYL
Sbjct  338  KSALVWTIKSFPGGKEYTLRCHFGLPSVEAEDEGKGKMPPIKVKFEIPFFTVSGVQVRYL  397

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYIT +G YE+R++
Sbjct  398  KVIEKSGYQALPWVRYITTSGNYEIRMI  425



>gb|KDN38638.1| putative clathrin assembly protein AP47 [Tilletiaria anomala 
UBC 951]
Length=440

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E  GR+ +GKAI+++D++FHQCVRLARFENDRTISFIPPDG F+LM+YRL+TQV+PLI
Sbjct  220  MFETTGRTARGKAIEMEDVRFHQCVRLARFENDRTISFIPPDGEFELMSYRLSTQVRPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VERH  SRIEFMVK ++QFK RSTA NVEI +PVP DA +P  R + GS  YAPE
Sbjct  280  WAEAVVERHEGSRIEFMVKVKAQFKRRSTANNVEISIPVPDDADSPKFRAAAGSVHYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
              A++WKIK   GG+E+M+RA F LPS+ ++E   +R+ PI VKFEIPYFTVSGIQVRYL
Sbjct  340  NSAMVWKIKQLGGGREFMMRAHFGLPSVKNDENI-DRRTPISVKFEIPYFTVSGIQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQHGEYDLR  424



>emb|CBJ29677.1| Clathrin assembly complex, medium subunit [Ectocarpus siliculosus]
Length=424

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = -1

Query  955  EFLLEAQGRST-KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVK  779
            + L E+ GRS+   KA++L+DIKFHQCVRLARFENDRTISFIPPDG FDLMTYRLTT VK
Sbjct  215  KLLFESSGRSSGTKKAVELEDIKFHQCVRLARFENDRTISFIPPDGEFDLMTYRLTTHVK  274

Query  778  PLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTY  599
            PLIWVEA VE HS SRIE+M+KA+SQFK RS A NVEI +PVP D  +P  + S+GS  Y
Sbjct  275  PLIWVEAVVEPHSHSRIEYMIKAKSQFKSRSIANNVEIIIPVPNDVDSPTFKASIGSVAY  334

Query  598  APEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQV  419
             P++DA++W IK F G +EY++RA F LPSI++E+   E KAPI+VKFEIPYFTVSGIQV
Sbjct  335  LPDQDAVVWSIKQFNGSQEYLMRAHFGLPSISAEDAR-EWKAPIQVKFEIPYFTVSGIQV  393

Query  418  RYLKIIEKSGYQALPWVRYITMAGEYELRL  329
            RYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  394  RYLKIIEKSGYQALPWVRYITQNGDYQLRM  423



>gb|ESA11631.1| hypothetical protein GLOINDRAFT_96718, partial [Rhizophagus irregularis 
DAOM 181602]
Length=369

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  949  LLEAQGRS-TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            + E+ GRS ++GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL TQVKPL
Sbjct  151  MFESTGRSASRGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQVKPL  210

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE ++ SRIE+M+KA++QFK RSTA NVEI VPVP DA +P  R+S+GS  YAP
Sbjct  211  IWVEALVESYTGSRIEYMIKAKAQFKRRSTANNVEIYVPVPDDADSPKFRSSIGSVHYAP  270

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            EK  L+WKIK F GGKE+++RA F LPS+ + +  P++K PI VKFEIPYFT SGIQVRY
Sbjct  271  EKSCLVWKIKQFQGGKEFLMRAHFGLPSVKNVD-DPDKKPPIGVKFEIPYFTTSGIQVRY  329

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKI+EKSGYQALPWVRYIT  G+Y+LRL
Sbjct  330  LKIVEKSGYQALPWVRYITQNGDYQLRL  357



>gb|KIJ33567.1| hypothetical protein M422DRAFT_183082 [Sphaerobolus stellatus 
SS14]
Length=325

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 170/207 (82%), Gaps = 1/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E+ GR+ +GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+T VKPLI
Sbjct  106  MFESTGRTARGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTPVKPLI  165

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVEAQVE H  SR+E+MVK ++QFK RSTA NVEI VPVP DA +P  R S G+  YAP+
Sbjct  166  WVEAQVESHKGSRVEYMVKVKAQFKRRSTANNVEIYVPVPDDADSPKFRASTGTVQYAPD  225

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A +WKIK   GG+E+++RA F LPS+  EE+   +KAPI VKFEIPYFTVSGIQVRYL
Sbjct  226  KSAFVWKIKQLGGGREFLMRAHFGLPSVKGEESEAAKKAPITVKFEIPYFTVSGIQVRYL  285

Query  409  KIIEKSGYQALPWVRYITMAG-EYELR  332
            KI+EKSGYQALPWVRYIT  G +Y LR
Sbjct  286  KIVEKSGYQALPWVRYITQHGDDYSLR  312



>ref|XP_002411827.1| clathrin coat assembly protein, putative [Ixodes scapularis]
 gb|EEC14244.1| clathrin coat assembly protein, putative [Ixodes scapularis]
Length=448

 Score =   311 bits (797),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 170/197 (86%), Gaps = 2/197 (1%)
 Frame = -1

Query  922  KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLIWVEAQVERH  743
            K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLIW+E+ +ERH
Sbjct  252  KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERH  311

Query  742  SRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPEKDALIWKIK  563
            + SR+E+MVKA+SQFK RSTA NVEI +PVP DA  P  +T++G+  YAPE+ A++W IK
Sbjct  312  AHSRVEYMVKAKSQFKRRSTANNVEIVIPVPTDADTPKFKTTVGNVKYAPEQSAVVWSIK  371

Query  562  SFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYLKIIEKSGYQ  383
            SFPGGKEY++RA F LPS+ SEET  E +API+VKFEIPYFT SGIQVRYLKIIEKSGYQ
Sbjct  372  SFPGGKEYLMRAHFGLPSVESEET--EGRAPIQVKFEIPYFTTSGIQVRYLKIIEKSGYQ  429

Query  382  ALPWVRYITMAGEYELR  332
            ALPWVRYIT  G+Y+LR
Sbjct  430  ALPWVRYITQNGDYQLR  446



>emb|CCV00015.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=439

 Score =   311 bits (796),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E+ GR+++GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL TQ+KPLI
Sbjct  220  MFESTGRTSRGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQIKPLI  279

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VERH  SRIEFMVK ++QFK RSTA NVEI + VP DA +P  R ++GS +YAPE
Sbjct  280  WAEAVVERHEGSRIEFMVKVKAQFKRRSTANNVEILINVPDDADSPKFRAAIGSVSYAPE  339

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
              A++WKIK   GGKEY++RA F LPS+  EE+   R+ PI VKFEIPYFTVSG+QVRYL
Sbjct  340  LSAMVWKIKQLGGGKEYLMRAHFGLPSVRDEESIV-RRTPINVKFEIPYFTVSGVQVRYL  398

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  399  KIVEKSGYQALPWVRYITQNGEYDLR  424



>ref|NP_001251914.1| Protein UNC-101, isoform c [Caenorhabditis elegans]
 emb|CBM41211.1| UNC-101, isoform c [Caenorhabditis elegans]
Length=273

 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 170/207 (82%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RF+ DRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  69   LFEGSGRG-KSKSVELEDVKFHQCVRLSRFDTDRTISFIPPDGAFELMSYRLTTVVKPLI  127

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  +ERHS SR+ F++KA+SQFK RSTA NVEI +PVP DA +P  +TS+GS  Y PE
Sbjct  128  WIETSIERHSHSRVSFIIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGSVKYTPE  187

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IK+FPGGKEY+L A   LPS+ SEE+  E + PI+VKFEIPYFT SGIQVRYL
Sbjct  188  QSAFVWTIKNFPGGKEYLLTAHLSLPSVMSEES--EGRPPIKVKFEIPYFTTSGIQVRYL  245

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEYE+R+
Sbjct  246  KIIEKSGYQALPWVRYITQNGEYEMRM  272



>ref|XP_001661031.1| AAEL010704-PA [Aedes aegypti]
 gb|EAT37288.1| AAEL010704-PA [Aedes aegypti]
Length=422

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 174/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSVKYAPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E++  E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWTIKSFPGGKEYLMRAHFGLPSVECEDS--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>gb|ETN64452.1| clathrin coat assembly protein ap-1 [Anopheles darlingi]
Length=422

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 174/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSVKYAPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E++  E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWTIKSFPGGKEYLMRAHFGLPSVECEDS--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_317947.4| AGAP011374-PA [Anopheles gambiae str. PEST]
 ref|XP_001868211.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EAA13067.4| AGAP011374-PA [Anopheles gambiae str. PEST]
 gb|EDS26337.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|KFB51883.1| AGAP011374-PA-like protein [Anopheles sinensis]
Length=422

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 174/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSVKYAPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E++  E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWTIKSFPGGKEYLMRAHFGLPSVECEDS--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_008560877.1| PREDICTED: AP-1 complex subunit mu-1 [Microplitis demolitor]
Length=422

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWSIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_009039824.1| hypothetical protein AURANDRAFT_72236 [Aureococcus anophagefferens]
 gb|EGB05442.1| hypothetical protein AURANDRAFT_72236 [Aureococcus anophagefferens]
Length=424

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 178/212 (84%), Gaps = 4/212 (2%)
 Frame = -1

Query  955  EFLLEAQGR-STKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVK  779
            + + EA GR  T+GKA++L+DIKFHQCVRLARFENDRTISFIPPDG FDLMTYRL+T VK
Sbjct  215  KLMFEATGRPMTRGKAVELEDIKFHQCVRLARFENDRTISFIPPDGEFDLMTYRLSTHVK  274

Query  778  PLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTY  599
            PLIWVEA VE HS SRIE+M+KA+SQFK RS A NV+I +PVP D  +P+ ++S+G+ TY
Sbjct  275  PLIWVEAVVEPHSHSRIEYMIKAKSQFKSRSVANNVDIIIPVPHDVDSPSFKSSIGTVTY  334

Query  598  APEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPER-KAPIRVKFEIPYFTVSGIQ  422
             P+++ ++W IK F G +EY++RA F LPS++SE+  PE  KAPI VKFEIPYFTVSGIQ
Sbjct  335  LPDRNVIVWSIKQFNGAREYLMRAHFGLPSVSSED--PEHWKAPIEVKFEIPYFTVSGIQ  392

Query  421  VRYLKIIEKSGYQALPWVRYITMAGEYELRLM  326
            VRYLKIIEKSGYQALPWVRYIT  G+Y+LR++
Sbjct  393  VRYLKIIEKSGYQALPWVRYITQNGDYQLRMV  424



>ref|XP_002945806.1| hypothetical protein VOLCADRAFT_108841 [Volvox carteri f. nagariensis]
 gb|EFJ52801.1| hypothetical protein VOLCADRAFT_108841 [Volvox carteri f. nagariensis]
Length=425

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+QGRS+K KA++L+DIKFHQCVRLARFENDRTISFIPPDG+FDLMTYR++  +KPLI
Sbjct  218  LFESQGRSSKQKAVELEDIKFHQCVRLARFENDRTISFIPPDGAFDLMTYRISQNIKPLI  277

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
             V+  VE+ SRSR E++VKARSQFKERS A  VEI +P+P DA +P ++ + GS+ Y PE
Sbjct  278  MVDCIVEKPSRSRTEYLVKARSQFKERSQANTVEIMLPLPADAISPTMKCTQGSAAYVPE  337

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K AL+W IKSFPGGKEY LR  F LPS+ +E+    +  PI+VKFEIP+FTVSG+QVRYL
Sbjct  338  KSALVWTIKSFPGGKEYSLRCHFGLPSVEAEDEGKGKMPPIKVKFEIPFFTVSGVQVRYL  397

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            K+IEKSGYQALPWVRYIT +G YE+R++
Sbjct  398  KVIEKSGYQALPWVRYITTSGNYEIRMV  425



>gb|ELT98131.1| hypothetical protein CAPTEDRAFT_178783 [Capitella teleta]
Length=422

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KF+QCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFNQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE+ +ERH+ SRIEFM+KA+SQFK RSTA NVEI V VP DA  P  +T+ GS  YAP+
Sbjct  277  WVESVIERHAHSRIEFMIKAKSQFKRRSTANNVEIVVTVPTDADCPKFKTTAGSCRYAPD  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+IW IKSFPGGKEY++RA F LPS+ +E+   E KAPI V+FEIPYFTVSGIQVRYL
Sbjct  337  QNAMIWTIKSFPGGKEYLMRAHFGLPSVVNEDL--EGKAPIHVRFEIPYFTVSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_005110316.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X1 [Aplysia 
californica]
 ref|XP_005110317.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X2 [Aplysia 
californica]
 ref|XP_005110318.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X3 [Aplysia 
californica]
Length=422

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  Y PE
Sbjct  277  WVESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIIPVPNDADSPKFKTTVGSCKYVPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
             + ++W IKSFPGGKEY++RA F LPS+ +EE   E K PI VKFEIPYFTVSGIQVRYL
Sbjct  337  INCVVWTIKSFPGGKEYLMRAHFGLPSVMNEEI--EGKPPINVKFEIPYFTVSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_002179260.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49083.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=439

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 174/219 (79%), Gaps = 10/219 (5%)
 Frame = -1

Query  955  EFLLEAQGRST--KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQV  782
            + + EA GR+   KGKA++L+DIKFHQCVRLARFENDRTISFIPPDG FDLMTYRL T V
Sbjct  220  KLMFEATGRANQAKGKAVELEDIKFHQCVRLARFENDRTISFIPPDGEFDLMTYRLNTHV  279

Query  781  KPLIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSST  602
            KPLIWVEA VE H  SRIE+M+K RSQFK RS A NVEI +PVP D  +P+ + S+GS +
Sbjct  280  KPLIWVEAVVEPHKGSRIEYMIKTRSQFKSRSVANNVEIIIPVPPDVDSPSFKCSVGSVS  339

Query  601  YAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPER--------KAPIRVKFEIP  446
            Y P+KD+ +W IK F GG+EY++RA F LPSI++ +  PE         KAPIRV+FEIP
Sbjct  340  YLPDKDSAVWTIKQFHGGREYLMRAHFGLPSISASDIDPEAKKKGDNAWKAPIRVQFEIP  399

Query  445  YFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  329
            YFTVSGIQVRYLKIIE+SGYQALPWVRYIT  G+Y+LR+
Sbjct  400  YFTVSGIQVRYLKIIERSGYQALPWVRYITANGDYQLRM  438



>ref|XP_003428199.1| PREDICTED: AP-1 complex subunit mu-1 [Nasonia vitripennis]
Length=422

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWSIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_011498712.1| PREDICTED: AP-1 complex subunit mu-1 [Ceratosolen solmsi marchali]
Length=422

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWSIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>gb|EXX50896.1| Apm1p [Rhizophagus irregularis DAOM 197198w]
Length=436

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  949  LLEAQGRS-TKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            + E+ GRS ++GKAI+++D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL TQVKPL
Sbjct  218  MFESTGRSASRGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQVKPL  277

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVEA VE ++ SRIE+M+KA++QFK RSTA NVEI VPVP DA +P  R+S+GS  YAP
Sbjct  278  IWVEALVESYTGSRIEYMIKAKAQFKRRSTANNVEIYVPVPDDADSPKFRSSIGSVHYAP  337

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            EK  L+WKIK F GGKE+++RA F LPS+ + +  P++K PI VKFEIPYFT SGIQVRY
Sbjct  338  EKSCLVWKIKQFQGGKEFLMRAHFGLPSVKNVD-DPDKKPPIGVKFEIPYFTTSGIQVRY  396

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKI+EKSGYQALPWVRYIT  G+Y+LRL
Sbjct  397  LKIVEKSGYQALPWVRYITQNGDYQLRL  424



>ref|XP_001942784.1| PREDICTED: AP-1 complex subunit mu-1 [Acyrthosiphon pisum]
Length=422

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 176/206 (85%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG FDLMTYRL+T +KPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFDLMTYRLSTHIKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E++VKA+SQFK RSTA NVE+ + VP+DA +P  +T++GS  Y PE
Sbjct  277  WIESVIERHAHSRVEYIVKAKSQFKRRSTANNVEVVIQVPMDADSPKFKTTVGSVKYMPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +++L+W IKSFPGGKEY++RA F LPS+ +EET  E + PI+V+FEIPYFT SGIQVRYL
Sbjct  337  QNSLVWSIKSFPGGKEYLMRAHFGLPSVENEET--EGRPPIQVRFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_002113923.1| hypothetical protein TRIADDRAFT_50452 [Trichoplax adhaerens]
 gb|EDV23013.1| hypothetical protein TRIADDRAFT_50452 [Trichoplax adhaerens]
Length=423

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR T+ KA+DL+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL+TQ+KPL+
Sbjct  219  LFENTGR-TRSKAVDLEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTQIKPLV  277

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+EA +ERHS SR+E+M+KARSQFK RSTA NV I VPVP DA +P  + ++G+  YAPE
Sbjct  278  WIEAVIERHSHSRVEYMIKARSQFKRRSTANNVIIRVPVPPDADSPKFKANVGAVRYAPE  337

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+ ++W IKSFPGGKE+++RA F LPSI  EE   +R+ PIRV+FEIPYFT SGIQVRYL
Sbjct  338  KNEILWSIKSFPGGKEFLMRAHFGLPSIEGEEA--DRRPPIRVEFEIPYFTTSGIQVRYL  395

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KI+EK GYQALPWVRYIT  G+Y++R
Sbjct  396  KIVEKGGYQALPWVRYITKNGDYQVR  421



>gb|EHJ64804.1| hypothetical protein KGM_02865 [Danaus plexippus]
Length=422

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  Y PE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIIPVPADADSPKFKTTIGSVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E+T  + K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWSIKSFPGGKEYLMRAHFGLPSVECEDT--DGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_011303754.1| PREDICTED: AP-1 complex subunit mu-1 [Fopius arisanus]
Length=422

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVRYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWSIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_003398021.1| PREDICTED: AP-1 complex subunit mu-1-like [Bombus terrestris]
Length=422

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  RT++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFRTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWFIKSFPGGKEYLMRAHFGLPSVIGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>emb|CBY41102.1| unnamed protein product [Oikopleura dioica]
Length=425

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 174/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  955  EFLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKP  776
            + L E  GRS K K+++LDD+KFHQCVRL+RF+NDRTISFIPPDG F+LM+YRL TQ+KP
Sbjct  218  KILFETTGRSKK-KSVELDDVKFHQCVRLSRFDNDRTISFIPPDGEFELMSYRLQTQIKP  276

Query  775  LIWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYA  596
            LIWVE+ +E+H+ SR+E MVKARSQFK RSTA NVEI VPVP DA +P  R++ G+  + 
Sbjct  277  LIWVESHIEKHAHSRVEIMVKARSQFKRRSTANNVEIIVPVPSDADSPKFRSTTGTCKWL  336

Query  595  PEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVR  416
            PEK A+ W+IKSFPGGKE+++RA F LPS+ S+E   E K PI+VKFEIPYFTVSGIQVR
Sbjct  337  PEKSAVSWQIKSFPGGKEFLMRASFGLPSVESDEI--EGKPPIQVKFEIPYFTVSGIQVR  394

Query  415  YLKIIEKSGYQALPWVRYITMAGEYELR  332
            YLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  YLKIIEKSGYQALPWVRYITQNGDYQLR  422



>ref|XP_002423855.1| clathrin coat assembly protein ap-1, putative [Pediculus humanus 
corporis]
 gb|EEB11117.1| clathrin coat assembly protein ap-1, putative [Pediculus humanus 
corporis]
Length=437

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  233  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  291

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH  SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  292  WIESVIERHVHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTVGSVKYAPE  351

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E++  E K PI+VKFEIPYFT SGIQVRYL
Sbjct  352  QNAITWTIKSFPGGKEYLMRAHFGLPSVEGEDS--EGKPPIQVKFEIPYFTTSGIQVRYL  409

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  410  KIIEKSGYQALPWVRYITQNGDYQLR  435



>gb|EGI59321.1| AP-1 complex subunit mu-1 [Acromyrmex echinatior]
Length=383

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  179  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  237

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  238  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  297

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  298  QSAITWIIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  355

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  356  KIIEKSGYQALPWVRYITQNGDYQLR  381



>ref|XP_003484471.1| PREDICTED: AP-1 complex subunit mu-1-like [Bombus impatiens]
Length=422

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  RT++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFRTTVGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWFIKSFPGGKEYLMRAHFGLPSVIGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_011863908.1| PREDICTED: AP-1 complex subunit mu-1 [Vollenhovia emeryi]
Length=422

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWIIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_004923800.1| PREDICTED: AP-1 complex subunit mu-1-like [Bombyx mori]
Length=422

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  Y PE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIIPVPADADSPKFKTTIGSVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  EE   + K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWSIKSFPGGKEYLMRAHFGLPSVECEEV--DGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_004365235.1| AP-1 complex subunit mu-1 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE88774.1| AP-1 complex subunit mu-1 [Capsaspora owczarzaki ATCC 30864]
Length=424

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 175/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  949  LLEAQGRST-KGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            L EA GR+  K KA++L+D+KFHQCVRL+RFENDRTISF+PPDG F+LM+YRL+T VKPL
Sbjct  218  LFEATGRTAGKAKAVELEDVKFHQCVRLSRFENDRTISFVPPDGEFELMSYRLSTAVKPL  277

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IW+EA VERHS SR+E+++KA+SQFK RS A NV+I +PVP DA +P  +T++G+ TY+P
Sbjct  278  IWIEAVVERHSHSRVEYLIKAKSQFKRRSIANNVDIVIPVPSDADSPKFKTTIGTVTYSP  337

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            EK+A++W IK FPGGKE+++RA F LPSI +E+   E + PI VKFEIPYFT SGIQVRY
Sbjct  338  EKNAIVWNIKQFPGGKEFLMRAHFGLPSIDAEDQ--EGRPPISVKFEIPYFTTSGIQVRY  395

Query  412  LKIIEKSGYQALPWVRYITMAGEYELRL  329
            LKIIE SGYQALPWVRYIT  G+Y+LR+
Sbjct  396  LKIIENSGYQALPWVRYITQNGDYQLRM  423



>ref|XP_011169377.1| PREDICTED: AP-1 complex subunit mu-1-like [Solenopsis invicta]
 gb|EFZ11942.1| hypothetical protein SINV_00609, partial [Solenopsis invicta]
Length=422

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWIIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>dbj|BAM18015.1| clathrin coat assembly protein ap-1 [Papilio xuthus]
Length=422

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  Y PE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIIPVPADADSPKFKTTIGSVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  EE   + K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWSIKSFPGGKEYLMRAHFGLPSVECEEV--DGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_003484470.1| PREDICTED: AP-1 complex subunit mu-1-like [Bombus impatiens]
Length=422

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+MVKARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMVKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWFIKSFPGGKEYLMRAHFGLPSVIGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_011690741.1| PREDICTED: AP-1 complex subunit mu-1 [Wasmannia auropunctata]
 ref|XP_011690742.1| PREDICTED: AP-1 complex subunit mu-1 [Wasmannia auropunctata]
Length=422

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWIIKSFPGGKEYLMRAHFGLPSVVGEDA--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_012061450.1| PREDICTED: AP-1 complex subunit mu-1 [Atta cephalotes]
Length=422

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWIIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_011332351.1| PREDICTED: AP-1 complex subunit mu-1 [Cerapachys biroi]
 gb|EZA58320.1| AP-1 complex subunit mu-1 [Cerapachys biroi]
Length=422

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWIIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_003249906.1| PREDICTED: AP-1 complex subunit mu-1-like isoform 1 [Apis mellifera]
 ref|XP_003690371.1| PREDICTED: AP-1 complex subunit mu-1-like isoform 1 [Apis florea]
 ref|XP_006607941.1| PREDICTED: AP-1 complex subunit mu-1-like [Apis dorsata]
Length=422

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWFIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_011141637.1| PREDICTED: AP-1 complex subunit mu-1 [Harpegnathos saltator]
 ref|XP_011141638.1| PREDICTED: AP-1 complex subunit mu-1 [Harpegnathos saltator]
 ref|XP_011141639.1| PREDICTED: AP-1 complex subunit mu-1 [Harpegnathos saltator]
 ref|XP_011141641.1| PREDICTED: AP-1 complex subunit mu-1 [Harpegnathos saltator]
 ref|XP_011261115.1| PREDICTED: AP-1 complex subunit mu-1 [Camponotus floridanus]
 ref|XP_011646206.1| PREDICTED: AP-1 complex subunit mu-1 [Pogonomyrmex barbatus]
 gb|EFN65114.1| AP-1 complex subunit mu-1 [Camponotus floridanus]
 gb|EFN83071.1| AP-1 complex subunit mu-1 [Harpegnathos saltator]
Length=422

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWIIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>gb|EFO28029.2| AP-1 complex subunit mu-1-I [Loa loa]
Length=396

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 174/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K ++++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  192  LFESSGRG-KNRSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLMTVVKPLI  250

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+EA VERHS SRIE+M+KA+SQFK RSTA NVEI +PVP DA +P  +TS+G+  Y PE
Sbjct  251  WMEAVVERHSHSRIEYMIKAKSQFKRRSTANNVEIIIPVPSDADSPIFKTSIGTVKYMPE  310

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +++ +W IKSFPGGKEY++RA F LPS+  E+   E + P++VKFEIPYFT SGIQVRYL
Sbjct  311  QNSFVWTIKSFPGGKEYLMRAHFNLPSVQCEDR--EGRPPMKVKFEIPYFTTSGIQVRYL  368

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYIT  G+Y+LR+M
Sbjct  369  KIIEKSGYQALPWVRYITQNGDYQLRMM  396



>gb|AEE62403.1| unknown [Dendroctonus ponderosae]
 gb|ENN79999.1| hypothetical protein YQE_03560, partial [Dendroctonus ponderosae]
 gb|ERL93769.1| hypothetical protein D910_11055 [Dendroctonus ponderosae]
Length=422

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFE DRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFEIDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPQDADSPKFKTTIGSVKYAPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E+T  E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWTIKSFPGGKEYLMRAHFGLPSVECEDT--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_011064332.1| PREDICTED: LOW QUALITY PROTEIN: AP-1 complex subunit mu-1 [Acromyrmex 
echinatior]
Length=431

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  227  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  285

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  286  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  345

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  346  QSAITWIIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  403

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  404  KIIEKSGYQALPWVRYITQNGDYQLR  429



>ref|XP_003700057.1| PREDICTED: AP-1 complex subunit mu-1 [Megachile rotundata]
Length=422

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  277  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAITWFIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_009043800.1| hypothetical protein LOTGIDRAFT_205544 [Lottia gigantea]
 gb|ESP05255.1| hypothetical protein LOTGIDRAFT_205544 [Lottia gigantea]
Length=422

 Score =   307 bits (787),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 174/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            WVE+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++G+  Y PE
Sbjct  277  WVESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIIPVPTDADSPKFKTTVGNCRYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
              ++IW IKSFPGGKEY++RA F LPS+ +E++  E + PI+VKFEIPYFTVSGIQVRYL
Sbjct  337  ISSVIWSIKSFPGGKEYLMRAHFGLPSVETEDS--EGRPPIQVKFEIPYFTVSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>gb|ACO12360.1| AP-1 complex subunit mu-1 [Lepeophtheirus salmonis]
Length=423

 Score =   307 bits (787),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 171/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RF+NDRTISFIPPDG F+LM+YRLTT VKPLI
Sbjct  219  LFESTGRG-KSKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGEFELMSYRLTTHVKPLI  277

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+MVKA+SQFK RSTA NVEI +PVP DA +P  +T+ G   Y PE
Sbjct  278  WIESVIERHAHSRVEYMVKAKSQFKRRSTANNVEIVIPVPNDADSPKFKTTSGHCKYVPE  337

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + ++IW IKSFPGGKEY++RA F LPS+ SE T  E K PI VKFEIPYFT SGIQVRYL
Sbjct  338  QSSIIWTIKSFPGGKEYLMRAHFGLPSVESELT--EGKPPIHVKFEIPYFTTSGIQVRYL  395

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  396  KIIEKSGYQALPWVRYITQNGDYQLR  421



>ref|XP_011562253.1| PREDICTED: AP-1 complex subunit mu-1 [Plutella xylostella]
Length=422

 Score =   307 bits (787),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  Y PE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIIIPVPADADSPKFKTTIGSVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E+   + K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWSIKSFPGGKEYLMRAHFGLPSVECEDV--DGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>gb|EGT35242.1| hypothetical protein CAEBREN_14107 [Caenorhabditis brenneri]
 gb|EGT36897.1| hypothetical protein CAEBREN_08328 [Caenorhabditis brenneri]
Length=422

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 170/207 (82%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RF+ DRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  218  LFEGSGRG-KSKSVELEDVKFHQCVRLSRFDTDRTISFIPPDGAFELMSYRLTTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  +ERHS SR+ F++KA+SQFK RSTA NVEI +PVP DA +P  +TS+GS  Y PE
Sbjct  277  WIETSIERHSHSRVSFIIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGSVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IKSFPGGKEY+L A   LPS+ SEE+  E + PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAFVWTIKSFPGGKEYLLTAHLSLPSVMSEES--EGRPPIKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEYE+R+
Sbjct  395  KIIEKSGYQALPWVRYITQNGEYEMRM  421



>ref|XP_003097680.1| CRE-UNC-101 protein [Caenorhabditis remanei]
 gb|EFO83750.1| CRE-UNC-101 protein [Caenorhabditis remanei]
Length=422

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 170/207 (82%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RF+ DRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  218  LFEGSGRG-KSKSVELEDVKFHQCVRLSRFDTDRTISFIPPDGAFELMSYRLTTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  +ERHS SR+ F++KA+SQFK RSTA NVEI +PVP DA +P  +TS+GS  Y PE
Sbjct  277  WIETSIERHSHSRVSFIIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGSVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IKSFPGGKEY+L A   LPS+ SEE+  E + PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAFVWTIKSFPGGKEYLLTAHLSLPSVMSEES--EGRPPIKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEYE+R+
Sbjct  395  KIIEKSGYQALPWVRYITQNGEYEMRM  421



>ref|XP_002640613.1| Hypothetical protein CBG08724 [Caenorhabditis briggsae]
 emb|CAP28502.1| Protein CBG08724 [Caenorhabditis briggsae]
Length=422

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 170/207 (82%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RF+ DRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  218  LFEGSGRG-KSKSVELEDVKFHQCVRLSRFDTDRTISFIPPDGAFELMSYRLTTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  +ERHS SR+ F++KA+SQFK RSTA NVEI +PVP DA +P  +TS+GS  Y PE
Sbjct  277  WIETSIERHSHSRVSFIIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGSVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IKSFPGGKEY+L A   LPS+ SEE+  E + PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAFVWTIKSFPGGKEYLLTAHLSLPSVMSEES--EGRPPIKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEYE+R+
Sbjct  395  KIIEKSGYQALPWVRYITQNGEYEMRM  421



>ref|NP_001006851.1| adaptor-related protein complex 1, mu 2 subunit [Xenopus (Silurana) 
tropicalis]
 gb|AAH76939.1| adaptor-related protein complex 1, mu 1 subunit [Xenopus (Silurana) 
tropicalis]
Length=423

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR+ K K ++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL TQVKPLI
Sbjct  219  LFELTGRN-KNKTVELEDVKFHQCVRLSRFENDRTISFIPPDGDFELMSYRLNTQVKPLI  277

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +E+ S SR+E MVKA+ QFK++S A NVEI VPVP DA +P  +TS+GS+ Y PE
Sbjct  278  WIESVIEKFSHSRLEIMVKAKGQFKKQSVANNVEISVPVPSDADSPKFKTSVGSAKYVPE  337

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+ +IW IKSFPGGKEY++RA F LPS+ +EE   E K PI VKFEIPYFTVSGIQVRY+
Sbjct  338  KNVVIWTIKSFPGGKEYLMRAHFGLPSVETEEL--EGKPPISVKFEIPYFTVSGIQVRYM  395

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  396  KIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_003136033.1| AP-1 complex subunit mu-1 [Loa loa]
Length=422

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 174/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K ++++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESSGRG-KNRSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLMTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+EA VERHS SRIE+M+KA+SQFK RSTA NVEI +PVP DA +P  +TS+G+  Y PE
Sbjct  277  WMEAVVERHSHSRIEYMIKAKSQFKRRSTANNVEIIIPVPSDADSPIFKTSIGTVKYMPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +++ +W IKSFPGGKEY++RA F LPS+  E+   E + P++VKFEIPYFT SGIQVRYL
Sbjct  337  QNSFVWTIKSFPGGKEYLMRAHFNLPSVQCEDR--EGRPPMKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYIT  G+Y+LR+M
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLRMM  422



>emb|CDP94008.1| Protein Bm13789, isoform c [Brugia malayi]
Length=422

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 174/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K ++++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESSGRG-KNRSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLMTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+EA VERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +TS+G+  Y PE
Sbjct  277  WMEAVVERHTHSRVEYMIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGTVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            +++ +W IKSFPGGKEY++RA F LPS+  E+   E + P++VKFEIPYFT SGIQVRYL
Sbjct  337  QNSFVWTIKSFPGGKEYLMRAHFNLPSVQCEDR--EGRPPMKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRLM  326
            KIIEKSGYQALPWVRYIT  G+Y+LR+M
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLRMM  422



>ref|XP_968639.1| PREDICTED: AP-1 complex subunit mu-1 [Tribolium castaneum]
 gb|EFA12022.1| hypothetical protein TcasGA2_TC001437 [Tribolium castaneum]
Length=422

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFE DRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFESTGRG-KSKSVELEDVKFHQCVRLSRFEIDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  YAPE
Sbjct  277  WIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPHDADSPKFKTTIGSVKYAPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            ++A+ W IKSFPGGKEY++RA F LPS+  E+T  E K PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QNAITWTIKSFPGGKEYLMRAHFGLPSVECEDT--EGKPPIQVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_003889932.1| AP-1 complex subunit mu-1 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 gb|EHS63225.1| AP-1 complex subunit mu-1 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
Length=321

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 171/207 (83%), Gaps = 2/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            + E+ GR+++GKAI+++D KFHQCVRL+RFENDRTISFIPPDG F+LM+YR+ TQVKPLI
Sbjct  102  MFESTGRTSRGKAIEMEDTKFHQCVRLSRFENDRTISFIPPDGEFELMSYRINTQVKPLI  161

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W EA VE HS SR+E+MVKA++QFK RSTA NVEI VPVP DA +P  R S+G+  Y PE
Sbjct  162  WAEAMVELHSNSRVEYMVKAKAQFKRRSTANNVEIYVPVPDDADSPRFRASVGTVHYVPE  221

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K A +WKIK   GG+EY++RA+F LPS+ SE+   E++ PI +KFEIPYFTVSGIQVRYL
Sbjct  222  KSAFVWKIKQLGGGREYLMRAQFGLPSVRSEDVI-EKRPPITIKFEIPYFTVSGIQVRYL  280

Query  409  KIIEKSGYQALPWVRYITMAG-EYELR  332
            KI+EKSGYQALPWVRYIT  G +Y LR
Sbjct  281  KIVEKSGYQALPWVRYITQHGDDYSLR  307



>gb|EDL78305.1| rCG31866, isoform CRA_b [Rattus norvegicus]
Length=330

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GRS K K+++L+D+KFHQCVRL+RF+NDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  126  LFELTGRS-KNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLI  184

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +E+ S SR+E MVKA+ QFK++S A  VEI VPVP DA +P  +TS+GS+ Y PE
Sbjct  185  WIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPE  244

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPYFTVSGIQVRY+
Sbjct  245  KNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPYFTVSGIQVRYM  302

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  303  KIIEKSGYQALPWVRYITQSGDYQLR  328



>ref|XP_007433201.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X2 [Python 
bivittatus]
Length=348

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 170/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L +  GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  144  LFDNTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  202

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +E+HS SRIE+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  + PE
Sbjct  203  WIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPE  262

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
              A++W IKSFPGGKEY++RA F LPS+ +E+   E K PI VKFEIPYFT SGIQVRYL
Sbjct  263  NSAIVWSIKSFPGGKEYLMRAHFGLPSVEAEDK--EGKPPISVKFEIPYFTTSGIQVRYL  320

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  321  KIIEKSGYQALPWVRYITQNGDYQLR  346



>ref|XP_003690372.1| PREDICTED: AP-1 complex subunit mu-1-like isoform 2 [Apis florea]
Length=469

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E+ GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  265  LFESTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  323

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERH+ SR+E+M+KARSQFK RSTA NVEI +PVP DA +P  +T++GS  Y+PE
Sbjct  324  WIESVIERHAHSRVEYMIKARSQFKRRSTANNVEIVIPVPNDADSPKFKTTIGSVKYSPE  383

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A+ W IKSFPGGKEY++RA F LPS+  E+   E K PI+VKFEIPYFT SGIQVRYL
Sbjct  384  QSAITWFIKSFPGGKEYLMRAHFGLPSVVGEDV--EGKPPIQVKFEIPYFTTSGIQVRYL  441

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  442  KIIEKSGYQALPWVRYITQNGDYQLR  467



>pdb|4EN2|M Chain M, Hiv-1 Nef In Complex With Mhc-I Cytoplasmic Domain And 
Mu1 Adaptin Subunit Of Ap1 Adaptor (Second Domain)
 pdb|4EN2|A Chain A, Hiv-1 Nef In Complex With Mhc-I Cytoplasmic Domain And 
Mu1 Adaptin Subunit Of Ap1 Adaptor (Second Domain)
Length=266

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 169/206 (82%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L +  GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  62   LFDNTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  120

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +E+HS SRIE+MVKA+SQFK RSTA NVEI +PVP DA +P  +T++GS  + PE
Sbjct  121  WIESVIEKHSHSRIEYMVKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPE  180

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
               ++W +KSFPGGKEY++RA F LPS+ +E+   E K PI VKFEIPYFT SGIQVRYL
Sbjct  181  NSEIVWSVKSFPGGKEYLMRAHFGLPSVEAEDK--EGKPPISVKFEIPYFTTSGIQVRYL  238

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  239  KIIEKSGYQALPWVRYITQNGDYQLR  264



>ref|XP_007433202.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X3 [Python 
bivittatus]
Length=336

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 170/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L +  GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  132  LFDNTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  190

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +E+HS SRIE+M+KA+SQFK RSTA NVEI +PVP DA +P  +T++GS  + PE
Sbjct  191  WIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPE  250

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
              A++W IKSFPGGKEY++RA F LPS+ +E+   E K PI VKFEIPYFT SGIQVRYL
Sbjct  251  NSAIVWSIKSFPGGKEYLMRAHFGLPSVEAEDK--EGKPPISVKFEIPYFTTSGIQVRYL  308

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  309  KIIEKSGYQALPWVRYITQNGDYQLR  334



>ref|NP_001040675.1| Protein UNC-101, isoform a [Caenorhabditis elegans]
 sp|P35602.2|AP1M_CAEEL RecName: Full=AP-1 complex subunit mu-1-I; AltName: Full=Clathrin 
assembly protein complex 1 mu-1-I medium chain; AltName: 
Full=Clathrin coat assembly protein AP47; AltName: Full=Clathrin 
coat-associated protein AP47; AltName: Full=Golgi adaptor 
AP-1 47 kDa protein; AltName: Full=HA1 47 kDa subunit; 
AltName: Full=Mu1-I-adaptin; AltName: Full=Uncoordinated protein 
101 [Caenorhabditis elegans]
 emb|CAB05557.3| UNC-101, isoform a [Caenorhabditis elegans]
Length=422

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 170/207 (82%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RF+ DRTISFIPPDG+F+LM+YRLTT VKPLI
Sbjct  218  LFEGSGRG-KSKSVELEDVKFHQCVRLSRFDTDRTISFIPPDGAFELMSYRLTTVVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E  +ERHS SR+ F++KA+SQFK RSTA NVEI +PVP DA +P  +TS+GS  Y PE
Sbjct  277  WIETSIERHSHSRVSFIIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGSVKYTPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            + A +W IK+FPGGKEY+L A   LPS+ SEE+  E + PI+VKFEIPYFT SGIQVRYL
Sbjct  337  QSAFVWTIKNFPGGKEYLLTAHLSLPSVMSEES--EGRPPIKVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  GEYE+R+
Sbjct  395  KIIEKSGYQALPWVRYITQNGEYEMRM  421



>gb|KDD76988.1| adaptor complexes medium subunit domain-containing protein, partial 
[Helicosporidium sp. ATCC 50920]
Length=871

 Score =   318 bits (814),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  949  LLEAQGRSTKG-KAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPL  773
            L E+QGR  +G KA+DL+DIKFHQCVRLA FE DRTISF+PPDG+FDLMTYRL+  VKPL
Sbjct  219  LFESQGRQGRGQKAVDLEDIKFHQCVRLALFERDRTISFVPPDGAFDLMTYRLSQNVKPL  278

Query  772  IWVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAP  593
            IWVE   ERHSRSR E++VKARSQFKERS+A +VEI +P+P DA +P  RTS G++TYAP
Sbjct  279  IWVECVAERHSRSRTEYLVKARSQFKERSSATSVEITLPIPPDAISPVARTSQGTATYAP  338

Query  592  EKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRY  413
            EK+A++WKIK+FPG +E++LR +F LPS+ +EE    R  PI+VKFE+PYFT+SGIQ+RY
Sbjct  339  EKEAIVWKIKNFPGNREFLLRCKFGLPSVQAEEEVHGRMPPIKVKFEVPYFTISGIQIRY  398

Query  412  LKIIEKSGYQALPWVRYITMAGEYELR  332
            LK+IE+SGYQALPWVRYIT AG+YE+R
Sbjct  399  LKVIERSGYQALPWVRYITTAGDYEIR  425



>ref|XP_008561429.1| PREDICTED: AP-1 complex subunit mu-2 [Galeopterus variegatus]
Length=359

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GRS K K+++L+D+KFHQCVRL+RF+NDRTISFIPPDG F+LM+YRL+TQVKPLI
Sbjct  155  LFELTGRS-KNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLI  213

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +E+ S SR+E MVKA+ QFK++S A +VEI VPVP DA +P  +TS+GS+ Y PE
Sbjct  214  WIESVIEKFSHSRVEIMVKAKGQFKKQSVANSVEISVPVPSDADSPRFKTSVGSAKYVPE  273

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPYFTVSGIQVRY+
Sbjct  274  KNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPYFTVSGIQVRYM  331

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  332  KIIEKSGYQALPWVRYITQSGDYQLR  357



>ref|NP_001084934.1| uncharacterized protein LOC431991 [Xenopus laevis]
 gb|AAH70627.1| MGC81419 protein [Xenopus laevis]
Length=423

 Score =   305 bits (782),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 171/206 (83%), Gaps = 3/206 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR+ K K ++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL TQVKPLI
Sbjct  219  LFELSGRN-KNKTVELEDVKFHQCVRLSRFENDRTISFIPPDGDFELMSYRLNTQVKPLI  277

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +E+ S SR+E MVKA+ QFK++S A NVEI VPVP DA +P  +TS+GS+ Y PE
Sbjct  278  WIESVIEKFSHSRLEIMVKAKGQFKKQSVANNVEIYVPVPSDADSPKFKTSVGSAKYVPE  337

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+ ++W IKSFPGGKEY++RA F LPS+  EE   E K PI VKFEIPYFTVSGIQVRY+
Sbjct  338  KNVVVWTIKSFPGGKEYLMRAHFGLPSVEREEV--EGKPPISVKFEIPYFTVSGIQVRYM  395

Query  409  KIIEKSGYQALPWVRYITMAGEYELR  332
            KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  396  KIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_789616.3| PREDICTED: AP-1 complex subunit mu-1 isoform X2 [Strongylocentrotus 
purpuratus]
 ref|XP_011676191.1| PREDICTED: AP-1 complex subunit mu-1 isoform X1 [Strongylocentrotus 
purpuratus]
Length=422

 Score =   305 bits (782),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 173/207 (84%), Gaps = 3/207 (1%)
 Frame = -1

Query  949  LLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLTTQVKPLI  770
            L E  GR  K K+++L+D+KFHQCVRL+RFENDRTISFIPPDG F+LM+YRL T VKPLI
Sbjct  218  LFENTGRG-KSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLI  276

Query  769  WVEAQVERHSRSRIEFMVKARSQFKERSTAGNVEIEVPVPVDATNPNVRTSMGSSTYAPE  590
            W+E+ +ERHS SR+E+M+KA+SQFK RSTA NV++ +PVP DA +P  +T++G + Y PE
Sbjct  277  WIESVIERHSHSRVEYMIKAKSQFKRRSTANNVDVIIPVPSDADSPKFKTTVGFAKYMPE  336

Query  589  KDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTVSGIQVRYL  410
            K+A++W IKSFPGGKE+++RA F LPS+ +EE   E + PI VKFEIPYFT SGIQVRYL
Sbjct  337  KNAVVWHIKSFPGGKEFLMRAHFNLPSVQAEEA--EGRPPISVKFEIPYFTTSGIQVRYL  394

Query  409  KIIEKSGYQALPWVRYITMAGEYELRL  329
            KIIEKSGYQALPWVRYIT  G+Y++R+
Sbjct  395  KIIEKSGYQALPWVRYITQNGDYQVRV  421



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2393765068816