BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5366

Length=824
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354376.1|  PREDICTED: uncharacterized protein LOC102579...    246   9e-74   Solanum tuberosum [potatoes]
ref|XP_004246616.1|  PREDICTED: FAD synthase                            243   8e-73   Solanum lycopersicum
ref|XP_009760625.1|  PREDICTED: FAD synthase-like                       243   1e-72   Nicotiana sylvestris
ref|XP_009598660.1|  PREDICTED: FAD synthase-like                       241   4e-72   Nicotiana tomentosiformis
ref|XP_006339086.1|  PREDICTED: uncharacterized protein LOC102587...    237   2e-71   
ref|XP_006339085.1|  PREDICTED: uncharacterized protein LOC102587...    238   9e-71   Solanum tuberosum [potatoes]
ref|XP_004249480.1|  PREDICTED: FAD synthase-like                       235   1e-69   Solanum lycopersicum
ref|XP_010241788.1|  PREDICTED: uncharacterized protein LOC104586...    217   1e-66   Nelumbo nucifera [Indian lotus]
gb|EYU29880.1|  hypothetical protein MIMGU_mgv1a0051982mg               223   4e-66   Erythranthe guttata [common monkey flower]
ref|XP_009596064.1|  PREDICTED: FAD synthase-like                       224   2e-65   Nicotiana tomentosiformis
ref|XP_009795878.1|  PREDICTED: FAD synthase-like                       223   3e-65   Nicotiana sylvestris
ref|XP_007027436.1|  Phosphoadenosine phosphosulfate (PAPS) reduc...    221   2e-64   
ref|XP_011468136.1|  PREDICTED: FAD synthase                            215   5e-62   Fragaria vesca subsp. vesca
gb|KJB62374.1|  hypothetical protein B456_009G414300                    214   6e-62   Gossypium raimondii
gb|KJB62378.1|  hypothetical protein B456_009G414300                    214   7e-62   Gossypium raimondii
ref|XP_006381395.1|  hypothetical protein POPTR_0006s12490g             209   1e-61   
emb|CDP06784.1|  unnamed protein product                                213   2e-61   Coffea canephora [robusta coffee]
ref|XP_006381394.1|  hypothetical protein POPTR_0006s12490g             209   2e-61   
ref|XP_007162778.1|  hypothetical protein PHAVU_001G179700g             213   4e-61   Phaseolus vulgaris [French bean]
ref|XP_012080798.1|  PREDICTED: FAD synthase-like isoform X2            212   6e-61   Jatropha curcas
ref|XP_003521410.1|  PREDICTED: uncharacterized protein LOC100795114    212   6e-61   Glycine max [soybeans]
gb|KHN02312.1|  Putative FAD synthase                                   213   6e-61   Glycine soja [wild soybean]
ref|XP_003554393.1|  PREDICTED: uncharacterized protein LOC100816619    212   6e-61   Glycine max [soybeans]
gb|KHG16140.1|  FAD synthase                                            211   6e-61   Gossypium arboreum [tree cotton]
ref|XP_011018772.1|  PREDICTED: FAD synthase isoform X1                 211   9e-61   Populus euphratica
gb|KHN09529.1|  Putative FAD synthase                                   211   1e-60   Glycine soja [wild soybean]
ref|XP_009377023.1|  PREDICTED: FAD synthase-like                       211   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_006381393.1|  hypothetical protein POPTR_0006s12490g             210   2e-60   
ref|XP_011077314.1|  PREDICTED: FAD synthase isoform X2                 209   3e-60   Sesamum indicum [beniseed]
ref|XP_011077312.1|  PREDICTED: FAD synthase isoform X1                 209   9e-60   Sesamum indicum [beniseed]
gb|EYU38565.1|  hypothetical protein MIMGU_mgv1a004967mg                208   1e-59   Erythranthe guttata [common monkey flower]
ref|XP_008387538.1|  PREDICTED: FAD synthase                            208   2e-59   
ref|XP_002269812.1|  PREDICTED: FAD synthase                            208   2e-59   Vitis vinifera
ref|XP_012082439.1|  PREDICTED: FAD synthase isoform X3                 208   2e-59   Jatropha curcas
ref|XP_012082437.1|  PREDICTED: FAD synthase isoform X1                 207   5e-59   Jatropha curcas
ref|XP_009362100.1|  PREDICTED: FAD synthase-like                       207   6e-59   Pyrus x bretschneideri [bai li]
ref|XP_006428353.1|  hypothetical protein CICLE_v10011527mg             206   8e-59   
ref|XP_003625689.1|  FAD synthetase                                     205   2e-58   Medicago truncatula
ref|XP_008369548.1|  PREDICTED: FAD synthase-like                       206   2e-58   Malus domestica [apple tree]
ref|XP_004494068.1|  PREDICTED: uncharacterized protein LOC101502...    205   2e-58   
ref|XP_002519482.1|  molybdopterin-binding, putative                    204   8e-58   
ref|XP_004137977.1|  PREDICTED: FAD synthase                            204   8e-58   Cucumis sativus [cucumbers]
ref|XP_012082438.1|  PREDICTED: FAD synthase isoform X2                 204   1e-57   
ref|XP_008442712.1|  PREDICTED: FAD synthase                            203   1e-57   Cucumis melo [Oriental melon]
ref|XP_010098792.1|  FAD synthase                                       197   2e-55   
ref|XP_006491700.1|  PREDICTED: uncharacterized protein LOC102612...    196   1e-54   
ref|XP_007204563.1|  hypothetical protein PRUPE_ppa004416mg             195   1e-54   Prunus persica
ref|XP_008241395.1|  PREDICTED: FAD synthase                            195   1e-54   Prunus mume [ume]
ref|XP_006491694.1|  PREDICTED: uncharacterized protein LOC102612...    195   2e-54   
ref|XP_010037643.1|  PREDICTED: FAD synthase                            195   2e-54   Eucalyptus grandis [rose gum]
ref|XP_010553000.1|  PREDICTED: FAD synthase-like                       192   2e-53   Tarenaya hassleriana [spider flower]
gb|KDO51704.1|  hypothetical protein CISIN_1g031335mg                   181   4e-53   Citrus sinensis [apfelsine]
gb|KDO51701.1|  hypothetical protein CISIN_1g031335mg                   181   5e-53   Citrus sinensis [apfelsine]
gb|KDO51703.1|  hypothetical protein CISIN_1g031335mg                   181   6e-53   Citrus sinensis [apfelsine]
ref|XP_010684031.1|  PREDICTED: FAD synthase                            191   8e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004494067.1|  PREDICTED: uncharacterized protein LOC101502...    187   2e-51   
ref|XP_006840651.1|  PREDICTED: FAD synthase                            186   3e-51   Amborella trichopoda
ref|XP_008796395.1|  PREDICTED: FAD synthase-like isoform X2            186   5e-51   Phoenix dactylifera
ref|XP_006398792.1|  hypothetical protein EUTSA_v10013303mg             184   2e-50   Eutrema salsugineum [saltwater cress]
ref|XP_006398793.1|  hypothetical protein EUTSA_v10013303mg             184   3e-50   
ref|XP_010423718.1|  PREDICTED: FAD synthase-like isoform X2            181   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010456377.1|  PREDICTED: FAD synthase-like                       182   9e-50   
ref|XP_012080795.1|  PREDICTED: FAD synthase-like isoform X1            182   2e-49   
ref|XP_010490819.1|  PREDICTED: FAD synthase-like isoform X1            181   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009384127.1|  PREDICTED: FAD synthase-like                       181   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX80868.1|  BnaC03g01220D                                          181   2e-49   
ref|XP_010241789.1|  PREDICTED: uncharacterized protein LOC104586...    172   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010423717.1|  PREDICTED: FAD synthase-like isoform X1            181   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010558189.1|  PREDICTED: FAD synthase isoform X7                 179   4e-49   
emb|CDX70308.1|  BnaA10g26570D                                          180   5e-49   
ref|XP_009130755.1|  PREDICTED: FAD synthase-like                       180   6e-49   Brassica rapa
emb|CDY44367.1|  BnaC02g03100D                                          180   6e-49   Brassica napus [oilseed rape]
ref|XP_010558187.1|  PREDICTED: FAD synthase isoform X6                 179   7e-49   
ref|XP_010558184.1|  PREDICTED: FAD synthase isoform X4                 179   8e-49   
ref|XP_010558185.1|  PREDICTED: FAD synthase isoform X5                 179   8e-49   
ref|XP_010558181.1|  PREDICTED: FAD synthase isoform X1                 179   9e-49   
ref|XP_009125503.1|  PREDICTED: FAD synthase-like                       179   9e-49   Brassica rapa
emb|CDY04882.1|  BnaAnng00640D                                          179   1e-48   
ref|XP_008789471.1|  PREDICTED: FAD synthase-like isoform X2            177   1e-48   
emb|CDY11253.1|  BnaA03g00890D                                          178   3e-48   Brassica napus [oilseed rape]
ref|XP_010940692.1|  PREDICTED: FAD synthase-like isoform X3            176   5e-48   
gb|KJB62379.1|  hypothetical protein B456_009G414300                    177   6e-48   Gossypium raimondii
ref|XP_002873090.1|  phosphoadenosine phosphosulfate reductase fa...    177   7e-48   
ref|XP_006287585.1|  hypothetical protein CARUB_v10000795mg             177   1e-47   Capsella rubella
ref|XP_008789470.1|  PREDICTED: FAD synthase-like isoform X1            177   1e-47   Phoenix dactylifera
ref|XP_010940691.1|  PREDICTED: FAD synthase-like isoform X2            175   2e-47   Elaeis guineensis
ref|XP_009420445.1|  PREDICTED: FAD synthase-like                       176   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001132126.1|  uncharacterized protein LOC100193543               167   2e-47   
emb|CDY10380.1|  BnaCnng02810D                                          175   3e-47   Brassica napus [oilseed rape]
gb|AFW79650.1|  hypothetical protein ZEAMMB73_828913                    166   4e-47   
ref|XP_010940690.1|  PREDICTED: FAD synthase-like isoform X1            175   4e-47   Elaeis guineensis
gb|AAK62461.1|AF387016_1  putative protein                              174   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568117.1|  phosphoadenosine phosphosulfate (PAPS) reductas...    172   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936061.1|  PREDICTED: FAD synthase-like isoform X2            172   4e-46   Elaeis guineensis
ref|XP_009122698.1|  PREDICTED: FAD synthase-like isoform X1            171   5e-46   
ref|XP_009122699.1|  PREDICTED: FAD synthase-like isoform X2            172   7e-46   Brassica rapa
ref|XP_004967807.1|  PREDICTED: uncharacterized protein LOC101755558    172   7e-46   Setaria italica
gb|AGT16499.1|  hypothetical protein SHCRBa_010_E09_R_480               166   1e-45   Saccharum hybrid cultivar R570
ref|XP_002457596.1|  hypothetical protein SORBIDRAFT_03g009960          170   4e-45   Sorghum bicolor [broomcorn]
ref|XP_010936059.1|  PREDICTED: FAD synthase-like isoform X1            169   6e-45   
ref|NP_001042640.2|  Os01g0259600                                       165   1e-44   
ref|XP_010558183.1|  PREDICTED: FAD synthase isoform X3                 168   2e-44   
ref|XP_008654383.1|  PREDICTED: uncharacterized protein LOC100193...    168   2e-44   Zea mays [maize]
gb|EEE54271.1|  hypothetical protein OsJ_01171                          165   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70347.1|  hypothetical protein OsI_01253                          165   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_010230726.1|  PREDICTED: FAD synthase                            163   1e-42   Brachypodium distachyon [annual false brome]
gb|KDO51705.1|  hypothetical protein CISIN_1g031335mg                   152   4e-42   Citrus sinensis [apfelsine]
emb|CDM82643.1|  unnamed protein product                                160   1e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010267372.1|  PREDICTED: uncharacterized protein LOC104604633    162   1e-41   
gb|KDO51702.1|  hypothetical protein CISIN_1g031335mg                   150   4e-41   Citrus sinensis [apfelsine]
ref|XP_011018779.1|  PREDICTED: FAD synthase isoform X2                 157   1e-40   Populus euphratica
ref|XP_010908719.1|  PREDICTED: uncharacterized protein LOC105035029    153   1e-39   
ref|XP_010936065.1|  PREDICTED: probable FAD synthase isoform X6        152   4e-39   
gb|ADE76044.1|  unknown                                                 152   1e-38   Picea sitchensis
gb|KCW49385.1|  hypothetical protein EUGRSUZ_K02925                     151   1e-38   Eucalyptus grandis [rose gum]
ref|XP_010936062.1|  PREDICTED: FAD synthase-like isoform X3            149   1e-37   Elaeis guineensis
gb|AFW79649.1|  hypothetical protein ZEAMMB73_828913                    148   2e-37   
ref|XP_006644015.1|  PREDICTED: uncharacterized protein LOC102722152    143   2e-35   Oryza brachyantha
gb|KJB62375.1|  hypothetical protein B456_009G414300                    126   9e-30   Gossypium raimondii
gb|KCW49386.1|  hypothetical protein EUGRSUZ_K02925                     121   5e-28   Eucalyptus grandis [rose gum]
ref|XP_008796393.1|  PREDICTED: FAD synthase-like isoform X1            112   2e-24   Phoenix dactylifera
ref|XP_010490820.1|  PREDICTED: FAD synthase-like isoform X2            109   6e-24   Camelina sativa [gold-of-pleasure]
gb|KDO51706.1|  hypothetical protein CISIN_1g031335mg                 99.8    1e-22   Citrus sinensis [apfelsine]
ref|XP_010936064.1|  PREDICTED: FAD synthase-like isoform X5            100   1e-20   Elaeis guineensis
ref|XP_010936063.1|  PREDICTED: FAD synthase-like isoform X4          97.4    2e-19   Elaeis guineensis
dbj|BAF00583.1|  hypothetical protein                                 89.0    9e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AFK39867.1|  unknown                                               84.7    3e-15   Medicago truncatula
tpg|DAA54006.1|  TPA: hypothetical protein ZEAMMB73_599926            70.9    1e-12   
ref|XP_010936066.1|  PREDICTED: probable FAD synthase isoform X7      76.6    2e-12   Elaeis guineensis
ref|XP_002976522.1|  hypothetical protein SELMODRAFT_54778            71.2    1e-10   
ref|XP_002973384.1|  hypothetical protein SELMODRAFT_54760            71.2    1e-10   
gb|KJB62376.1|  hypothetical protein B456_009G414300                  68.6    7e-10   Gossypium raimondii
gb|KCW49387.1|  hypothetical protein EUGRSUZ_K02925                   55.5    2e-05   Eucalyptus grandis [rose gum]



>ref|XP_006354376.1| PREDICTED: uncharacterized protein LOC102579774 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354377.1| PREDICTED: uncharacterized protein LOC102579774 isoform X2 [Solanum 
tuberosum]
Length=513

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG KC+GDKNEMA LPEGITELLHHEQL VPLIKCHNVIIL ATN  ELD QWDCL
Sbjct  365  LRHLIGEKCSGDKNEMALLPEGITELLHHEQLPVPLIKCHNVIILTATNAVELDRQWDCL  424

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS G+LE  +PFVSKC  TTL DVEVAQPLSKLC QFPD+YIGGYRESR G L+I 
Sbjct  425  IELAKSNGILEQMDPFVSKCFATTLSDVEVAQPLSKLCAQFPDLYIGGYRESREGPLIIT  484

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            FEGKDLSR+EAA+++LC+ FHPGAFS +
Sbjct  485  FEGKDLSRIEAASQSLCQKFHPGAFSKI  512



>ref|XP_004246616.1| PREDICTED: FAD synthase [Solanum lycopersicum]
 ref|XP_010325965.1| PREDICTED: FAD synthase [Solanum lycopersicum]
Length=513

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG KC+GDKNEMA LPEGITELLHHE L VPLIKCHNVIIL ATN  ELD QWDCL
Sbjct  365  LRHLIGEKCSGDKNEMALLPEGITELLHHEHLPVPLIKCHNVIILTATNAVELDRQWDCL  424

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS G+LEL +PF SKC  TTL DVEVAQPLSKLC QFPD+YIGGYRESR G L+I 
Sbjct  425  IELAKSNGILELMDPFASKCFATTLSDVEVAQPLSKLCAQFPDLYIGGYRESREGPLIIT  484

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKDLSR+EAA+++LC+ FHPG+FS ++
Sbjct  485  FEGKDLSRIEAASQSLCQKFHPGSFSKIE  513



>ref|XP_009760625.1| PREDICTED: FAD synthase-like [Nicotiana sylvestris]
Length=513

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG KC+GDKNEMA LPEGITELLHHEQL VPLIKCHNVIIL ATNV ELD QWDCL
Sbjct  365  LRHLIGEKCSGDKNEMALLPEGITELLHHEQLPVPLIKCHNVIILTATNVVELDRQWDCL  424

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS G+L L +PFVSKC  TTL DVEVAQPLSKLC QFPD+YIGGYR SR G LVI 
Sbjct  425  IELAKSNGILVLMDPFVSKCFATTLSDVEVAQPLSKLCAQFPDLYIGGYRRSREGPLVIT  484

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKDLSR+EAA+++LC+ FH GAFS ++
Sbjct  485  FEGKDLSRIEAASQSLCQKFHAGAFSEIE  513



>ref|XP_009598660.1| PREDICTED: FAD synthase-like [Nicotiana tomentosiformis]
Length=513

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG KC+GDKNEMA LPEGITELLHHEQL VPLIKCHNVIIL ATNV ELD QWDCL
Sbjct  365  LRHLIGEKCSGDKNEMALLPEGITELLHHEQLPVPLIKCHNVIILTATNVVELDRQWDCL  424

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS G+L L +PFVSKC  TTL DVEVAQPLSKLC QFPD+YIGGYR SR G +VI 
Sbjct  425  IELAKSNGILVLMDPFVSKCFATTLSDVEVAQPLSKLCAQFPDLYIGGYRRSREGPVVIT  484

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKDLSR+EAA+++LC+ FH GAFS ++
Sbjct  485  FEGKDLSRIEAASQSLCQKFHAGAFSEIE  513



>ref|XP_006339086.1| PREDICTED: uncharacterized protein LOC102587202 isoform X2 [Solanum 
tuberosum]
Length=403

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG KCTGDKNEMAQLPEGITELLHHEQL VPLIKC NV+IL ATNV ELD QW CL
Sbjct  255  LRHLIGEKCTGDKNEMAQLPEGITELLHHEQLPVPLIKCRNVVILTATNVAELDLQWHCL  314

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I   KS G L L  PFVSKCL TTL DVEVAQPLSKLCLQFPDIYIGGYR SR G L+IR
Sbjct  315  IDSLKSNGDLVLMAPFVSKCLTTTLSDVEVAQPLSKLCLQFPDIYIGGYRGSRKGPLMIR  374

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKDLSR+EAA+++LC++F PGAFS  +
Sbjct  375  FEGKDLSRIEAASQSLCQNFQPGAFSETE  403



>ref|XP_006339085.1| PREDICTED: uncharacterized protein LOC102587202 isoform X1 [Solanum 
tuberosum]
Length=512

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG KCTGDKNEMAQLPEGITELLHHEQL VPLIKC NV+IL ATNV ELD QW CL
Sbjct  364  LRHLIGEKCTGDKNEMAQLPEGITELLHHEQLPVPLIKCRNVVILTATNVAELDLQWHCL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I   KS G L L  PFVSKCL TTL DVEVAQPLSKLCLQFPDIYIGGYR SR G L+IR
Sbjct  424  IDSLKSNGDLVLMAPFVSKCLTTTLSDVEVAQPLSKLCLQFPDIYIGGYRGSRKGPLMIR  483

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKDLSR+EAA+++LC++F PGAFS  +
Sbjct  484  FEGKDLSRIEAASQSLCQNFQPGAFSETE  512



>ref|XP_004249480.1| PREDICTED: FAD synthase-like [Solanum lycopersicum]
Length=512

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG KCTGDKNEMAQLPEGITELL+HEQL VPLIKCHNVIIL ATNV ELD QW CL
Sbjct  364  LRHLIGEKCTGDKNEMAQLPEGITELLYHEQLPVPLIKCHNVIILTATNVAELDLQWHCL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I   KS G   L  PFVSKCL TTL DVEVAQPLSKLCLQFPDIYIGGYR SR G L+IR
Sbjct  424  IDSLKSNGDFVLMAPFVSKCLATTLSDVEVAQPLSKLCLQFPDIYIGGYRGSRKGPLMIR  483

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKDLSR+EAA+++L ++F PGAFS  +
Sbjct  484  FEGKDLSRIEAASQSLSQNFQPGAFSETE  512



>ref|XP_010241788.1| PREDICTED: uncharacterized protein LOC104586309 isoform X1 [Nelumbo 
nucifera]
Length=188

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NE+A LPEGITELLHHE L VPLIKC NVIIL ATN+TEL++QWDCL
Sbjct  38   LRHLISDQCTGDRNELALLPEGITELLHHEMLPVPLIKCRNVIILTATNITELNKQWDCL  97

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I LT S GLL L EPF+SK L TTL DVE AQPLS+LCL+FPD+YIGG+R+SR G L+I 
Sbjct  98   IDLTSSTGLLVLMEPFLSKQLATTLTDVETAQPLSELCLEFPDLYIGGFRKSRVGPLIIS  157

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD +R+E A + LC+ FHPGAFS V+
Sbjct  158  FVGKDQARIELAKQVLCQKFHPGAFSEVN  186



>gb|EYU29880.1| hypothetical protein MIMGU_mgv1a0051982mg, partial [Erythranthe 
guttata]
Length=404

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTG +NEMAQLPEGITEL HHE+L VPLIKC NVIIL ATN+ ELDE+W+CL
Sbjct  256  LRHLIGERCTGHRNEMAQLPEGITELWHHEKLSVPLIKCQNVIILTATNIDELDEEWNCL  315

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS GLL + EPFV K L TTL DVE AQPLS++C +FPD++IGGYRESR   L+I 
Sbjct  316  IELMKSNGLLAITEPFVLKRLSTTLSDVEAAQPLSEMCFEFPDLFIGGYRESRKDPLIIS  375

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F+GKD  R+ AAAEALC  FHPGAFS +D
Sbjct  376  FKGKDKGRISAAAEALCNKFHPGAFSEID  404



>ref|XP_009596064.1| PREDICTED: FAD synthase-like [Nicotiana tomentosiformis]
 ref|XP_009596065.1| PREDICTED: FAD synthase-like [Nicotiana tomentosiformis]
 ref|XP_009596066.1| PREDICTED: FAD synthase-like [Nicotiana tomentosiformis]
Length=504

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  KCTGDKNEMAQLPEGITELLHHEQL VPLIKC NVI+L ATNV ELD QWDCL
Sbjct  356  LRHLIDEKCTGDKNEMAQLPEGITELLHHEQLPVPLIKCGNVIVLTATNVAELDLQWDCL  415

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+  KS   L L  PFVSKCL TTL DVE+AQPLSK+CLQ+PD+ IGGYR SR G L+IR
Sbjct  416  IESAKSNADLVLMAPFVSKCLATTLSDVEIAQPLSKVCLQYPDMNIGGYRGSRKGPLIIR  475

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKDL+R+E A+++LC++F  GAFS ++
Sbjct  476  FEGKDLTRIETASQSLCQNFLSGAFSQIE  504



>ref|XP_009795878.1| PREDICTED: FAD synthase-like [Nicotiana sylvestris]
 ref|XP_009795879.1| PREDICTED: FAD synthase-like [Nicotiana sylvestris]
Length=505

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  KCTGDKNEMAQLPEGITELLHHEQL VPLIKC NVIIL ATNV ELD QWDCL
Sbjct  357  LRHLIAEKCTGDKNEMAQLPEGITELLHHEQLPVPLIKCGNVIILTATNVAELDLQWDCL  416

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+  KS G L L  PFVSK L TTL DVE+AQPLSKL LQ+PD+ IGGYR SR G L++R
Sbjct  417  IESAKSNGDLVLMAPFVSKSLATTLSDVEIAQPLSKLRLQYPDMNIGGYRGSRKGPLIVR  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKD +R+EAA+++LC++FH GAFS ++
Sbjct  477  FEGKDPTRIEAASQSLCQNFHSGAFSQIE  505



>ref|XP_007027436.1| Phosphoadenosine phosphosulfate (PAPS) reductase family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007027437.1| Phosphoadenosine phosphosulfate (PAPS) reductase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY07938.1| Phosphoadenosine phosphosulfate (PAPS) reductase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY07939.1| Phosphoadenosine phosphosulfate (PAPS) reductase family protein 
isoform 1 [Theobroma cacao]
Length=508

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L+ATN TELD+QWDCL
Sbjct  360  LRHLIGDHCTGDRNEMAQLPEGITELLHHEKLPVPLIKCRNVIVLSATNATELDKQWDCL  419

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT S G L   EP+ SK L T L DVE AQPLSKLCL+FPD+YIG +RESR G LVI 
Sbjct  420  IELTGSDGCLVTMEPYSSKRLTTNLTDVETAQPLSKLCLEFPDLYIGCFRESRQGPLVIS  479

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKDL+R+ AA E LCK  HP AFS V+
Sbjct  480  FEGKDLARIHAAVETLCKKLHPEAFSEVN  508



>ref|XP_011468136.1| PREDICTED: FAD synthase [Fragaria vesca subsp. vesca]
 ref|XP_011468137.1| PREDICTED: FAD synthase [Fragaria vesca subsp. vesca]
 ref|XP_011468138.1| PREDICTED: FAD synthase [Fragaria vesca subsp. vesca]
Length=511

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMA LPEGITELLHHE+L VPLIKC NVII  ATNV ELD++W+CL
Sbjct  361  LRHLIGDQCTGDRNEMALLPEGITELLHHEKLMVPLIKCKNVIIFTATNVLELDDEWNCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L +S G L +A+PFVSKCL T L D+EVAQP+SKLCL+FPD+YIG YR SR   L I 
Sbjct  421  IELMRSGGELVMAQPFVSKCLTTNLADLEVAQPVSKLCLEFPDLYIGCYRISRREPLRIY  480

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKD +R+E+A EALCK F PGAFS ++
Sbjct  481  FEGKDQNRIESAKEALCKKFQPGAFSEIN  509



>gb|KJB62374.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=508

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L+ATN TEL++QWDCL
Sbjct  360  LRHLIGDHCTGDRNEMAQLPEGITELLHHEKLPVPLIKCCNVIVLSATNATELEKQWDCL  419

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT+S G L   E + SK L T L DVE AQPLSKLCL+FPD+YIG +R SR G LVI 
Sbjct  420  IELTESDGFLVTIESYSSKRLTTNLTDVETAQPLSKLCLEFPDLYIGCFRRSRQGPLVIS  479

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKD SRV+A  EALCK F+ GAFS V+
Sbjct  480  FEGKDPSRVQAGVEALCKKFNAGAFSEVN  508



>gb|KJB62378.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=505

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L+ATN TEL++QWDCL
Sbjct  357  LRHLIGDHCTGDRNEMAQLPEGITELLHHEKLPVPLIKCCNVIVLSATNATELEKQWDCL  416

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT+S G L   E + SK L T L DVE AQPLSKLCL+FPD+YIG +R SR G LVI 
Sbjct  417  IELTESDGFLVTIESYSSKRLTTNLTDVETAQPLSKLCLEFPDLYIGCFRRSRQGPLVIS  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKD SRV+A  EALCK F+ GAFS V+
Sbjct  477  FEGKDPSRVQAGVEALCKKFNAGAFSEVN  505



>ref|XP_006381395.1| hypothetical protein POPTR_0006s12490g [Populus trichocarpa]
 gb|ERP59192.1| hypothetical protein POPTR_0006s12490g [Populus trichocarpa]
Length=340

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I   CTGD+NEMA LPEGITELLHHE+L VPLIKC NVII  ATN TELD++WDCL
Sbjct  192  LRHLISDHCTGDQNEMALLPEGITELLHHEKLAVPLIKCQNVIIFTATNATELDKEWDCL  251

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT+S G L    P+VSK L+T L DVE AQPLSKLCL+FPD+ IG YR+SR G L+I 
Sbjct  252  IELTRSCGFLPTMVPYVSKHLQTNLSDVETAQPLSKLCLEFPDLNIGCYRKSRKGPLIIS  311

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            FEGKD +++E+A E+LCK FHPG FS +
Sbjct  312  FEGKDQTQIESAVESLCKLFHPGTFSGI  339



>emb|CDP06784.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG KCTGD+NEMAQLPEGITELLHHEQL VPLIKCHNVIIL+ATNV ELD QWDCL
Sbjct  365  LRHLIGEKCTGDRNEMAQLPEGITELLHHEQLPVPLIKCHNVIILSATNVAELDLQWDCL  424

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            + L+ S GLL L EP  SK L T   DVE AQPLSKLCL+FPD+YIG YR SR+G L+I 
Sbjct  425  LDLSSSNGLLVLMEPLQSKRLCTNTSDVEAAQPLSKLCLEFPDLYIGAYRASRNGPLIIT  484

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F+GKD  R+ AA  AL +  H G FS VD
Sbjct  485  FQGKDQGRIAAATAALSEKVHTGQFSEVD  513



>ref|XP_006381394.1| hypothetical protein POPTR_0006s12490g [Populus trichocarpa]
 gb|ERP59191.1| hypothetical protein POPTR_0006s12490g [Populus trichocarpa]
Length=365

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I   CTGD+NEMA LPEGITELLHHE+L VPLIKC NVII  ATN TELD++WDCL
Sbjct  217  LRHLISDHCTGDQNEMALLPEGITELLHHEKLAVPLIKCQNVIIFTATNATELDKEWDCL  276

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT+S G L    P+VSK L+T L DVE AQPLSKLCL+FPD+ IG YR+SR G L+I 
Sbjct  277  IELTRSCGFLPTMVPYVSKHLQTNLSDVETAQPLSKLCLEFPDLNIGCYRKSRKGPLIIS  336

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            FEGKD +++E+A E+LCK FHPG FS +
Sbjct  337  FEGKDQTQIESAVESLCKLFHPGTFSGI  364



>ref|XP_007162778.1| hypothetical protein PHAVU_001G179700g [Phaseolus vulgaris]
 gb|ESW34772.1| hypothetical protein PHAVU_001G179700g [Phaseolus vulgaris]
Length=504

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR I+G +CTGD+NEMAQLPEGITEL HH++L VPLIKC NVIIL+ATNV+EL++QWDC 
Sbjct  356  LRHIMGDQCTGDRNEMAQLPEGITELWHHDKLSVPLIKCQNVIILSATNVSELEKQWDCW  415

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS  LL L EP+VSK + T L DVE+AQPLSKLCL+FPD+YIG YR++R+G +++ 
Sbjct  416  IELAKSSDLLALLEPYVSKHVATNLTDVEIAQPLSKLCLEFPDLYIGCYRKARYGSVIVS  475

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F+GKDL+R+++A +AL K F PGAF
Sbjct  476  FKGKDLTRIDSAIKALHKKFQPGAF  500



>ref|XP_012080798.1| PREDICTED: FAD synthase-like isoform X2 [Jatropha curcas]
 gb|KDP30682.1| hypothetical protein JCGZ_15557 [Jatropha curcas]
Length=507

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE+L VP+IKC NVIIL ATNV ELDE+W+CL
Sbjct  359  LRHLIGEHCTGDRNEMALLPEGITELLHHEKLPVPMIKCQNVIILAATNVAELDEEWECL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTKS  LL + EPFV K + T L DVE+AQPLSKLCL FPDI IG YR+SR+G LVI 
Sbjct  419  TELTKSYNLLPMLEPFVLKQILTNLSDVEIAQPLSKLCLDFPDINIGVYRKSRNGTLVIN  478

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            FEGK+  R++ A EALCK FHPGAFS +
Sbjct  479  FEGKNQLRIDLAVEALCKFFHPGAFSEI  506



>ref|XP_003521410.1| PREDICTED: uncharacterized protein LOC100795114 [Glycine max]
Length=506

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR IIG +CTGD+NEMAQLPEGITEL HH++L VPLIKC NVIIL+ATNV E+++QWDC 
Sbjct  358  LRHIIGDQCTGDRNEMAQLPEGITELWHHDKLSVPLIKCENVIILSATNVPEMEKQWDCW  417

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS  LL L EP+VSK + T+L DVE+AQPLSKLCL+FPD+YIG YR +R+G L++ 
Sbjct  418  IELAKSSDLLALLEPYVSKHVTTSLSDVEIAQPLSKLCLEFPDLYIGCYRNARYGSLIVS  477

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F+GKDL+R+E+A +AL K F P AF
Sbjct  478  FKGKDLTRIESAIKALQKKFQPSAF  502



>gb|KHN02312.1| Putative FAD synthase [Glycine soja]
Length=539

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR IIG +CTGD+NEMAQLPEGITEL HH++L VPLIKC NVIIL+ATNV EL++QWDC 
Sbjct  391  LRHIIGDQCTGDRNEMAQLPEGITELWHHDKLSVPLIKCENVIILSATNVPELEKQWDCW  450

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS  LL L EP+VSK + T L DVE+AQPLSKLCL+FPD+YIG YR++R+G L++ 
Sbjct  451  IELAKSSDLLALLEPYVSKDVTTNLSDVEIAQPLSKLCLEFPDLYIGCYRKARYGSLIVS  510

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F+GKDL+R+E+A +AL K F P AF
Sbjct  511  FKGKDLTRIESAIKALHKKFQPSAF  535



>ref|XP_003554393.1| PREDICTED: uncharacterized protein LOC100816619 [Glycine max]
Length=506

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR IIG +CTGD+NEMAQLPEGITEL HH++L VPLIKC NVIIL+ATNV EL++QWDC 
Sbjct  358  LRHIIGDQCTGDRNEMAQLPEGITELWHHDKLSVPLIKCENVIILSATNVPELEKQWDCW  417

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS  LL L EP+VSK + T L DVE+AQPLSKLCL+FPD+YIG YR++R+G L++ 
Sbjct  418  IELAKSSDLLALLEPYVSKDVTTNLSDVEIAQPLSKLCLEFPDLYIGCYRKARYGSLIVS  477

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F+GKDL+R+E+A +AL K F P AF
Sbjct  478  FKGKDLTRIESAIKALHKKFQPSAF  502



>gb|KHG16140.1| FAD synthase [Gossypium arboreum]
Length=454

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L+ATN +EL++QWDCL
Sbjct  306  LRHLIGDHCTGDRNEMAQLPEGITELLHHEKLPVPLIKCCNVIVLSATNASELEKQWDCL  365

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT S G L   E + SK L T L DVE AQPLSKLCL+FPD+YIG +R SR G L I 
Sbjct  366  IELTGSDGFLVTIESYSSKRLTTNLTDVETAQPLSKLCLEFPDLYIGCFRRSRQGPLAIS  425

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKD SRV+A  EALCK F+ GAFS V+
Sbjct  426  FEGKDPSRVQAGVEALCKKFNAGAFSEVN  454



>ref|XP_011018772.1| PREDICTED: FAD synthase isoform X1 [Populus euphratica]
 ref|XP_011018773.1| PREDICTED: FAD synthase isoform X1 [Populus euphratica]
 ref|XP_011018774.1| PREDICTED: FAD synthase isoform X1 [Populus euphratica]
 ref|XP_011018778.1| PREDICTED: FAD synthase isoform X1 [Populus euphratica]
Length=505

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE+L VPLIKC NVII  ATN TELD++WDCL
Sbjct  357  LRHLIGDHCTGDQNEMALLPEGITELLHHEKLAVPLIKCQNVIIFTATNATELDKEWDCL  416

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT+S G L    P+VSK L+T L DVE AQPLSKL L+FPD+ IG YR+SR G L+I 
Sbjct  417  IELTRSCGFLPTMVPYVSKHLQTNLSDVETAQPLSKLSLEFPDLNIGCYRKSRKGPLIIS  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            FEGKD +R+E+A E+LCK FHPG FS +
Sbjct  477  FEGKDQTRIESAVESLCKLFHPGTFSGI  504



>gb|KHN09529.1| Putative FAD synthase [Glycine soja]
Length=506

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR IIG +CTGD+NEMAQLPEGITEL HH++L VPLIKC NVIIL+ATNV E+++QWDC 
Sbjct  358  LRHIIGDQCTGDRNEMAQLPEGITELWHHDKLSVPLIKCENVIILSATNVPEMEKQWDCW  417

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS  LL L EP+VSK + T L DVE+AQPLSKLCL+FPD+YIG YR +R+G L++ 
Sbjct  418  IELAKSSDLLALLEPYVSKHVTTNLSDVEIAQPLSKLCLEFPDLYIGCYRNARYGSLIVS  477

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F+GKDL+R+E+A +AL K F P AF
Sbjct  478  FKGKDLTRIESAIKALQKKFQPSAF  502



>ref|XP_009377023.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009377024.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
Length=511

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMA LPEGITELLHHE+L VPLIKC NVIIL ATN+ ELDEQW+CL
Sbjct  361  LRHLIGDQCTGDRNEMALLPEGITELLHHEKLTVPLIKCKNVIILTATNILELDEQWNCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L +S G L   +PFVSK L T L DVE+AQPLSKLCL+FPD++IG  R+SR   ++I 
Sbjct  421  IELMRSDGALATMQPFVSKHLTTNLTDVEIAQPLSKLCLEFPDLFIGCRRKSRTEPVIIY  480

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVDRA  371
            FEGKD  R+++A EALCK FHPGAF  ++ +
Sbjct  481  FEGKDQDRIQSAIEALCKKFHPGAFVEINSS  511



>ref|XP_006381393.1| hypothetical protein POPTR_0006s12490g [Populus trichocarpa]
 gb|ERP59190.1| hypothetical protein POPTR_0006s12490g [Populus trichocarpa]
Length=482

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I   CTGD+NEMA LPEGITELLHHE+L VPLIKC NVII  ATN TELD++WDCL
Sbjct  334  LRHLISDHCTGDQNEMALLPEGITELLHHEKLAVPLIKCQNVIIFTATNATELDKEWDCL  393

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT+S G L    P+VSK L+T L DVE AQPLSKLCL+FPD+ IG YR+SR G L+I 
Sbjct  394  IELTRSCGFLPTMVPYVSKHLQTNLSDVETAQPLSKLCLEFPDLNIGCYRKSRKGPLIIS  453

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            FEGKD +++E+A E+LCK FHPG FS +
Sbjct  454  FEGKDQTQIESAVESLCKLFHPGTFSGI  481



>ref|XP_011077314.1| PREDICTED: FAD synthase isoform X2 [Sesamum indicum]
Length=490

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMAQLPEGITEL+HH++L VPLIKC NVIIL ATN  EL+++WDCL
Sbjct  342  LRHLIGERCTGDRNEMAQLPEGITELMHHDKLRVPLIKCQNVIILTATNAAELEKEWDCL  401

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS  LL + EPFVSK L TTL DVE AQPLS + ++FPD+Y G YRESR G +VI 
Sbjct  402  IELMKSNELLVMTEPFVSKRLATTLSDVEAAQPLSDIAIKFPDVYTGAYRESRGGSIVIT  461

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD +R+ AAAEALCK FHPGAFS VD
Sbjct  462  FTGKDEARIRAAAEALCKKFHPGAFSEVD  490



>ref|XP_011077312.1| PREDICTED: FAD synthase isoform X1 [Sesamum indicum]
 ref|XP_011077313.1| PREDICTED: FAD synthase isoform X1 [Sesamum indicum]
Length=510

 Score =   209 bits (532),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMAQLPEGITEL+HH++L VPLIKC NVIIL ATN  EL+++WDCL
Sbjct  362  LRHLIGERCTGDRNEMAQLPEGITELMHHDKLRVPLIKCQNVIILTATNAAELEKEWDCL  421

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L KS  LL + EPFVSK L TTL DVE AQPLS + ++FPD+Y G YRESR G +VI 
Sbjct  422  IELMKSNELLVMTEPFVSKRLATTLSDVEAAQPLSDIAIKFPDVYTGAYRESRGGSIVIT  481

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD +R+ AAAEALCK FHPGAFS VD
Sbjct  482  FTGKDEARIRAAAEALCKKFHPGAFSEVD  510



>gb|EYU38565.1| hypothetical protein MIMGU_mgv1a004967mg [Erythranthe guttata]
Length=502

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMAQLPEGITEL+HHE+L VPLIKC NVIIL A +V EL+ +WDC 
Sbjct  354  LRHLIGERCTGDRNEMAQLPEGITELVHHEKLSVPLIKCKNVIILTAASVAELENEWDCF  413

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I L +S G+L   EP +SK L TTL DVE+AQPLS++C QFPD+YIG YR+SR G ++I 
Sbjct  414  IDLMRSNGVLLTTEPLISKKLATTLPDVEIAQPLSEICRQFPDLYIGTYRKSRGGSIIIT  473

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEG D +R+ AAAEALCK FHP A S  +
Sbjct  474  FEGNDKARIGAAAEALCKKFHPEALSETE  502



>ref|XP_008387538.1| PREDICTED: FAD synthase [Malus domestica]
 ref|XP_008387539.1| PREDICTED: FAD synthase [Malus domestica]
Length=511

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMA LPEGITELLHHE+L VPLIKC NVIIL ATN+ ELDEQW+CL
Sbjct  361  LRHLIGDQCTGDRNEMALLPEGITELLHHEKLIVPLIKCKNVIILTATNILELDEQWNCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L +S G L   +PFVSK L T L DVE+AQPLSKLCL+FPD+YIG  R+SR   L+I 
Sbjct  421  IELMRSDGALATMQPFVSKHLTTNLTDVEIAQPLSKLCLEFPDLYIGCRRKSRTEPLIIY  480

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVDRA  371
            F+GKD  R+++A EALCK FHPGA   ++ +
Sbjct  481  FKGKDQDRIQSAIEALCKKFHPGAXVEINSS  511



>ref|XP_002269812.1| PREDICTED: FAD synthase [Vitis vinifera]
 emb|CBI30146.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPLIKC NV IL ATNVTELD++WDCL
Sbjct  366  LRHLIGDHCTGDRNEMAQLPEGITELLHHEKLSVPLIKCQNVFILTATNVTELDKEWDCL  425

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT+S GLL L EPF+SK + T L DVE AQ LSKLC +FPD+YIG YR+SR   L+I 
Sbjct  426  IELTRSSGLLVLMEPFLSKRMTTNLSDVEAAQALSKLCFEFPDLYIGCYRKSRLAPLIIS  485

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKD +R+E+A EAL K F  G  S  +
Sbjct  486  FEGKDQTRLESAVEALSKKFPAGQISEAN  514



>ref|XP_012082439.1| PREDICTED: FAD synthase isoform X3 [Jatropha curcas]
 gb|KDP29170.1| hypothetical protein JCGZ_16559 [Jatropha curcas]
Length=508

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGIT+LLHHE+L VP+IKC NVIIL ATN+ EL+ +W CL
Sbjct  360  LRHLIGDHCTGDRNEMALLPEGITDLLHHEKLPVPMIKCQNVIILAATNIAELENEWACL  419

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             + T+S GLL + EPFVSK L T L DVE+AQPLSKLC +FPDI IG YR+SR+G  ++ 
Sbjct  420  TESTRSYGLLAMMEPFVSKHLATNLSDVEIAQPLSKLCFEFPDINIGVYRKSRNGSRIVS  479

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGK  +++++A E LCK FHPGAFS +D
Sbjct  480  FEGKKQAKIDSAIEVLCKKFHPGAFSEID  508



>ref|XP_012082437.1| PREDICTED: FAD synthase isoform X1 [Jatropha curcas]
Length=536

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGIT+LLHHE+L VP+IKC NVIIL ATN+ EL+ +W CL
Sbjct  388  LRHLIGDHCTGDRNEMALLPEGITDLLHHEKLPVPMIKCQNVIILAATNIAELENEWACL  447

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             + T+S GLL + EPFVSK L T L DVE+AQPLSKLC +FPDI IG YR+SR+G  ++ 
Sbjct  448  TESTRSYGLLAMMEPFVSKHLATNLSDVEIAQPLSKLCFEFPDINIGVYRKSRNGSRIVS  507

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGK  +++++A E LCK FHPGAFS +D
Sbjct  508  FEGKKQAKIDSAIEVLCKKFHPGAFSEID  536



>ref|XP_009362100.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362101.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362102.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362106.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362107.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362108.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
Length=511

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMA LPEGITELLHHE+L VPLIKC NVIIL ATNV ELDE+W+CL
Sbjct  361  LRHLIGDQCTGDRNEMALLPEGITELLHHEKLIVPLIKCKNVIILTATNVLELDEEWNCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L  S G L   +PFVS+ L T L DVE+AQPLSKLCL+F D+YIG  R+SR   L+I 
Sbjct  421  IELMISDGALATLQPFVSRHLTTNLTDVEIAQPLSKLCLEFSDLYIGCRRKSRKEPLIIY  480

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVDRA  371
            FEGKD  R+++A EALCK FHPGAF  +D +
Sbjct  481  FEGKDQDRIQSAIEALCKKFHPGAFVEMDSS  511



>ref|XP_006428353.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 ref|XP_006428354.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 ref|XP_006428355.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 ref|XP_006428356.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 gb|ESR41593.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 gb|ESR41594.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 gb|ESR41595.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 gb|ESR41596.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
Length=505

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR++IG +CTGD+NEMA LPEG TELLHH++L +PLIKC NVIIL ATNVTELD++W+CL
Sbjct  358  LRQLIGDRCTGDRNEMALLPEGTTELLHHDKLLLPLIKCQNVIILTATNVTELDKEWNCL  417

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L +S G L L EP+ SK L T L D+E AQPLSKLCL+FPD++IG YR+SR G L+I 
Sbjct  418  IELLRSGG-LSLMEPYTSKSLTTNLSDLEAAQPLSKLCLEFPDLHIGCYRKSRQGPLIIS  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            FEGKD +R+EAA E+L K FH GAFS V
Sbjct  477  FEGKDQARIEAAIESLFKKFHRGAFSEV  504



>ref|XP_003625689.1| FAD synthetase [Medicago truncatula]
 gb|AES81907.1| phosphoadenosine phosphosulfate reductase family protein [Medicago 
truncatula]
 gb|AFK44331.1| unknown [Medicago truncatula]
Length=502

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR+IIG +C GD+NEMAQLPEGITELLHH+ L VPL+KC NVIIL+AT+++E+++QWDCL
Sbjct  354  LRKIIGDQCIGDRNEMAQLPEGITELLHHDSLTVPLMKCQNVIILSATDISEMEKQWDCL  413

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LTKS  LL L EPF+SK + T L DVE+AQPLSKLCL+FPD+ IG YR++R+G ++I 
Sbjct  414  IELTKSSDLLTLLEPFISKHVTTNLSDVEIAQPLSKLCLEFPDLCIGCYRKARYGSVIIS  473

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F+GKD +R+E+A EAL K F  GAF
Sbjct  474  FKGKDPARLESAIEALQKKFTSGAF  498



>ref|XP_008369548.1| PREDICTED: FAD synthase-like [Malus domestica]
 ref|XP_008369550.1| PREDICTED: FAD synthase-like [Malus domestica]
Length=515

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMA LPEGITELLHHE+L VPLIKC NVII  ATNV ELDEQW+CL
Sbjct  361  LRHLIGDQCTGDRNEMALLPEGITELLHHEKLIVPLIKCKNVIIFTATNVLELDEQWNCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L  S G L   +PFVS+ L T L DVE+AQPLSKLCL+FPD+YIG  R+SR   L+I 
Sbjct  421  IELMISDGGLATMQPFVSRHLTTNLTDVEIAQPLSKLCLEFPDLYIGCRRKSRKEPLIIY  480

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            FEGKD  ++++A EALCK FHPGAF
Sbjct  481  FEGKDQDQIQSAIEALCKKFHPGAF  505



>ref|XP_004494068.1| PREDICTED: uncharacterized protein LOC101502847 isoform X2 [Cicer 
arietinum]
Length=503

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR IIG +CTGD+NEMAQLPEGITELLHH +L +PLIKC NVIIL+ATNV+EL++QWDCL
Sbjct  355  LRHIIGDQCTGDRNEMAQLPEGITELLHHGKLTLPLIKCQNVIILSATNVSELEKQWDCL  414

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LTKS  LL L +P++SK + T L DVEVAQPLSKLCL+FPDI IG YR++R+G L+I 
Sbjct  415  IELTKSNDLLTLLDPYISKHMTTNLSDVEVAQPLSKLCLEFPDICIGCYRKARYGSLIIS  474

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F+GKD +R+E+A +AL K F   AF
Sbjct  475  FKGKDQARIESAIKALQKKFKSEAF  499



>ref|XP_002519482.1| molybdopterin-binding, putative [Ricinus communis]
 gb|EEF42896.1| molybdopterin-binding, putative [Ricinus communis]
Length=512

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHH++L VP+IKC NVIIL ATN+ ELD +W+CL
Sbjct  364  LRHLIGDHCTGDRNEMALLPEGITELLHHDKLPVPMIKCQNVIILAATNIGELDREWECL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             + T+S GLL   EPF +K L T + DVE+AQPLSKLCL+FPD+ IG YR+SR+G L+I 
Sbjct  424  TEFTRSYGLLATMEPFAAKRLTTNISDVEIAQPLSKLCLEFPDLNIGVYRKSRNGTLIIT  483

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGK  +R+++A EAL K FHPG FS ++
Sbjct  484  FEGKKQARIDSAVEALRKKFHPGVFSEMN  512



>ref|XP_004137977.1| PREDICTED: FAD synthase [Cucumis sativus]
 gb|KGN58989.1| hypothetical protein Csa_3G740810 [Cucumis sativus]
Length=512

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPLIKCHNVI+L ATN+TELD QWDCL
Sbjct  358  LRHLIGEHCTGDRNEMAQLPEGITELLHHEKLPVPLIKCHNVIVLTATNLTELDLQWDCL  417

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT++  L  L EP+ SK L T L DVE+A  L+KLCL+FPDI+IG YRE+R G ++I 
Sbjct  418  IELTRTGDLFPLLEPYKSKHLTTKLSDVEIAPSLAKLCLEFPDIHIGCYREARSGPIIIS  477

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F+GK+  R + AAEAL K F PGAF++ +
Sbjct  478  FKGKNEERNQLAAEALSKKFQPGAFTDTN  506



>ref|XP_012082438.1| PREDICTED: FAD synthase isoform X2 [Jatropha curcas]
Length=535

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGIT+LLHHE+L VP+IKC NVIIL ATN+ EL+ +W CL
Sbjct  388  LRHLIGDHCTGDRNEMALLPEGITDLLHHEKLPVPMIKCQNVIILAATNIAELENEWACL  447

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             + T+S GLL + EPFVSK L T L DVE+AQPLSKLC +FPDI IG YR+SR+G  ++ 
Sbjct  448  TESTRSYGLLAMMEPFVSKHLATNLSDVEIAQPLSKLCFEFPDINIGVYRKSRNGSRIVS  507

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGK  +++++A E LCK FHPGAFS +D
Sbjct  508  FEGKQ-AKIDSAIEVLCKKFHPGAFSEID  535



>ref|XP_008442712.1| PREDICTED: FAD synthase [Cucumis melo]
Length=512

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPL+KCHNVI+L ATN+TELD QWDCL
Sbjct  358  LRHLIGEHCTGDRNEMAQLPEGITELLHHEKLPVPLVKCHNVIVLTATNLTELDLQWDCL  417

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT++  L  L EP+ SK L T L DVE+A  L+KLCL+FPDI IG YRE+R G ++I 
Sbjct  418  IELTRTGDLFPLLEPYKSKHLITKLSDVEIAPSLAKLCLEFPDIDIGCYREARSGPIIIS  477

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F+GK+  R + AAEAL K F PGAF+N++
Sbjct  478  FKGKNEERNQLAAEALSKKFQPGAFTNIN  506



>ref|XP_010098792.1| FAD synthase [Morus notabilis]
 gb|EXB75880.1| FAD synthase [Morus notabilis]
Length=511

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR+++G  C GD+NEMA LPEGITELLHHE L VPLIKC NVI+L ATN TEL  QWDCL
Sbjct  361  LRQVVGDYCPGDRNEMALLPEGITELLHHENLPVPLIKCKNVIVLAATNYTELQTQWDCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L++S G+L + +P+V + L T+L DV  A+P+SKLCL+FPD++I  YRES +G LV+ 
Sbjct  421  IELSRSSGVLAVMKPYVLRSLTTSLSDVATAKPISKLCLEFPDLHISCYRESLYGPLVVS  480

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVDRA  371
            F G+D +R+E AAEAL K F PGAF+ ++ +
Sbjct  481  FRGRDQARIELAAEALRKKFEPGAFAEINSS  511



>ref|XP_006491700.1| PREDICTED: uncharacterized protein LOC102612726 isoform X7 [Citrus 
sinensis]
Length=521

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 121/164 (74%), Gaps = 17/164 (10%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNE----------------MAQLPEGITELLHHEQLEVPLIKCHNVII  692
            LR++IG +CTGD+NE                MA LPEG TELLHH++L +PLIKC NVII
Sbjct  358  LRQLIGDRCTGDRNEPYNLGSQETFGIQISQMALLPEGTTELLHHDKLLLPLIKCQNVII  417

Query  691  LNATNVTELDEQWDCLIKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDI  512
            L ATNVTELD++W+CLI+L +S GL  L EP+ SK L T L D+E AQPLSKLCL+FPD+
Sbjct  418  LTATNVTELDKEWNCLIELLRSGGL-SLMEPYTSKSLTTNLSDLEAAQPLSKLCLEFPDL  476

Query  511  YIGGYRESRHGHLVIRFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            +IG YR+SR G L+I FEGKD +R+EAA E+L K FH GAFS V
Sbjct  477  HIGCYRKSRQGPLIISFEGKDQARIEAAIESLFKKFHRGAFSEV  520



>ref|XP_007204563.1| hypothetical protein PRUPE_ppa004416mg [Prunus persica]
 gb|EMJ05762.1| hypothetical protein PRUPE_ppa004416mg [Prunus persica]
Length=511

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMA LPEGITELLHHE+L VPLIKC NVIIL ATN  ELDE+W+CL
Sbjct  361  LRHLIGDQCTGDRNEMALLPEGITELLHHEKLIVPLIKCKNVIILTATNALELDEEWNCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L  S  +L + + FVSK L T L DVE+A+PLSKLCL+FPD+YIG +R+SR   LV+ 
Sbjct  421  IELMTSDDVLLMMQSFVSKHLTTNLTDVEIARPLSKLCLEFPDLYIGCHRKSRKEPLVLY  480

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVDRA  371
            F+GKD  R+E+A EAL K F PGAF  ++ +
Sbjct  481  FKGKDQDRIESAVEALNKKFCPGAFVEINSS  511



>ref|XP_008241395.1| PREDICTED: FAD synthase [Prunus mume]
 ref|XP_008241396.1| PREDICTED: FAD synthase [Prunus mume]
Length=511

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +CTGD+NEMA LPEGITELLHHE+L VPLIKC NVIIL ATN  ELDE+W+CL
Sbjct  361  LRHLIGDQCTGDRNEMALLPEGITELLHHEKLIVPLIKCKNVIILTATNALELDEEWNCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+L +S  +L + + FVSK L T L DVE+A+PLSKLCL+FPD+YIG +R+SR   L++ 
Sbjct  421  IELMRSDDVLLMMQSFVSKHLTTNLTDVEIARPLSKLCLEFPDLYIGCHRKSRKEPLILY  480

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVDRA  371
            F+GKD  R+E+A EAL K F PGAF  ++ +
Sbjct  481  FKGKDKDRIESAIEALNKKFCPGAFVEINSS  511



>ref|XP_006491694.1| PREDICTED: uncharacterized protein LOC102612726 isoform X1 [Citrus 
sinensis]
 ref|XP_006491695.1| PREDICTED: uncharacterized protein LOC102612726 isoform X2 [Citrus 
sinensis]
 ref|XP_006491696.1| PREDICTED: uncharacterized protein LOC102612726 isoform X3 [Citrus 
sinensis]
 ref|XP_006491697.1| PREDICTED: uncharacterized protein LOC102612726 isoform X4 [Citrus 
sinensis]
 ref|XP_006491698.1| PREDICTED: uncharacterized protein LOC102612726 isoform X5 [Citrus 
sinensis]
 ref|XP_006491699.1| PREDICTED: uncharacterized protein LOC102612726 isoform X6 [Citrus 
sinensis]
Length=522

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 121/165 (73%), Gaps = 18/165 (11%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNE-----------------MAQLPEGITELLHHEQLEVPLIKCHNVI  695
            LR++IG +CTGD+NE                 MA LPEG TELLHH++L +PLIKC NVI
Sbjct  358  LRQLIGDRCTGDRNEQPYNLGSQETFGIQISQMALLPEGTTELLHHDKLLLPLIKCQNVI  417

Query  694  ILNATNVTELDEQWDCLIKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPD  515
            IL ATNVTELD++W+CLI+L +S GL  L EP+ SK L T L D+E AQPLSKLCL+FPD
Sbjct  418  ILTATNVTELDKEWNCLIELLRSGGL-SLMEPYTSKSLTTNLSDLEAAQPLSKLCLEFPD  476

Query  514  IYIGGYRESRHGHLVIRFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            ++IG YR+SR G L+I FEGKD +R+EAA E+L K FH GAFS V
Sbjct  477  LHIGCYRKSRQGPLIISFEGKDQARIEAAIESLFKKFHRGAFSEV  521



>ref|XP_010037643.1| PREDICTED: FAD synthase [Eucalyptus grandis]
 ref|XP_010037645.1| PREDICTED: FAD synthase [Eucalyptus grandis]
 gb|KCW49384.1| hypothetical protein EUGRSUZ_K02925 [Eucalyptus grandis]
Length=508

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG +  GD+NEMA LPEGITELLHH++L VPLIKC NVIIL ATNVTELD++WDCL
Sbjct  360  LWQLIGNQSKGDRNEMALLPEGITELLHHDKLPVPLIKCQNVIILTATNVTELDQEWDCL  419

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I L +S G L + +PFVSK L   L DVE A PLSKLCL+FPD+ IG YRESRHG L+I 
Sbjct  420  IDLMRSAGQLVVVDPFVSKRLTANLSDVEAAAPLSKLCLEFPDLCIGCYRESRHGPLIIS  479

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FE KD +R+++A  AL   F P AFS ++
Sbjct  480  FESKDTARIDSAIGALRNKFPPEAFSEIN  508



>ref|XP_010553000.1| PREDICTED: FAD synthase-like [Tarenaya hassleriana]
Length=506

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  ELD +W+CL
Sbjct  358  LRHLIGEHCTGDRNEMAQLPEGITELLHHEKLSVPLIKCCNVIVLTATNTCELDREWECL  417

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G+L L +P+ S+ + T+L DVEVA PLSKLCL+FPDIYIG YR+SR G +VI 
Sbjct  418  TELTKLGGVLALMDPYASRRVMTSLTDVEVAGPLSKLCLEFPDIYIGCYRKSRKGPIVIC  477

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F+G+D +R ++A EAL + F  G F  ++
Sbjct  478  FKGEDKARTDSAVEALREKFKEGVFDEIE  506



>gb|KDO51704.1| hypothetical protein CISIN_1g031335mg [Citrus sinensis]
Length=133

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  778  MAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLELAEP  599
            MA LPEG TELLHH++L +PLIKC NVIIL ATNVTELD++W+CLI+L +S GL  L EP
Sbjct  1    MALLPEGTTELLHHDKLLLPLIKCQNVIILTATNVTELDKEWNCLIELLRSGGL-SLMEP  59

Query  598  FVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIRFEGKDLSRVEAAAEA  419
            + SK L T L D+E AQPLSKLCL+FPD++IG YR+SR G L+I FEGKD +R+EAA E+
Sbjct  60   YTSKSLTTNLSDLEAAQPLSKLCLEFPDLHIGCYRKSRQGPLIISFEGKDQARIEAAIES  119

Query  418  LCKSFHPGAFSNV  380
            L K FH GAFS V
Sbjct  120  LFKKFHRGAFSEV  132



>gb|KDO51701.1| hypothetical protein CISIN_1g031335mg [Citrus sinensis]
Length=161

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = -2

Query  784  NEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLELA  605
            ++MA LPEG TELLHH++L +PLIKC NVIIL ATNVTELD++W+CLI+L +S GL  L 
Sbjct  27   SQMALLPEGTTELLHHDKLLLPLIKCQNVIILTATNVTELDKEWNCLIELLRSGGL-SLM  85

Query  604  EPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIRFEGKDLSRVEAAA  425
            EP+ SK L T L D+E AQPLSKLCL+FPD++IG YR+SR G L+I FEGKD +R+EAA 
Sbjct  86   EPYTSKSLTTNLSDLEAAQPLSKLCLEFPDLHIGCYRKSRQGPLIISFEGKDQARIEAAI  145

Query  424  EALCKSFHPGAFSNV  380
            E+L K FH GAFS V
Sbjct  146  ESLFKKFHRGAFSEV  160



>gb|KDO51703.1| hypothetical protein CISIN_1g031335mg [Citrus sinensis]
Length=153

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = -2

Query  793  GDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLTKSQGLL  614
            G   +MA LPEG TELLHH++L +PLIKC NVIIL ATNVTELD++W+CLI+L +S GL 
Sbjct  16   GFPFQMALLPEGTTELLHHDKLLLPLIKCQNVIILTATNVTELDKEWNCLIELLRSGGL-  74

Query  613  ELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIRFEGKDLSRVE  434
             L EP+ SK L T L D+E AQPLSKLCL+FPD++IG YR+SR G L+I FEGKD +R+E
Sbjct  75   SLMEPYTSKSLTTNLSDLEAAQPLSKLCLEFPDLHIGCYRKSRQGPLIISFEGKDQARIE  134

Query  433  AAAEALCKSFHPGAFSNV  380
            AA E+L K FH GAFS V
Sbjct  135  AAIESLFKKFHRGAFSEV  152



>ref|XP_010684031.1| PREDICTED: FAD synthase [Beta vulgaris subsp. vulgaris]
Length=541

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L  I+G + TGD+NEMAQLPEGITELLHHE L VPL+KC NVI+L ATN  ELD++W+CL
Sbjct  364  LTNIVGYQHTGDRNEMAQLPEGITELLHHENLPVPLMKCQNVIVLMATNPLELDKEWNCL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT S GLL L +PF SK L T L DVEVAQPLS L L FPD+YIG YR+SR G LVI 
Sbjct  424  IELTASSGLLTLTKPFSSKYLTTILSDVEVAQPLSALRLDFPDLYIGCYRKSRSGPLVIT  483

Query  463  FEGKDLSRVEAAAEALCKSFHPGA  392
              GKD  +V+ A EAL K FHPG+
Sbjct  484  LLGKDQGKVQLATEALMKKFHPGS  507



>ref|XP_004494067.1| PREDICTED: uncharacterized protein LOC101502847 isoform X1 [Cicer 
arietinum]
Length=516

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR IIG +CTGD+NEMAQLPEGITELLHH +L +PLIKC NVIIL+ATNV+EL++QWDCL
Sbjct  355  LRHIIGDQCTGDRNEMAQLPEGITELLHHGKLTLPLIKCQNVIILSATNVSELEKQWDCL  414

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LTKS  LL L +P++SK + T L DVEVAQPLSKLCL+FPDI IG YR++R+G L+I 
Sbjct  415  IELTKSNDLLTLLDPYISKHMTTNLSDVEVAQPLSKLCLEFPDICIGCYRKARYGSLIIS  474

Query  463  FEGK  452
            F+GK
Sbjct  475  FKGK  478



>ref|XP_006840651.1| PREDICTED: FAD synthase [Amborella trichopoda]
 gb|ERN02326.1| hypothetical protein AMTR_s00211p00019770 [Amborella trichopoda]
Length=512

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG +C+GD+NEMA LPEGITELLHH+ L VPLIKCHNVI L++TN  ELD+QW CL
Sbjct  360  LRHLIGEECSGDRNEMALLPEGITELLHHDTLPVPLIKCHNVISLSSTNEDELDKQWGCL  419

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESR--HGHLV  470
            +++  S GL+EL  PF SK L T L DV +AQPLSKLCL+FPD+YIG YR++R   G  +
Sbjct  420  LEMNASSGLIELMAPFGSKYLCTRLSDVALAQPLSKLCLEFPDLYIGCYRKARTGSGSTI  479

Query  469  IRFEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            I F GK+ +RV++A + LC  F P AFS  +
Sbjct  480  ISFMGKNQARVDSAVDKLCSMFFPSAFSETE  510



>ref|XP_008796395.1| PREDICTED: FAD synthase-like isoform X2 [Phoenix dactylifera]
Length=512

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 113/148 (76%), Gaps = 2/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD NEMA LPEGITELLHHE L VPLIKC NVIIL ATNV+EL+ QW+CL
Sbjct  364  LRHLIGDHCTGDHNEMALLPEGITELLHHETLPVPLIKCRNVIILAATNVSELEMQWECL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L  S  L+ +A PF+SK L TTL D+E AQ +SKLC+ FPDIYIG +R+SR G L+I 
Sbjct  424  LEL-PSVPLVRMA-PFISKHLSTTLSDIETAQVISKLCIDFPDIYIGCHRKSRAGPLIIS  481

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            F GKD +RVE AAE L + FH GAF  V
Sbjct  482  FVGKDKTRVELAAEKLSRRFHAGAFCGV  509



>ref|XP_006398792.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
 gb|ESQ40245.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
Length=499

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGSSSLIELYASRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  470

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
             +GKD +RV++A +ALCK F    F
Sbjct  471  LKGKDNARVDSAVQALCKKFKQSVF  495



>ref|XP_006398793.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
 ref|XP_006398794.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
 gb|ESQ40246.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
 gb|ESQ40247.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
Length=507

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  359  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  419  TELTKLGGSSSLIELYASRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  478

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
             +GKD +RV++A +ALCK F    F
Sbjct  479  LKGKDNARVDSAVQALCKKFKQSVF  503



>ref|XP_010423718.1| PREDICTED: FAD synthase-like isoform X2 [Camelina sativa]
Length=436

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  289  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  348

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  349  TELTKLGGGSSLTE-YSSRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  407

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R++ AA+ALCK F   AF  +
Sbjct  408  LKGKDNARIDLAAQALCKKFKKDAFVEI  435



>ref|XP_010456377.1| PREDICTED: FAD synthase-like, partial [Camelina sativa]
Length=489

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+E+W+CL
Sbjct  342  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTKELEEEWECL  401

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  402  TELTKLGGGSSLIE-YSSRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSREGPIIIC  460

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R++ AA+ALCK F   AF  +
Sbjct  461  LKGKDNARIDLAAQALCKKFKKDAFVEI  488



>ref|XP_012080795.1| PREDICTED: FAD synthase-like isoform X1 [Jatropha curcas]
 ref|XP_012080796.1| PREDICTED: FAD synthase-like isoform X1 [Jatropha curcas]
 ref|XP_012080797.1| PREDICTED: FAD synthase-like isoform X1 [Jatropha curcas]
Length=519

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE+L VP+IKC NVIIL ATNV ELDE+W+CL
Sbjct  359  LRHLIGEHCTGDRNEMALLPEGITELLHHEKLPVPMIKCQNVIILAATNVAELDEEWECL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTKS  LL + EPFV K + T L DVE+AQPLSKLCL FPDI IG YR+SR+G LVI 
Sbjct  419  TELTKSYNLLPMLEPFVLKQILTNLSDVEIAQPLSKLCLDFPDINIGVYRKSRNGTLVIN  478

Query  463  FEGK  452
            FEGK
Sbjct  479  FEGK  482



>ref|XP_010490819.1| PREDICTED: FAD synthase-like isoform X1 [Camelina sativa]
Length=498

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+E+W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTKELEEEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E   S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGGSSLIES-SSRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  469

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R++ AA+ALCK F   AF  V
Sbjct  470  LKGKDNARIDLAAQALCKKFKKDAFVEV  497



>ref|XP_009384127.1| PREDICTED: FAD synthase-like [Musa acuminata subsp. malaccensis]
Length=509

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITEL+ H +L VPLIKC NVIIL ATNV+EL+ QWDCL
Sbjct  361  LRLLIGKHCTGDRNEMALLPEGITELMQHSKLPVPLIKCQNVIILAATNVSELETQWDCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++ T S  L+ L  PF+SK L T L DVE AQ +SKLCL+FPDIYIG  R+SR G LVI 
Sbjct  421  LE-TPSHPLMRLP-PFMSKHLGTMLSDVETAQTISKLCLEFPDIYIGCQRKSRVGPLVIT  478

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD +R++ AAE L  SF  GAFS  D
Sbjct  479  FVGKDKTRIDLAAEKLSNSFPAGAFSEAD  507



>emb|CDX80868.1| BnaC03g01220D [Brassica napus]
Length=496

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 114/148 (77%), Gaps = 3/148 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTKELEKEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E   SK L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGSTSLME---SKRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRRGPIIIC  467

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R+++A +ALCK F  G F ++
Sbjct  468  LKGKDNARIDSAVQALCKKFKEGVFVDM  495



>ref|XP_010241789.1| PREDICTED: uncharacterized protein LOC104586309 isoform X2 [Nelumbo 
nucifera]
Length=167

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 104/149 (70%), Gaps = 21/149 (14%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NE                     IKC NVIIL ATN+TEL++QWDCL
Sbjct  38   LRHLISDQCTGDRNE---------------------IKCRNVIILTATNITELNKQWDCL  76

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I LT S GLL L EPF+SK L TTL DVE AQPLS+LCL+FPD+YIGG+R+SR G L+I 
Sbjct  77   IDLTSSTGLLVLMEPFLSKQLATTLTDVETAQPLSELCLEFPDLYIGGFRKSRVGPLIIS  136

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD +R+E A + LC+ FHPGAFS V+
Sbjct  137  FVGKDQARIELAKQVLCQKFHPGAFSEVN  165



>ref|XP_010423717.1| PREDICTED: FAD synthase-like isoform X1 [Camelina sativa]
 ref|XP_010423719.1| PREDICTED: FAD synthase-like isoform X3 [Camelina sativa]
Length=498

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGGSSLTE-YSSRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  469

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R++ AA+ALCK F   AF  +
Sbjct  470  LKGKDNARIDLAAQALCKKFKKDAFVEI  497



>ref|XP_010558189.1| PREDICTED: FAD synthase isoform X7 [Tarenaya hassleriana]
 ref|XP_010558190.1| PREDICTED: FAD synthase isoform X7 [Tarenaya hassleriana]
 ref|XP_010558191.1| PREDICTED: FAD synthase isoform X7 [Tarenaya hassleriana]
Length=451

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG    GD+NEMAQLPEGITELLHHE+L +PLIKC NVI+L ATN +ELD++W+CL
Sbjct  305  LRHLIG---QGDRNEMAQLPEGITELLHHEKLPIPLIKCCNVIVLTATNTSELDQEWECL  361

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK   +L + +P+ S+ L T+L DVEVA+PLSKLCL +PDIYIG YR+SR G +VI 
Sbjct  362  TELTKLGSVLAVTQPYTSRRLTTSLTDVEVAEPLSKLCLDYPDIYIGCYRKSRQGPIVIC  421

Query  463  FEGKDLSRVEAAAEALCKSF  404
            F+GKD +R+++A EAL   F
Sbjct  422  FKGKDKARIDSAVEALHNKF  441



>emb|CDX70308.1| BnaA10g26570D [Brassica napus]
Length=499

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I   CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEHCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGSTSLLELYASRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  470

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R+++A +AL K F  G F ++
Sbjct  471  LKGKDNARIDSAVQALRKKFKEGVFVDM  498



>ref|XP_009130755.1| PREDICTED: FAD synthase-like [Brassica rapa]
Length=496

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 112/148 (76%), Gaps = 3/148 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E   SK L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGSTSLME---SKRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIT  467

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R++ A + LCK F  G F ++
Sbjct  468  LKGKDNARIDLAVQGLCKKFKEGVFVDM  495



>emb|CDY44367.1| BnaC02g03100D [Brassica napus]
Length=501

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPL KC NVI+L ATN  EL+++W+CL
Sbjct  353  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLRKCRNVIVLAATNTEELEKEWECL  412

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PL+KL L+FPDIY+G YR+SR G ++I 
Sbjct  413  TELTKLGGSTSLVELYASRRLMTSLTDVEVAEPLNKLGLEFPDIYLGCYRKSRQGPIIIC  472

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            F+GKD +R+++A +AL K F  G F ++
Sbjct  473  FKGKDNARIDSAVQALRKRFKEGVFVDM  500



>ref|XP_010558187.1| PREDICTED: FAD synthase isoform X6 [Tarenaya hassleriana]
Length=470

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG    GD+NEMAQLPEGITELLHHE+L +PLIKC NVI+L ATN +ELD++W+CL
Sbjct  324  LRHLIG---QGDRNEMAQLPEGITELLHHEKLPIPLIKCCNVIVLTATNTSELDQEWECL  380

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK   +L + +P+ S+ L T+L DVEVA+PLSKLCL +PDIYIG YR+SR G +VI 
Sbjct  381  TELTKLGSVLAVTQPYTSRRLTTSLTDVEVAEPLSKLCLDYPDIYIGCYRKSRQGPIVIC  440

Query  463  FEGKDLSRVEAAAEALCKSF  404
            F+GKD +R+++A EAL   F
Sbjct  441  FKGKDKARIDSAVEALHNKF  460



>ref|XP_010558184.1| PREDICTED: FAD synthase isoform X4 [Tarenaya hassleriana]
Length=480

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG    GD+NEMAQLPEGITELLHHE+L +PLIKC NVI+L ATN +ELD++W+CL
Sbjct  334  LRHLIG---QGDRNEMAQLPEGITELLHHEKLPIPLIKCCNVIVLTATNTSELDQEWECL  390

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK   +L + +P+ S+ L T+L DVEVA+PLSKLCL +PDIYIG YR+SR G +VI 
Sbjct  391  TELTKLGSVLAVTQPYTSRRLTTSLTDVEVAEPLSKLCLDYPDIYIGCYRKSRQGPIVIC  450

Query  463  FEGKDLSRVEAAAEALCKSF  404
            F+GKD +R+++A EAL   F
Sbjct  451  FKGKDKARIDSAVEALHNKF  470



>ref|XP_010558185.1| PREDICTED: FAD synthase isoform X5 [Tarenaya hassleriana]
 ref|XP_010558186.1| PREDICTED: FAD synthase isoform X5 [Tarenaya hassleriana]
Length=477

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG    GD+NEMAQLPEGITELLHHE+L +PLIKC NVI+L ATN +ELD++W+CL
Sbjct  331  LRHLIG---QGDRNEMAQLPEGITELLHHEKLPIPLIKCCNVIVLTATNTSELDQEWECL  387

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK   +L + +P+ S+ L T+L DVEVA+PLSKLCL +PDIYIG YR+SR G +VI 
Sbjct  388  TELTKLGSVLAVTQPYTSRRLTTSLTDVEVAEPLSKLCLDYPDIYIGCYRKSRQGPIVIC  447

Query  463  FEGKDLSRVEAAAEALCKSF  404
            F+GKD +R+++A EAL   F
Sbjct  448  FKGKDKARIDSAVEALHNKF  467



>ref|XP_010558181.1| PREDICTED: FAD synthase isoform X1 [Tarenaya hassleriana]
 ref|XP_010558182.1| PREDICTED: FAD synthase isoform X2 [Tarenaya hassleriana]
Length=500

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG    GD+NEMAQLPEGITELLHHE+L +PLIKC NVI+L ATN +ELD++W+CL
Sbjct  354  LRHLIG---QGDRNEMAQLPEGITELLHHEKLPIPLIKCCNVIVLTATNTSELDQEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK   +L + +P+ S+ L T+L DVEVA+PLSKLCL +PDIYIG YR+SR G +VI 
Sbjct  411  TELTKLGSVLAVTQPYTSRRLTTSLTDVEVAEPLSKLCLDYPDIYIGCYRKSRQGPIVIC  470

Query  463  FEGKDLSRVEAAAEALCKSF  404
            F+GKD +R+++A EAL   F
Sbjct  471  FKGKDKARIDSAVEALHNKF  490



>ref|XP_009125503.1| PREDICTED: FAD synthase-like [Brassica rapa]
Length=503

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 114/149 (77%), Gaps = 1/149 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  354  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  413

Query  643  IKLTKSQGLLELAEPFV-SKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVI  467
             +LTK  G   L E +  S+ L T+L DVEVA+PL+KL L+FPDIYIG YR+SR G ++I
Sbjct  414  TELTKLGGSTSLMELYASSRRLMTSLTDVEVAEPLTKLGLEFPDIYIGCYRKSRQGPIII  473

Query  466  RFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
              +GKD +R+++  +ALCK F  G F ++
Sbjct  474  CLKGKDNARIDSGVQALCKRFKEGVFVDM  502



>emb|CDY04882.1| BnaAnng00640D [Brassica napus]
Length=503

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 114/149 (77%), Gaps = 1/149 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  354  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  413

Query  643  IKLTKSQGLLELAEPFV-SKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVI  467
             +LTK  G   L E +  S+ L T+L DVEVA+PL+KL L+FPDIYIG YR+SR G ++I
Sbjct  414  TELTKLGGSTSLMELYASSRRLMTSLTDVEVAEPLTKLGLEFPDIYIGCYRKSRQGPIII  473

Query  466  RFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
              +GKD +R+++  +ALCK F  G F ++
Sbjct  474  CLKGKDNARIDSVVQALCKRFKEGVFVDM  502



>ref|XP_008789471.1| PREDICTED: FAD synthase-like isoform X2 [Phoenix dactylifera]
Length=400

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE L VPLIKC NVIIL ATNV+EL+ +W+CL
Sbjct  253  LRHLIGDHCTGDRNEMALLPEGITELLHHEMLPVPLIKCRNVIILAATNVSELETEWECL  312

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L  S  ++ +A PF SK L T L D+E AQ +SKLC+ FPDIYIG +R+SR G L+I 
Sbjct  313  LQL-PSPPIVRMA-PFKSKHLHTMLSDIETAQVISKLCIDFPDIYIGCHRKSRAGPLIIN  370

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            F GKD +RVE AA+ LC+ F  GA   V
Sbjct  371  FVGKDNTRVELAAQNLCERFPAGAVREV  398



>emb|CDY11253.1| BnaA03g00890D [Brassica napus]
Length=496

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 112/148 (76%), Gaps = 3/148 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E   SK L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGSTSLME---SKRLMTSLTDVEVAKPLSKLGLEFPDIYLGCYRKSRQGPIIIT  467

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R++ A + LC+ F  G F ++
Sbjct  468  LKGKDNARIDLAVQGLCEKFKEGVFVDM  495



>ref|XP_010940692.1| PREDICTED: FAD synthase-like isoform X3 [Elaeis guineensis]
Length=403

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE L VPLIKC NVIIL ATNV+EL+ +W+CL
Sbjct  253  LRHLIGDHCTGDRNEMALLPEGITELLHHEMLPVPLIKCRNVIILAATNVSELETEWECL  312

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L  +   +    PF+SK L T L D+E AQ +SKLC+ F DIYIG +R+SR G L+I 
Sbjct  313  LQLPSTP--VAWMAPFMSKHLSTMLSDIEAAQIISKLCIDFSDIYIGCHRKSRVGPLIIN  370

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            F GKD +R+E AAE LC+ F  G F  V
Sbjct  371  FVGKDNARIELAAENLCQRFPAGVFCEV  398



>gb|KJB62379.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=489

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 103/149 (69%), Gaps = 19/149 (13%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPL                   QWDCL
Sbjct  360  LRHLIGDHCTGDRNEMAQLPEGITELLHHEKLPVPL-------------------QWDCL  400

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            I+LT+S G L   E + SK L T L DVE AQPLSKLCL+FPD+YIG +R SR G LVI 
Sbjct  401  IELTESDGFLVTIESYSSKRLTTNLTDVETAQPLSKLCLEFPDLYIGCFRRSRQGPLVIS  460

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            FEGKD SRV+A  EALCK F+ GAFS V+
Sbjct  461  FEGKDPSRVQAGVEALCKKFNAGAFSEVN  489



>ref|XP_002873090.1| phosphoadenosine phosphosulfate reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49349.1| phosphoadenosine phosphosulfate reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=497

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 114/150 (76%), Gaps = 6/150 (4%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQG--LLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLV  470
             +LTK  G  L+E    + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++
Sbjct  411  TELTKLGGGSLIE----YSSRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPII  466

Query  469  IRFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            I   GKD +R+++AA+ALCK F    F  +
Sbjct  467  ICLTGKDNARIDSAAQALCKKFKKDVFVEI  496



>ref|XP_006287585.1| hypothetical protein CARUB_v10000795mg [Capsella rubella]
 gb|EOA20483.1| hypothetical protein CARUB_v10000795mg [Capsella rubella]
Length=498

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGGSSLLE-YSSRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  469

Query  463  FEGKDLSRVEAAAEALCKSF  404
             +GKD +R++ AA+ALCK F
Sbjct  470  LKGKDNARIDLAAQALCKKF  489



>ref|XP_008789470.1| PREDICTED: FAD synthase-like isoform X1 [Phoenix dactylifera]
Length=511

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE L VPLIKC NVIIL ATNV+EL+ +W+CL
Sbjct  364  LRHLIGDHCTGDRNEMALLPEGITELLHHEMLPVPLIKCRNVIILAATNVSELETEWECL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L  S  ++ +A PF SK L T L D+E AQ +SKLC+ FPDIYIG +R+SR G L+I 
Sbjct  424  LQL-PSPPIVRMA-PFKSKHLHTMLSDIETAQVISKLCIDFPDIYIGCHRKSRAGPLIIN  481

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            F GKD +RVE AA+ LC+ F  GA   V
Sbjct  482  FVGKDNTRVELAAQNLCERFPAGAVREV  509



>ref|XP_010940691.1| PREDICTED: FAD synthase-like isoform X2 [Elaeis guineensis]
Length=429

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE L VPLIKC NVIIL ATNV+EL+ +W+CL
Sbjct  279  LRHLIGDHCTGDRNEMALLPEGITELLHHEMLPVPLIKCRNVIILAATNVSELETEWECL  338

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L  +   +    PF+SK L T L D+E AQ +SKLC+ F DIYIG +R+SR G L+I 
Sbjct  339  LQLPSTP--VAWMAPFMSKHLSTMLSDIEAAQIISKLCIDFSDIYIGCHRKSRVGPLIIN  396

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            F GKD +R+E AAE LC+ F  G F  V
Sbjct  397  FVGKDNARIELAAENLCQRFPAGVFCEV  424



>ref|XP_009420445.1| PREDICTED: FAD synthase-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELL HE+L +PLIKC NVIIL ATNV EL+ QWDCL
Sbjct  361  LRHLIGKHCTGDRNEMALLPEGITELLQHEKLPLPLIKCQNVIILAATNVCELETQWDCL  420

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L  +  L++LA PFVSK L + L DVE+AQ +SKLCL+FPD+YIG  R+SR   L I 
Sbjct  421  LELPNTP-LVQLA-PFVSKHLSSMLSDVEIAQTISKLCLEFPDVYIGCQRKSRVQSL-IS  477

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD +R+E AA  LC SF  GAFS V+
Sbjct  478  FVGKDNTRIELAAGRLCNSFPEGAFSEVN  506



>ref|NP_001132126.1| uncharacterized protein LOC100193543 [Zea mays]
 gb|ACF80831.1| unknown [Zea mays]
Length=186

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L +++G   TGD+NEMAQLPEGITELLHH+ L +PLIKC NVI L ATN+ ELD +WDCL
Sbjct  38   LSQLMGNNYTGDRNEMAQLPEGITELLHHKTLPLPLIKCRNVIALAATNMDELDTEWDCL  97

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+  ++PFVSK L TTL DV++A  L+KLCL+F D+YIG +R SR G LV+ 
Sbjct  98   LG-TQESGLMP-SKPFVSKHLSTTLSDVQIASVLAKLCLEFSDVYIGCHRISRAGPLVVN  155

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
              GKD  RV+AAAE L  SF  G FS ++
Sbjct  156  LTGKDNQRVDAAAEKLTSSFE-GQFSQLN  183



>emb|CDY10380.1| BnaCnng02810D [Brassica napus]
Length=500

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I   CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISEHCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQG-LLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVI  467
             +LTK  G    L E + S+ L T+L DVE+A+PLSKL L+FPDIY+G YR+SR G ++I
Sbjct  411  TELTKLGGSTSSLMELYASRRLMTSLTDVEIAEPLSKLGLEFPDIYLGCYRKSRQGPIII  470

Query  466  RFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
              +GKD +R+++A +AL K F  G F ++
Sbjct  471  CLKGKDNARIDSAVQALRKKFKEGVFVDM  499



>gb|AFW79650.1| hypothetical protein ZEAMMB73_828913 [Zea mays]
Length=145

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 107/145 (74%), Gaps = 3/145 (2%)
 Frame = -2

Query  811  IGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLT  632
            +G   TGD+NEMAQLPEGITELLHH+ L +PLIKC NVI L ATN+ ELD +WDCL+  T
Sbjct  1    MGNNYTGDRNEMAQLPEGITELLHHKTLPLPLIKCRNVIALAATNMDELDTEWDCLLG-T  59

Query  631  KSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIRFEGK  452
            +  GL+  ++PFVSK L TTL DV++A  L+KLCL+F D+YIG +R SR G LV+   GK
Sbjct  60   QESGLMP-SKPFVSKHLSTTLSDVQIASVLAKLCLEFSDVYIGCHRISRAGPLVVNLTGK  118

Query  451  DLSRVEAAAEALCKSFHPGAFSNVD  377
            D  RV+AAAE L  SF  G FS ++
Sbjct  119  DNQRVDAAAEKLTSSFE-GQFSQLN  142



>ref|XP_010940690.1| PREDICTED: FAD synthase-like isoform X1 [Elaeis guineensis]
Length=514

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE L VPLIKC NVIIL ATNV+EL+ +W+CL
Sbjct  364  LRHLIGDHCTGDRNEMALLPEGITELLHHEMLPVPLIKCRNVIILAATNVSELETEWECL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L  +   +    PF+SK L T L D+E AQ +SKLC+ F DIYIG +R+SR G L+I 
Sbjct  424  LQLPSTP--VAWMAPFMSKHLSTMLSDIEAAQIISKLCIDFSDIYIGCHRKSRVGPLIIN  481

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            F GKD +R+E AAE LC+ F  G F  V
Sbjct  482  FVGKDNARIELAAENLCQRFPAGVFCEV  509



>gb|AAK62461.1|AF387016_1 putative protein [Arabidopsis thaliana]
 gb|AAM10037.1| putative protein [Arabidopsis thaliana]
Length=497

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 113/150 (75%), Gaps = 6/150 (4%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGDKNEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISDQCTGDKNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQG--LLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLV  470
             +LTK  G  L+E    + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++
Sbjct  411  TELTKLGGGSLIE----YSSRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPII  466

Query  469  IRFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            I   GKD +R+++AA+AL K F    F  +
Sbjct  467  ICLTGKDNARMDSAAQALRKKFKKDVFVEI  496



>ref|NP_568117.1| phosphoadenosine phosphosulfate (PAPS) reductase family protein 
[Arabidopsis thaliana]
 emb|CAB83302.1| putative protein [Arabidopsis thaliana]
 gb|AED90602.1| phosphoadenosine phosphosulfate (PAPS) reductase family protein 
[Arabidopsis thaliana]
Length=497

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 6/150 (4%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+++W+CL
Sbjct  351  LRHLISDQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELEKEWECL  410

Query  643  IKLTKSQG--LLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLV  470
             +LTK  G  L+E    + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++
Sbjct  411  TELTKLGGGSLIE----YSSRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPII  466

Query  469  IRFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            I   GKD +R+++AA+AL K F    F  +
Sbjct  467  ICLTGKDNARMDSAAQALRKKFKKDVFVEI  496



>ref|XP_010936061.1| PREDICTED: FAD synthase-like isoform X2 [Elaeis guineensis]
Length=512

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD NE+A LPEGITELLHHE L VPLIKC NVII  ATN+ EL+ QW+CL
Sbjct  364  LRHLIGDHCTGDHNELALLPEGITELLHHETLPVPLIKCRNVIIFAATNICELETQWECL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L+ +  L+++A PF+SK L T L D+E AQ +SKL + FPDIYIG +R+SR G L+I 
Sbjct  424  LELSNTP-LVQMA-PFISKHLSTMLSDIETAQVISKLRMDFPDIYIGCHRKSRAGPLIIS  481

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F GK+  RVE AAE L + FH GAF
Sbjct  482  FVGKNKIRVELAAEKLSRRFHAGAF  506



>ref|XP_009122698.1| PREDICTED: FAD synthase-like isoform X1 [Brassica rapa]
Length=461

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I   CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L  TN  EL+++ +C+
Sbjct  313  LRHLISEHCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLADTNTEELEKETECM  372

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  373  TELTKLGGSTSLLELYASRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  432

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R+++A +AL K F  G F ++
Sbjct  433  LKGKDNARIDSAVQALRKKFKEGVFVDM  460



>ref|XP_009122699.1| PREDICTED: FAD synthase-like isoform X2 [Brassica rapa]
Length=499

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I   CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L  TN  EL+++ +C+
Sbjct  351  LRHLISEHCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLADTNTEELEKETECM  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK  G   L E + S+ L T+L DVEVA+PLSKL L+FPDIY+G YR+SR G ++I 
Sbjct  411  TELTKLGGSTSLLELYASRRLMTSLTDVEVAEPLSKLGLEFPDIYLGCYRKSRQGPIIIC  470

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNV  380
             +GKD +R+++A +AL K F  G F ++
Sbjct  471  LKGKDNARIDSAVQALRKKFKEGVFVDM  498



>ref|XP_004967807.1| PREDICTED: uncharacterized protein LOC101755558 [Setaria italica]
Length=507

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L +++G   TGD+NEMA LPEGITELLHH+ L +PLIKC NVI L ATNV ELD +WDCL
Sbjct  359  LSQLMGNNYTGDRNEMALLPEGITELLHHKTLPLPLIKCRNVITLAATNVDELDTEWDCL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL++ A+PFVSK L TTL DV++A  L+KLCL+F D+YIG +R SR G LV+ 
Sbjct  419  LD-TQESGLVQ-AKPFVSKHLSTTLSDVQIAPVLAKLCLEFSDVYIGCHRISRAGPLVVN  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
              GKD  RVEAAAE L  SF  G FS VD
Sbjct  477  LTGKDNQRVEAAAEKLTSSFE-GQFSQVD  504



>gb|AGT16499.1| hypothetical protein SHCRBa_010_E09_R_480 [Saccharum hybrid cultivar 
R570]
Length=287

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L +++G   TGD+NEMA LPEGITELLHH+ L +PLIKC NVI L ATN+ EL+ +WDCL
Sbjct  139  LSQLMGNNYTGDRNEMALLPEGITELLHHKTLPLPLIKCRNVIALAATNMDELETEWDCL  198

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+ + +PFVSK L TTL DV++A  L+KLCL+F D+YIG +R SR G LV+ 
Sbjct  199  LD-TQESGLMPV-KPFVSKHLSTTLSDVQIAPVLAKLCLEFSDVYIGCHRISRAGPLVVN  256

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
              GKD  RV+AAAE L  SF  G FS VD
Sbjct  257  LTGKDNQRVDAAAEKLTSSFE-GQFSQVD  284



>ref|XP_002457596.1| hypothetical protein SORBIDRAFT_03g009960 [Sorghum bicolor]
 gb|EES02716.1| hypothetical protein SORBIDRAFT_03g009960 [Sorghum bicolor]
Length=507

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L +++G   TGD+NEMAQLPEGITELLHH+ L +PLIKC NVI L ATN+ ELD +WDCL
Sbjct  359  LSQLMGNNYTGDRNEMAQLPEGITELLHHKTLPLPLIKCRNVIALGATNMVELDTEWDCL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+   +PFVSK L TT+ DV++A  L+KLCL+F D+YIG +R SR G LV+ 
Sbjct  419  LD-TQESGLMP-TKPFVSKHLSTTVSDVQIAPVLAKLCLEFSDVYIGCHRISRAGPLVVN  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
              GKD  RV+AAAE L  SF  G FS VD
Sbjct  477  LTGKDNQRVDAAAEKLTSSFE-GQFSQVD  504



>ref|XP_010936059.1| PREDICTED: FAD synthase-like isoform X1 [Elaeis guineensis]
Length=513

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD NE+A LPEGITELLHHE L VPLIKC NVII  ATN+ EL+ QW+CL
Sbjct  364  LRHLIGDHCTGDHNELALLPEGITELLHHETLPVPLIKCRNVIIFAATNICELETQWECL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGG-YRESRHGHLVI  467
            ++L+ +  L+++A PF+SK L T L D+E AQ +SKL + FPDIYI G +R+SR G L+I
Sbjct  424  LELSNTP-LVQMA-PFISKHLSTMLSDIETAQVISKLRMDFPDIYIAGCHRKSRAGPLII  481

Query  466  RFEGKDLSRVEAAAEALCKSFHPGAF  389
             F GK+  RVE AAE L + FH GAF
Sbjct  482  SFVGKNKIRVELAAEKLSRRFHAGAF  507



>ref|NP_001042640.2| Os01g0259600 [Oryza sativa Japonica Group]
 dbj|BAD81409.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD81430.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04554.2| Os01g0259600 [Oryza sativa Japonica Group]
Length=343

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG   TGD+NEMA LPEGITELLHH+ L +PLIKC NV+IL ATNV EL+ +W CL
Sbjct  195  LSQLIGDNYTGDRNEMALLPEGITELLHHKMLPLPLIKCKNVVILAATNVDELETEWGCL  254

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+ +A+ FVSK L T+L DV++A  ++KLC+ F D+YIG YR SR G LV+ 
Sbjct  255  LD-TQESGLV-MAKSFVSKHLCTSLLDVKIAPVVAKLCIDFSDVYIGCYRISRSGPLVVS  312

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD  RVEAAAE L  SF  G FS VD
Sbjct  313  FIGKDNQRVEAAAEKLTNSFE-GQFSQVD  340



>ref|XP_010558183.1| PREDICTED: FAD synthase isoform X3 [Tarenaya hassleriana]
Length=497

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 108/140 (77%), Gaps = 6/140 (4%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG    GD+NE   LPEGITELLHHE+L +PLIKC NVI+L ATN +ELD++W+CL
Sbjct  354  LRHLIG---QGDRNE---LPEGITELLHHEKLPIPLIKCCNVIVLTATNTSELDQEWECL  407

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
             +LTK   +L + +P+ S+ L T+L DVEVA+PLSKLCL +PDIYIG YR+SR G +VI 
Sbjct  408  TELTKLGSVLAVTQPYTSRRLTTSLTDVEVAEPLSKLCLDYPDIYIGCYRKSRQGPIVIC  467

Query  463  FEGKDLSRVEAAAEALCKSF  404
            F+GKD +R+++A EAL   F
Sbjct  468  FKGKDKARIDSAVEALHNKF  487



>ref|XP_008654383.1| PREDICTED: uncharacterized protein LOC100193543 isoform X1 [Zea 
mays]
 gb|ACN35205.1| unknown [Zea mays]
 gb|AFW79648.1| hypothetical protein ZEAMMB73_828913 [Zea mays]
Length=507

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L +++G   TGD+NEMAQLPEGITELLHH+ L +PLIKC NVI L ATN+ ELD +WDCL
Sbjct  359  LSQLMGNNYTGDRNEMAQLPEGITELLHHKTLPLPLIKCRNVIALAATNMDELDTEWDCL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+  ++PFVSK L TTL DV++A  L+KLCL+F D+YIG +R SR G LV+ 
Sbjct  419  LG-TQESGLMP-SKPFVSKHLSTTLSDVQIASVLAKLCLEFSDVYIGCHRISRAGPLVVN  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
              GKD  RV+AAAE L  SF  G FS ++
Sbjct  477  LTGKDNQRVDAAAEKLTSSFE-GQFSQLN  504



>gb|EEE54271.1| hypothetical protein OsJ_01171 [Oryza sativa Japonica Group]
Length=497

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG   TGD+NEMA LPEGITELLHH+ L +PLIKC NV+IL ATNV EL+ +W CL
Sbjct  349  LSQLIGDNYTGDRNEMALLPEGITELLHHKMLPLPLIKCKNVVILAATNVDELETEWGCL  408

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+ +A+ FVSK L T+L DV++A  ++KLC+ F D+YIG YR SR G LV+ 
Sbjct  409  LD-TQESGLV-MAKSFVSKHLCTSLLDVKIAPVVAKLCIDFSDVYIGCYRISRSGPLVVS  466

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD  RVEAAAE L  SF  G FS VD
Sbjct  467  FIGKDNQRVEAAAEKLTNSFE-GQFSQVD  494



>gb|EEC70347.1| hypothetical protein OsI_01253 [Oryza sativa Indica Group]
Length=502

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG   TGD+NEMA LPEGITELLHH+ L +PLIKC NV+IL ATNV EL+ +W CL
Sbjct  354  LSQLIGDNYTGDRNEMALLPEGITELLHHKMLPLPLIKCKNVVILAATNVDELETEWGCL  413

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+ +A+ FVSK L T+L DV++A  ++KLC+ F D+YIG YR SR G LV+ 
Sbjct  414  LD-TQESGLV-MAKSFVSKHLCTSLLDVKIAPVVAKLCIDFSDVYIGCYRISRSGPLVVS  471

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            F GKD  RVEAAAE L  SF  G FS VD
Sbjct  472  FLGKDNQRVEAAAEKLTNSFE-GQFSQVD  499



>ref|XP_010230726.1| PREDICTED: FAD synthase [Brachypodium distachyon]
Length=507

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 107/149 (72%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG   TGD+NEMA LPEGITELLHH+ L +PLIKC NVI+L ATNV EL  +W+CL
Sbjct  359  LSQLIGNSYTGDRNEMALLPEGITELLHHKTLPLPLIKCKNVIVLAATNVDELAMEWNCL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+  A+PFVSK L T L DV++A  ++KLCL+F D+YIG +R SR G LV+ 
Sbjct  419  LD-TQESGLVR-AKPFVSKHLRTLLPDVKIAPVVAKLCLEFSDVYIGSHRISRTGPLVVS  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
              GKD  RVE AAE L  SF  G FS VD
Sbjct  477  LVGKDNQRVEGAAEKLASSFE-GQFSQVD  504



>gb|KDO51705.1| hypothetical protein CISIN_1g031335mg [Citrus sinensis]
Length=120

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = -2

Query  778  MAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLELAEP  599
            MA LPEG TELLHH++L +PLIKC NVIIL ATNVTELD++W+CLI+L +S G L L EP
Sbjct  1    MALLPEGTTELLHHDKLLLPLIKCQNVIILTATNVTELDKEWNCLIELLRSGG-LSLMEP  59

Query  598  FVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIRFEGK  452
            + SK L T L D+E AQPLSKLCL+FPD++IG YR+SR G L+I FEGK
Sbjct  60   YTSKSLTTNLSDLEAAQPLSKLCLEFPDLHIGCYRKSRQGPLIISFEGK  108



>emb|CDM82643.1| unnamed protein product [Triticum aestivum]
Length=507

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG    G++NEMA LPEGITELLHH+ L +PLIKC NVIIL+ATNV ELD +W+CL
Sbjct  359  LSQLIGNSYIGNRNEMALLPEGITELLHHKMLPLPLIKCKNVIILSATNVDELDMEWNCL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GLL   +PFVSK L T L DV++A  ++KLCL+F D+YIG +R SR G LV+ 
Sbjct  419  LD-TQESGLLR-TKPFVSKHLSTLLPDVKIAPVVAKLCLEFSDVYIGSHRISRTGPLVVS  476

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
              GKD  RVE AA  L  SF  G FS VD
Sbjct  477  LIGKDYQRVEGAAAKLSGSFE-GLFSQVD  504



>ref|XP_010267372.1| PREDICTED: uncharacterized protein LOC104604633 [Nelumbo nucifera]
Length=721

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  715  IKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSK  536
            IKC NVIIL ATN+TELD+QWDCLI+LT S G L L +PFVSK L TTL DVE AQ LSK
Sbjct  607  IKCRNVIILTATNITELDKQWDCLIELTSSSGPLILMKPFVSKQLSTTLTDVETAQTLSK  666

Query  535  LCLQFPDIYIGGYRESRHGHLVIRFEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
            LCL+FPD+YIG +R+SR G L+I F GKD +R E A +ALC+ FHPGAFS V+
Sbjct  667  LCLEFPDLYIGAFRKSRVGPLIISFVGKDQARTEMAVQALCQKFHPGAFSEVN  719



>gb|KDO51702.1| hypothetical protein CISIN_1g031335mg [Citrus sinensis]
Length=156

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = -2

Query  715  IKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSK  536
            IKC NVIIL ATNVTELD++W+CLI+L +S GL  L EP+ SK L T L D+E AQPLSK
Sbjct  45   IKCQNVIILTATNVTELDKEWNCLIELLRSGGL-SLMEPYTSKSLTTNLSDLEAAQPLSK  103

Query  535  LCLQFPDIYIGGYRESRHGHLVIRFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
            LCL+FPD++IG YR+SR G L+I FEGKD +R+EAA E+L K FH GAFS V
Sbjct  104  LCLEFPDLHIGCYRKSRQGPLIISFEGKDQARIEAAIESLFKKFHRGAFSEV  155



>ref|XP_011018779.1| PREDICTED: FAD synthase isoform X2 [Populus euphratica]
Length=467

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE+L VPLIKC NVII  ATN TELD++WDCL
Sbjct  357  LRHLIGDHCTGDQNEMALLPEGITELLHHEKLAVPLIKCQNVIIFTATNATELDKEWDCL  416

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIG  503
            I+LT+S G L    P+VSK L+T L DVE AQPLSKL L+FPD+ IG
Sbjct  417  IELTRSCGFLPTMVPYVSKHLQTNLSDVETAQPLSKLSLEFPDLNIG  463



>ref|XP_010908719.1| PREDICTED: uncharacterized protein LOC105035029 [Elaeis guineensis]
Length=417

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMA LPEGITELLHHE L VPLIKC NVIIL ATNV+EL+ +W+CL
Sbjct  275  LRHLIGDHCTGDRNEMALLPEGITELLHHEMLPVPLIKCRNVIILAATNVSELETEWECL  334

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            ++L  S  ++ +A PF+SK L T L D+E AQ +SKLC+ F DIYIG +R+SR G L+I 
Sbjct  335  LQLP-STPVVRMA-PFMSKQLSTMLSDIEAAQVISKLCIDFSDIYIGCHRKSRVGPLIIN  392

Query  463  FEGK  452
            F GK
Sbjct  393  FVGK  396



>ref|XP_010936065.1| PREDICTED: probable FAD synthase isoform X6 [Elaeis guineensis]
Length=445

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -2

Query  787  KNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLEL  608
            +N++A LPEGITELLHHE L VPLIKC NVII  ATN+ EL+ QW+CL++L+ +  L+++
Sbjct  308  QNDLALLPEGITELLHHETLPVPLIKCRNVIIFAATNICELETQWECLLELSNTP-LVQM  366

Query  607  AEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGG-YRESRHGHLVIRFEGKDLSRVEA  431
            A PF+SK L T L D+E AQ +SKL + FPDIYI G +R+SR G L+I F GK+  RVE 
Sbjct  367  A-PFISKHLSTMLSDIETAQVISKLRMDFPDIYIAGCHRKSRAGPLIISFVGKNKIRVEL  425

Query  430  AAEALCKSFHPGAF  389
            AAE L + FH GAF
Sbjct  426  AAEKLSRRFHAGAF  439



>gb|ADE76044.1| unknown [Picea sitchensis]
Length=523

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 12/160 (8%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR+ IG + +GD+NEMA+LPEGITELLHH +L VPLIKC NVI+L+AT V EL  QW+CL
Sbjct  364  LRQFIGEEYSGDQNEMARLPEGITELLHHNELPVPLIKCQNVIVLSATTVPELGLQWNCL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESR---HGHL  473
            ++L K   +L++  P+VSK L T + +V +A+PLS++  +FPD+ IG YRESR   H  +
Sbjct  424  LELRKENAVLQVKAPYVSKYLRTKVSEVAIAEPLSRIHSEFPDLSIGCYRESRIAFHASM  483

Query  472  ---------VIRFEGKDLSRVEAAAEALCKSFHPGAFSNV  380
                     V+   GK+  RV++A + L  +F  G FS +
Sbjct  484  PNQRNQPTVVVTVVGKNSLRVQSAVDKLYSAFSKGTFSEI  523



>gb|KCW49385.1| hypothetical protein EUGRSUZ_K02925 [Eucalyptus grandis]
Length=477

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG +  GD+NEMA LPEGITELLHH++L VPLIKC NVIIL ATNVTELD++WDCL
Sbjct  360  LWQLIGNQSKGDRNEMALLPEGITELLHHDKLPVPLIKCQNVIILTATNVTELDQEWDCL  419

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRE  491
            I L +S G L + +PFVSK L   L DVE A PLSKLCL+FPD+ IG  R 
Sbjct  420  IDLMRSAGQLVVVDPFVSKRLTANLSDVEAAAPLSKLCLEFPDLCIGKLRN  470



>ref|XP_010936062.1| PREDICTED: FAD synthase-like isoform X3 [Elaeis guineensis]
Length=489

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 3/131 (2%)
 Frame = -2

Query  778  MAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLELAEP  599
            +A LPEGITELLHHE L VPLIKC NVII  ATN+ EL+ QW+CL++L+ +  L+++A P
Sbjct  355  LALLPEGITELLHHETLPVPLIKCRNVIIFAATNICELETQWECLLELSNTP-LVQMA-P  412

Query  598  FVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGG-YRESRHGHLVIRFEGKDLSRVEAAAE  422
            F+SK L T L D+E AQ +SKL + FPDIYI G +R+SR G L+I F GK+  RVE AAE
Sbjct  413  FISKHLSTMLSDIETAQVISKLRMDFPDIYIAGCHRKSRAGPLIISFVGKNKIRVELAAE  472

Query  421  ALCKSFHPGAF  389
             L + FH GAF
Sbjct  473  KLSRRFHAGAF  483



>gb|AFW79649.1| hypothetical protein ZEAMMB73_828913 [Zea mays]
Length=490

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L +++G   TGD+NEMAQLPEGITELLHH+ L +PLIKC NVI L ATN+ ELD +WDCL
Sbjct  359  LSQLMGNNYTGDRNEMAQLPEGITELLHHKTLPLPLIKCRNVIALAATNMDELDTEWDCL  418

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+  ++PFVSK L TTL DV++A  L+KLCL+F D+YIG +R SR G LV+ 
Sbjct  419  LG-TQESGLMP-SKPFVSKHLSTTLSDVQIASVLAKLCLEFSDVYIGCHRISRAGPLVVN  476

Query  463  FEGK  452
              GK
Sbjct  477  LTGK  480



>ref|XP_006644015.1| PREDICTED: uncharacterized protein LOC102722152 [Oryza brachyantha]
Length=501

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG   TGD+NEMA LPEGIT+LLHH+ L +P+IKC NV+I  ATNV EL+ +W CL
Sbjct  353  LSQLIGDNYTGDRNEMALLPEGITDLLHHKLLPLPMIKCKNVVIFAATNVDELETEWGCL  412

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
            +  T+  GL+ +A+PFVSK L T+L DV+++  ++KLC+ F D+YIG +R SR G LV+ 
Sbjct  413  LD-TQGSGLV-MAKPFVSKHLSTSLLDVKISPVVAKLCIDFSDVYIGCHRISRSGPLVVS  470

Query  463  FEGKDLSRVEAAAEALCKSFHPGAFSNVD  377
              GKD  RVEAAA+ L  SF  G FS VD
Sbjct  471  LIGKDNQRVEAAAQKLTSSFE-GQFSQVD  498



>gb|KJB62375.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=456

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L+ATN TEL++QWDCL
Sbjct  360  LRHLIGDHCTGDRNEMAQLPEGITELLHHEKLPVPLIKCCNVIVLSATNATELEKQWDCL  419

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVA  551
            I+LT+S G L   E + SK L T L DV + 
Sbjct  420  IELTESDGFLVTIESYSSKRLTTNLTDVHIT  450



>gb|KCW49386.1| hypothetical protein EUGRSUZ_K02925 [Eucalyptus grandis]
Length=458

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            L ++IG +  GD+NEMA LPEGITELLHH++L VPLIKC NVIIL ATNVTELD++WDCL
Sbjct  360  LWQLIGNQSKGDRNEMALLPEGITELLHHDKLPVPLIKCQNVIILTATNVTELDQEWDCL  419

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVA  551
            I L +S G L + +PFVSK L   L DV  +
Sbjct  420  IDLMRSAGQLVVVDPFVSKRLTANLSDVRYS  450



>ref|XP_008796393.1| PREDICTED: FAD synthase-like isoform X1 [Phoenix dactylifera]
Length=548

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD NEMA LPEGITELLHHE L VPLIKC NVIIL ATNV+EL+ QW+CL
Sbjct  364  LRHLIGDHCTGDHNEMALLPEGITELLHHETLPVPLIKCRNVIILAATNVSELEMQWECL  423

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFD  563
            ++L  S  L+ +A PF+SK L TTL D
Sbjct  424  LEL-PSVPLVRMA-PFISKHLSTTLSD  448



>ref|XP_010490820.1| PREDICTED: FAD synthase-like isoform X2 [Camelina sativa]
Length=462

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+E+W+CL
Sbjct  351  LRHLISEQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTKELEEEWECL  410

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQ  524
             +LTK  G   L E   S+ L T+L DV  +  L+  C Q
Sbjct  411  TELTKLGGGSSLIES-SSRRLMTSLTDVCFS--LAMACFQ  447



>gb|KDO51706.1| hypothetical protein CISIN_1g031335mg [Citrus sinensis]
Length=84

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = -2

Query  778  MAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLELAEP  599
            MA LPEG TELLHH++L +PLIKC NVIIL ATNVTELD++W+CLI+L +S G L L EP
Sbjct  1    MALLPEGTTELLHHDKLLLPLIKCQNVIILTATNVTELDKEWNCLIELLRSGG-LSLMEP  59

Query  598  FVSKCLETTLFDVEVAQPLSKLC  530
            + SK L T L DV V + L+  C
Sbjct  60   YTSKSLTTNLSDVCVKRSLACCC  82



>ref|XP_010936064.1| PREDICTED: FAD synthase-like isoform X5 [Elaeis guineensis]
Length=463

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 71/145 (49%), Gaps = 51/145 (35%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD NE+A LPEGITELLHHE L VPLI                       
Sbjct  364  LRHLIGDHCTGDHNELALLPEGITELLHHETLPVPLI-----------------------  400

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGGYRESRHGHLVIR  464
                                        E AQ +SKL + FPDIYIG +R+SR G L+I 
Sbjct  401  ----------------------------ETAQVISKLRMDFPDIYIGCHRKSRAGPLIIS  432

Query  463  FEGKDLSRVEAAAEALCKSFHPGAF  389
            F GK+  RVE AAE L + FH GAF
Sbjct  433  FVGKNKIRVELAAEKLSRRFHAGAF  457



>ref|XP_010936063.1| PREDICTED: FAD synthase-like isoform X4 [Elaeis guineensis]
Length=464

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 71/146 (49%), Gaps = 52/146 (36%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCL  644
            LR +IG  CTGD NE+A LPEGITELLHHE L VPLI                       
Sbjct  364  LRHLIGDHCTGDHNELALLPEGITELLHHETLPVPLI-----------------------  400

Query  643  IKLTKSQGLLELAEPFVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGG-YRESRHGHLVI  467
                                        E AQ +SKL + FPDIYI G +R+SR G L+I
Sbjct  401  ----------------------------ETAQVISKLRMDFPDIYIAGCHRKSRAGPLII  432

Query  466  RFEGKDLSRVEAAAEALCKSFHPGAF  389
             F GK+  RVE AAE L + FH GAF
Sbjct  433  SFVGKNKIRVELAAEKLSRRFHAGAF  458



>dbj|BAF00583.1| hypothetical protein [Arabidopsis thaliana]
Length=408

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQ  656
            LR +I  +CTGD+NEMAQLPEGITELLHHE+L VPLIKC NVI+L ATN  EL+ +
Sbjct  351  LRHLISDQCTGDRNEMAQLPEGITELLHHEKLSVPLIKCRNVIVLAATNTEELENR  406



>gb|AFK39867.1| unknown [Medicago truncatula]
Length=413

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNV  674
            LR+IIG +C GD+NEMAQLPEGITELLHH+ L VPL+KC NVIIL+AT++
Sbjct  354  LRKIIGDQCIGDRNEMAQLPEGITELLHHDSLTVPLMKCQNVIILSATDI  403



>tpg|DAA54006.1| TPA: hypothetical protein ZEAMMB73_599926 [Zea mays]
Length=51

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  811  IGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELD  662
            +G   TGD+NEMA LPEGIT+LLHH+ L +PLIKC N I L ATN+ ELD
Sbjct  1    MGNNYTGDRNEMALLPEGITQLLHHKTLPLPLIKCGNAIALAATNMDELD  50



>ref|XP_010936066.1| PREDICTED: probable FAD synthase isoform X7 [Elaeis guineensis]
Length=440

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 60/131 (46%), Gaps = 52/131 (40%)
 Frame = -2

Query  778  MAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVTELDEQWDCLIKLTKSQGLLELAEP  599
            +A LPEGITELLHHE L VPLI                                      
Sbjct  355  LALLPEGITELLHHETLPVPLI--------------------------------------  376

Query  598  FVSKCLETTLFDVEVAQPLSKLCLQFPDIYIGG-YRESRHGHLVIRFEGKDLSRVEAAAE  422
                         E AQ +SKL + FPDIYI G +R+SR G L+I F GK+  RVE AAE
Sbjct  377  -------------ETAQVISKLRMDFPDIYIAGCHRKSRAGPLIISFVGKNKIRVELAAE  423

Query  421  ALCKSFHPGAF  389
             L + FH GAF
Sbjct  424  KLSRRFHAGAF  434



>ref|XP_002976522.1| hypothetical protein SELMODRAFT_54778, partial [Selaginella moellendorffii]
 gb|EFJ22191.1| hypothetical protein SELMODRAFT_54778, partial [Selaginella moellendorffii]
Length=414

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILN  686
            LR+++G  C GD+N MA+LPEGITELLHH++L +P+IKC NV +L+
Sbjct  369  LRQLVGDNCAGDQNAMARLPEGITELLHHKRLSIPVIKCRNVFVLS  414



>ref|XP_002973384.1| hypothetical protein SELMODRAFT_54760, partial [Selaginella moellendorffii]
 gb|EFJ25758.1| hypothetical protein SELMODRAFT_54760, partial [Selaginella moellendorffii]
Length=414

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILN  686
            LR+++G  C GD+N MA+LPEGITELLHH++L +P+IKC NV +L+
Sbjct  369  LRQLVGDNCAGDQNAMARLPEGITELLHHKRLSIPVIKCRNVFVLS  414



>gb|KJB62376.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
 gb|KJB62377.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=411

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLIKCHNVIILNATNVT  671
            LR +IG  CTGD+NEMAQLPEGITELLHHE+L VPL+  +   +L   N+ 
Sbjct  360  LRHLIGDHCTGDRNEMAQLPEGITELLHHEKLPVPLVGVYFKTLLRKMNLN  410



>gb|KCW49387.1| hypothetical protein EUGRSUZ_K02925 [Eucalyptus grandis]
Length=407

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  823  LRRIIGGKCTGDKNEMAQLPEGITELLHHEQLEVPLI  713
            L ++IG +  GD+NEMA LPEGITELLHH++L VPL+
Sbjct  360  LWQLIGNQSKGDRNEMALLPEGITELLHHDKLPVPLV  396



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1752198629708