BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5361

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003593909.1|  hypothetical protein MTR_2g019240                  102   4e-24   Medicago truncatula
ref|XP_006352971.1|  PREDICTED: uncharacterized protein LOC102585170    102   5e-24   Solanum tuberosum [potatoes]
ref|XP_010316935.1|  PREDICTED: uncharacterized protein LOC104645894    101   1e-23   Solanum lycopersicum
ref|XP_006377603.1|  hypothetical protein POPTR_0011s08260g             100   2e-23   
gb|ABK92885.1|  unknown                                                 100   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011460205.1|  PREDICTED: uncharacterized protein LOC105350255  99.8    6e-23   Fragaria vesca subsp. vesca
ref|XP_006594502.1|  PREDICTED: uncharacterized protein LOC102668493  99.4    1e-22   Glycine max [soybeans]
ref|XP_002277427.1|  PREDICTED: uncharacterized protein LOC100243015  98.2    2e-22   Vitis vinifera
ref|XP_009794048.1|  PREDICTED: uncharacterized protein LOC104240854  97.1    5e-22   Nicotiana sylvestris
ref|XP_011658293.1|  PREDICTED: uncharacterized protein LOC101212042  96.7    9e-22   Cucumis sativus [cucumbers]
ref|XP_008366004.1|  PREDICTED: uncharacterized protein LOC103429650  95.9    2e-21   Malus domestica [apple tree]
ref|XP_008439626.1|  PREDICTED: uncharacterized protein LOC103484363  95.5    2e-21   Cucumis melo [Oriental melon]
emb|CDY43665.1|  BnaA04g20260D                                        95.1    3e-21   Brassica napus [oilseed rape]
ref|XP_010248033.1|  PREDICTED: uncharacterized protein LOC104590955  94.7    4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009141391.1|  PREDICTED: uncharacterized protein LOC103865346  94.0    8e-21   Brassica rapa
ref|XP_009360893.1|  PREDICTED: uncharacterized protein LOC103951282  93.6    2e-20   Pyrus x bretschneideri [bai li]
gb|KHN06972.1|  hypothetical protein glysoja_032815                   91.3    1e-19   Glycine soja [wild soybean]
gb|EYU43661.1|  hypothetical protein MIMGU_mgv1a017429mg              88.2    7e-19   Erythranthe guttata [common monkey flower]
emb|CDP19519.1|  unnamed protein product                              87.8    1e-18   Coffea canephora [robusta coffee]
gb|EYU33371.1|  hypothetical protein MIMGU_mgv1a017439mg              87.4    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_008787806.1|  PREDICTED: uncharacterized protein LOC103705741  88.6    2e-18   
ref|XP_011620806.1|  PREDICTED: uncharacterized protein LOC18427321   86.3    4e-18   Amborella trichopoda
ref|XP_002519671.1|  conserved hypothetical protein                   86.3    5e-18   Ricinus communis
ref|XP_004486018.1|  PREDICTED: uncharacterized protein LOC101512336  83.2    6e-17   Cicer arietinum [garbanzo]
gb|EMT32170.1|  hypothetical protein F775_43897                       82.8    9e-17   
ref|XP_010668026.1|  PREDICTED: uncharacterized protein LOC104885010  82.4    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009623189.1|  PREDICTED: uncharacterized protein LOC104114438  83.2    1e-16   Nicotiana tomentosiformis
ref|XP_010110958.1|  hypothetical protein L484_021652                 82.4    1e-16   Morus notabilis
gb|EPS70466.1|  hypothetical protein M569_04305                       80.9    3e-16   Genlisea aurea
ref|XP_009408527.1|  PREDICTED: uncharacterized protein LOC103990943  80.9    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008225492.1|  PREDICTED: uncharacterized protein LOC103325133  80.9    5e-16   Prunus mume [ume]
ref|XP_003557596.1|  PREDICTED: uncharacterized protein LOC100843802  80.5    6e-16   Brachypodium distachyon [annual false brome]
ref|XP_007213992.1|  hypothetical protein PRUPE_ppa014074mg           80.5    7e-16   Prunus persica
gb|ABK25746.1|  unknown                                               79.7    1e-15   Picea sitchensis
ref|XP_004955482.1|  PREDICTED: uncharacterized protein LOC101767780  79.7    1e-15   Setaria italica
ref|XP_011096578.1|  PREDICTED: uncharacterized protein LOC105175727  79.3    2e-15   Sesamum indicum [beniseed]
ref|XP_002459358.1|  hypothetical protein SORBIDRAFT_02g003250        79.3    2e-15   Sorghum bicolor [broomcorn]
ref|XP_006410605.1|  hypothetical protein EUTSA_v10017600mg           79.3    2e-15   Eutrema salsugineum [saltwater cress]
ref|NP_001058914.1|  Os07g0154300                                     78.2    4e-15   
gb|ACG27377.1|  hypothetical protein                                  78.2    4e-15   Zea mays [maize]
gb|ACG37211.1|  hypothetical protein                                  77.8    5e-15   Zea mays [maize]
ref|XP_008670982.1|  PREDICTED: uncharacterized protein LOC100303895  77.8    2e-14   Zea mays [maize]
ref|XP_010056946.1|  PREDICTED: uncharacterized protein LOC104444871  76.6    2e-14   Eucalyptus grandis [rose gum]
ref|XP_002881345.1|  hypothetical protein ARALYDRAFT_902544           76.3    2e-14   Arabidopsis lyrata subsp. lyrata
ref|NP_565793.1|  uncharacterized protein                             75.9    3e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36361.1|  hypothetical protein AALP_AA4G113400                  75.9    3e-14   Arabis alpina [alpine rockcress]
ref|XP_006467458.1|  PREDICTED: uncharacterized protein LOC102611820  75.5    3e-14   Citrus sinensis [apfelsine]
ref|XP_012072115.1|  PREDICTED: uncharacterized protein LOC105633999  75.5    4e-14   Jatropha curcas
ref|XP_007147911.1|  hypothetical protein PHAVU_006G165400g           74.3    7e-14   Phaseolus vulgaris [French bean]
gb|KDO78196.1|  hypothetical protein CISIN_1g034996mg                 74.3    1e-13   Citrus sinensis [apfelsine]
ref|XP_007025063.1|  Uncharacterized protein TCM_029473               74.3    1e-13   
ref|XP_006295340.1|  hypothetical protein CARUB_v10024431mg           73.9    1e-13   Capsella rubella
ref|XP_010549491.1|  PREDICTED: uncharacterized protein LOC104820651  73.6    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_006449706.1|  hypothetical protein CICLE_v10017916mg           61.6    3e-09   Citrus clementina [clementine]
gb|AFG44474.1|  hypothetical protein CL2409Contig1_01                 60.1    1e-08   Pinus taeda
gb|ADE77763.1|  unknown                                               59.3    2e-08   Picea sitchensis
gb|ABK23688.1|  unknown                                               58.9    3e-08   Picea sitchensis
gb|AEW08948.1|  hypothetical protein CL2409Contig1_01                 57.8    7e-08   Pinus radiata
gb|AFG44463.1|  hypothetical protein CL2409Contig1_01                 56.6    2e-07   Pinus taeda
ref|XP_001759335.1|  predicted protein                                53.1    3e-06   
ref|XP_003570233.1|  PREDICTED: uncharacterized protein LOC100835108  52.8    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_010684331.1|  PREDICTED: 6.7 kDa chloroplast outer envelop...  49.3    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004953688.1|  PREDICTED: salt stress root protein RS1-like     49.3    2e-04   Setaria italica
gb|EMS45753.1|  hypothetical protein TRIUR3_22777                     48.1    2e-04   Triticum urartu
ref|NP_001047926.1|  Os02g0715400                                     48.1    4e-04   



>ref|XP_003593909.1| hypothetical protein MTR_2g019240 [Medicago truncatula]
 gb|AES64160.1| transmembrane protein, putative [Medicago truncatula]
Length=70

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 4/67 (6%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA----RVPLN  361
            MGA+T ++IA+ GVILGWITIE+ACKPCLE+GR+A+DRNLNPDYDPDD D+    R PLN
Sbjct  1    MGAITGAVIAVVGVILGWITIEIACKPCLEQGRQAIDRNLNPDYDPDDEDSAAAVRAPLN  60

Query  362  PDPTPAE  382
            P P  A+
Sbjct  61   PAPVAAK  67



>ref|XP_006352971.1| PREDICTED: uncharacterized protein LOC102585170 [Solanum tuberosum]
Length=77

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA-RVPLN  361
            MGALT +LIAIAGVILGWITIEMACKPCLEKGREA+D+NLNPDYDPDD D+ R PL 
Sbjct  1    MGALTTALIAIAGVILGWITIEMACKPCLEKGREAIDQNLNPDYDPDDEDSIRAPLT  57



>ref|XP_010316935.1| PREDICTED: uncharacterized protein LOC104645894 [Solanum lycopersicum]
Length=77

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD-HDARVPLNPDP  370
            MGALT +LIAI GV+LGWITIEMACKPCLEKGREA+D+NLNPDYDPDD H  R PL  + 
Sbjct  1    MGALTTALIAIGGVVLGWITIEMACKPCLEKGREAIDQNLNPDYDPDDQHSIREPLTANA  60

Query  371  T  373
            T
Sbjct  61   T  61



>ref|XP_006377603.1| hypothetical protein POPTR_0011s08260g, partial [Populus trichocarpa]
 gb|ERP55400.1| hypothetical protein POPTR_0011s08260g, partial [Populus trichocarpa]
Length=76

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNP  364
            M A+T++LIAIAGV+LGWI IE+ACKPCLEKGREA+DR+LNPDYDPDD + RVP+NP
Sbjct  18   MAAVTSALIAIAGVVLGWIAIEIACKPCLEKGREAIDRSLNPDYDPDDDEIRVPINP  74



>gb|ABK92885.1| unknown [Populus trichocarpa]
Length=59

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNP  364
            M A+T++LIAIAGV+LGWI IE+ACKPCLEKGREA+DR+LNPDYDPDD + RVP+NP
Sbjct  1    MAAVTSALIAIAGVVLGWIAIEIACKPCLEKGREAIDRSLNPDYDPDDDEIRVPINP  57



>ref|XP_011460205.1| PREDICTED: uncharacterized protein LOC105350255 [Fragaria vesca 
subsp. vesca]
Length=82

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 2/57 (4%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNP  364
            MGA+T+++IAIAGV+LGWITIE+ACKPCLE+GREA+DRNLNPDYDPD  D R PLNP
Sbjct  1    MGAITSAVIAIAGVVLGWITIEIACKPCLEQGREAIDRNLNPDYDPD--DIRAPLNP  55



>ref|XP_006594502.1| PREDICTED: uncharacterized protein LOC102668493 [Glycine max]
 gb|KHN47329.1| hypothetical protein glysoja_020197 [Glycine soja]
Length=100

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNPDPT  373
            MGA+T+++IA+ GV+LGWITIE+ACKPCLEKGREA+DR+L+PDYDPDD   R PLNP   
Sbjct  34   MGAITSAVIAVVGVLLGWITIEIACKPCLEKGREAIDRSLDPDYDPDDTAIRAPLNPTAA  93

Query  374  PA  379
             A
Sbjct  94   SA  95



>ref|XP_002277427.1| PREDICTED: uncharacterized protein LOC100243015 [Vitis vinifera]
 ref|XP_010655677.1| PREDICTED: uncharacterized protein LOC100243015 [Vitis vinifera]
Length=85

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 3/60 (5%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH---DARVPLNP  364
            MG LT+++IAIAGV+LGWITIE+ACKPCLE+GR+A+DR+LNPDYDPDD    D R PLNP
Sbjct  1    MGGLTSAVIAIAGVVLGWITIEIACKPCLEQGRQAIDRSLNPDYDPDDDQNVDIRAPLNP  60



>ref|XP_009794048.1| PREDICTED: uncharacterized protein LOC104240854 [Nicotiana sylvestris]
Length=73

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNPDPT  373
            MG +T ++IAIAGVILGWITIE+ACKPCLEK REA+D+NLNPDY PDD D R PLN +PT
Sbjct  1    MGVITTAVIAIAGVILGWITIEIACKPCLEKDREAIDQNLNPDYGPDD-DIRSPLNANPT  59



>ref|XP_011658293.1| PREDICTED: uncharacterized protein LOC101212042 [Cucumis sativus]
 gb|KGN49402.1| hypothetical protein Csa_6G523430 [Cucumis sativus]
Length=86

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 2/61 (3%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH--DARVPLNPD  367
            MGA+T ++IAI  V+ GWITIE+ACKPCLEKGREA+DR+LNPD+DPDD   D R PLNP+
Sbjct  1    MGAITTAVIAIGAVVAGWITIEIACKPCLEKGREAIDRSLNPDFDPDDEVSDIRAPLNPN  60

Query  368  P  370
            P
Sbjct  61   P  61



>ref|XP_008366004.1| PREDICTED: uncharacterized protein LOC103429650 [Malus domestica]
Length=89

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNP  364
            MGA+TAS+IAI GV+LGWI IE+ACKPCLE+GR+A+DR+LNPDYDPDD D   PLNP
Sbjct  1    MGAITASVIAIVGVVLGWIAIEIACKPCLEQGRQAIDRSLNPDYDPDD-DVSAPLNP  56



>ref|XP_008439626.1| PREDICTED: uncharacterized protein LOC103484363 [Cucumis melo]
Length=86

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH--DARVPLNPD  367
            MGA+T ++IAI  V+ GWITIE+ACKPCLEKGREA+DR+LNPDYDPDD   D R PLNP+
Sbjct  1    MGAITTAVIAIGAVVAGWITIEIACKPCLEKGREAIDRSLNPDYDPDDEVSDIRAPLNPN  60



>emb|CDY43665.1| BnaA04g20260D [Brassica napus]
Length=85

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHD  343
            M A+T ++IAIAG+ILGWITIEMACKPCLEKGREA+DR+LNPDYDPDD D
Sbjct  1    MAAITTAVIAIAGIILGWITIEMACKPCLEKGREAIDRSLNPDYDPDDED  50



>ref|XP_010248033.1| PREDICTED: uncharacterized protein LOC104590955 [Nelumbo nucifera]
Length=87

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 4/62 (6%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD----HDARVPLN  361
            M A+T+++IAIA VILGWITIE+ACKPCLEKGREA+DR+LNPDYDPD+       R PLN
Sbjct  1    MAAITSAVIAIAAVILGWITIEIACKPCLEKGREAIDRSLNPDYDPDEDNPSQSIRAPLN  60

Query  362  PD  367
            P+
Sbjct  61   PN  62



>ref|XP_009141391.1| PREDICTED: uncharacterized protein LOC103865346 [Brassica rapa]
Length=85

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHD  343
            M A+T ++IA+AG+ILGWITIEMACKPCLEKGREA+DR+LNPDYDPDD D
Sbjct  1    MAAITTAVIALAGIILGWITIEMACKPCLEKGREAIDRSLNPDYDPDDED  50



>ref|XP_009360893.1| PREDICTED: uncharacterized protein LOC103951282 [Pyrus x bretschneideri]
Length=95

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 5/62 (8%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH-----DARVPL  358
            MGA+TAS+IAI GV+LGWI IE+ACKPCLE+GR+A+DR+LNPDYDPDD      D   PL
Sbjct  1    MGAITASVIAIVGVVLGWIAIEIACKPCLEQGRQAIDRSLNPDYDPDDDGSVSADISAPL  60

Query  359  NP  364
            NP
Sbjct  61   NP  62



>gb|KHN06972.1| hypothetical protein glysoja_032815 [Glycine soja]
Length=98

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  209  ASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNPDPTPA  379
            +++IA+ GV+LGWITIE+ACKPCLEKGREA+DR+L+PDYDPDD   R PLNP    A
Sbjct  37   SAVIAVVGVLLGWITIEIACKPCLEKGREAIDRSLDPDYDPDDTAIRAPLNPTAASA  93



>gb|EYU43661.1| hypothetical protein MIMGU_mgv1a017429mg [Erythranthe guttata]
Length=75

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA-RVPLN  361
            MGALT +LIAI  V LGW T+E+ACKPCLEKGREA+DR+LNPDYDPDD      PLN
Sbjct  1    MGALTTALIAIVAVALGWCTMEIACKPCLEKGREAIDRSLNPDYDPDDQTTLHAPLN  57



>emb|CDP19519.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 2/59 (3%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA--RVPLNP  364
            MGALTA+LIAIAGV LGWITIE+ACKPCLEKGREA+DRNLNPDYDPDDHD   R PL P
Sbjct  1    MGALTAALIAIAGVALGWITIEIACKPCLEKGREAIDRNLNPDYDPDDHDEAIRAPLEP  59



>gb|EYU33371.1| hypothetical protein MIMGU_mgv1a017439mg [Erythranthe guttata]
Length=75

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA-RVPLN  361
            MGALT +LIAI  V LGW T+E+ACKPCL+KGREA+DR+LNPDYDPDD      PLN
Sbjct  1    MGALTTALIAIVAVALGWCTMEIACKPCLQKGREAIDRSLNPDYDPDDQTTLHAPLN  57



>ref|XP_008787806.1| PREDICTED: uncharacterized protein LOC103705741 [Phoenix dactylifera]
Length=126

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNPDPT  373
            MGA+T +++AIA VILGWITIE+ACKPCLEKGR A+DR L+P+YDPD     +P  P P+
Sbjct  32   MGAITTAVVAIAAVILGWITIEIACKPCLEKGRNAIDRALDPNYDPDSSIVPIPTRPRPS  91



>ref|XP_011620806.1| PREDICTED: uncharacterized protein LOC18427321 [Amborella trichopoda]
 gb|ERM99290.1| hypothetical protein AMTR_s00092p00166500 [Amborella trichopoda]
Length=73

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLN  361
            M A+T++LIAIAG+ L W+ +E+ACKPCLEKGREA+DR+L+P++DPDD D   PLN
Sbjct  1    MAAITSALIAIAGIGLAWLAMEIACKPCLEKGREAIDRSLDPNFDPDDRDIHTPLN  56



>ref|XP_002519671.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42644.1| conserved hypothetical protein [Ricinus communis]
Length=75

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            M A+T++LIA+AGVILGWI IEMACKPCLE+GR A+ R+LNPDYDPDD
Sbjct  1    MAAITSALIAVAGVILGWIAIEMACKPCLEQGRNAIGRSLNPDYDPDD  48



>ref|XP_004486018.1| PREDICTED: uncharacterized protein LOC101512336 [Cicer arietinum]
Length=73

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNPDPT  373
            MGA+T+++IA+  V+LGWITIE+ACKPCL++GREA+DRNLNPDYDPDD D R PLNP P+
Sbjct  1    MGAITSAVIAVVAVLLGWITIEIACKPCLQQGREAIDRNLNPDYDPDDDDVRAPLNPHPS  60

Query  374  PA  379
            PA
Sbjct  61   PA  62



>gb|EMT32170.1| hypothetical protein F775_43897 [Aegilops tauschii]
Length=78

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA  346
            MGA+  ++IAIA V+LGWITIEMACKPCLE GR A+DR L+P+YDPDD  A
Sbjct  1    MGAVVTAVIAIAAVVLGWITIEMACKPCLETGRRAMDRALDPNYDPDDSPA  51



>ref|XP_010668026.1| PREDICTED: uncharacterized protein LOC104885010 [Beta vulgaris 
subsp. vulgaris]
Length=71

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHD-ARVPLNP  364
            MGA+TA++IA+AG+ + WITIEMACKPCLEKGREA+DR+LNPDYDPDDHD  R PLNP
Sbjct  1    MGAVTAAIIAVAGLGVAWITIEMACKPCLEKGREAIDRSLNPDYDPDDHDNIRAPLNP  58



>ref|XP_009623189.1| PREDICTED: uncharacterized protein LOC104114438 [Nicotiana tomentosiformis]
Length=103

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNPDPT  373
             +T ++IA+A VILGWITIEMACKPCLEK  EA+D+NLNPDYD DD D   PLN +PT
Sbjct  31   TITTAVIAVASVILGWITIEMACKPCLEKDGEAIDQNLNPDYDLDD-DISAPLNANPT  87



>ref|XP_010110958.1| hypothetical protein L484_021652 [Morus notabilis]
 gb|EXC29344.1| hypothetical protein L484_021652 [Morus notabilis]
Length=87

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNPDPT  373
            MGA+T+++IAIAGV+LGWITIE+ACKPCLEKGREA+DR+L+P+YDPDD+D + PLNP+  
Sbjct  1    MGAITSAVIAIAGVVLGWITIEIACKPCLEKGREAIDRSLDPNYDPDDNDIQAPLNPNSH  60

Query  374  P  376
            P
Sbjct  61   P  61



>gb|EPS70466.1| hypothetical protein M569_04305, partial [Genlisea aurea]
Length=53

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 3/56 (5%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLN  361
            MG +T +LIAIA V LGW TIE+ACKPCLE+GREA+DR+LNPDYDP   D   PLN
Sbjct  1    MGPVTTALIAIAMVALGWCTIEIACKPCLERGREAIDRSLNPDYDP---DLEAPLN  53



>ref|XP_009408527.1| PREDICTED: uncharacterized protein LOC103990943 [Musa acuminata 
subsp. malaccensis]
Length=78

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH  340
            MGA+T++++A+  VILGWITIE+ACKPCLE+GREA+DR L+P+YDPD  
Sbjct  1    MGAITSAVVAMVVVILGWITIEIACKPCLEQGREAIDRALDPNYDPDSS  49



>ref|XP_008225492.1| PREDICTED: uncharacterized protein LOC103325133 [Prunus mume]
Length=93

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA----RVPLN  361
            MGA+T+++IAI GV+LGWITIE+ACKPCLE+GR+A+DRNLNPDYDPDD       R PLN
Sbjct  1    MGAITSAVIAIVGVVLGWITIEIACKPCLEQGRQAIDRNLNPDYDPDDDVVSSDIRAPLN  60

Query  362  PDPT  373
            P+ T
Sbjct  61   PNST  64



>ref|XP_003557596.1| PREDICTED: uncharacterized protein LOC100843802 [Brachypodium 
distachyon]
Length=83

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            MGA+  ++IAIA V+LGWITIEMACKPCLE GR A+DR L+P+YDPDD
Sbjct  1    MGAVVTAVIAIAAVVLGWITIEMACKPCLETGRRAMDRALDPNYDPDD  48



>ref|XP_007213992.1| hypothetical protein PRUPE_ppa014074mg [Prunus persica]
 gb|EMJ15191.1| hypothetical protein PRUPE_ppa014074mg [Prunus persica]
Length=88

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA----RVPLN  361
            MGA+T+++IAI GV+LGWITIE+ACKPCLE+GR+A+DRNLNPDYDPDD       R PLN
Sbjct  1    MGAITSAVIAIVGVVLGWITIEIACKPCLEQGRQAIDRNLNPDYDPDDDVVSSDIRAPLN  60

Query  362  PDPT  373
            P+ T
Sbjct  61   PNST  64



>gb|ABK25746.1| unknown [Picea sitchensis]
 gb|ABR18330.1| unknown [Picea sitchensis]
Length=77

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH  340
            MGAL  + IAI G+ILGW+ IEMACKPCLE GR A+DR+L+P+YDPD++
Sbjct  1    MGALVTAAIAIVGLILGWVAIEMACKPCLEAGRNAIDRSLDPNYDPDEN  49



>ref|XP_004955482.1| PREDICTED: uncharacterized protein LOC101767780 [Setaria italica]
Length=80

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            MGA+  ++IAIA V+LGWITIEMACKPCLE GR A+DR L+P+YDPD 
Sbjct  1    MGAVVTAVIAIAAVVLGWITIEMACKPCLETGRRAMDRALDPNYDPDS  48



>ref|XP_011096578.1| PREDICTED: uncharacterized protein LOC105175727 [Sesamum indicum]
Length=79

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA----RVPLN  361
            MGA+T +LIAIA V LGW TIE+ACKPCLEKGREA+DRNLNPDYDPDD  +      PLN
Sbjct  1    MGAVTTALIAIAAVALGWCTIEIACKPCLEKGREAIDRNLNPDYDPDDQVSTTTLHAPLN  60

Query  362  P  364
            P
Sbjct  61   P  61



>ref|XP_002459358.1| hypothetical protein SORBIDRAFT_02g003250 [Sorghum bicolor]
 gb|EER95879.1| hypothetical protein SORBIDRAFT_02g003250 [Sorghum bicolor]
Length=85

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            MGA+  ++IAIA V+LGWITIEMACKPCLE GR A+DR L+P+YDPD 
Sbjct  1    MGAVVTAVIAIAAVVLGWITIEMACKPCLETGRRAMDRALDPNYDPDS  48



>ref|XP_006410605.1| hypothetical protein EUTSA_v10017600mg [Eutrema salsugineum]
 gb|ESQ52058.1| hypothetical protein EUTSA_v10017600mg [Eutrema salsugineum]
Length=81

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNP  319
            M ALT++LIAIAGVILGWI IEMACKPCLE GREA+DR+LNP
Sbjct  1    MAALTSALIAIAGVILGWIAIEMACKPCLESGREAIDRSLNP  42



>ref|NP_001058914.1| Os07g0154300 [Oryza sativa Japonica Group]
 dbj|BAD31594.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20828.1| Os07g0154300 [Oryza sativa Japonica Group]
 gb|EAZ02813.1| hypothetical protein OsI_24938 [Oryza sativa Indica Group]
 gb|EAZ38732.1| hypothetical protein OsJ_23133 [Oryza sativa Japonica Group]
 dbj|BAH00791.1| unnamed protein product [Oryza sativa Japonica Group]
Length=76

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA  346
            MGA+  ++IAIA V+LGWITIEMACKPCL+ GR A+DR L+P+YDPD+  A
Sbjct  1    MGAVVTAVIAIAAVVLGWITIEMACKPCLDSGRRAMDRALDPNYDPDEPTA  51



>gb|ACG27377.1| hypothetical protein [Zea mays]
Length=76

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            MGA+  ++IAIA V+LGWITIEMACKPCLE GR A+DR L+P++DPD 
Sbjct  1    MGAVVTAVIAIAAVVLGWITIEMACKPCLETGRRAMDRALDPNHDPDS  48



>gb|ACG37211.1| hypothetical protein [Zea mays]
 gb|ACG45790.1| hypothetical protein [Zea mays]
 tpg|DAA42627.1| TPA: hypothetical protein ZEAMMB73_778240 [Zea mays]
Length=76

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            MGA+  ++IAIA V+LGWITIEMACKPCLE GR A+DR L+P++DPD 
Sbjct  1    MGAVVTAVIAIAAVVLGWITIEMACKPCLETGRRAMDRALDPNHDPDS  48



>ref|XP_008670982.1| PREDICTED: uncharacterized protein LOC100303895 [Zea mays]
Length=126

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            MGA+  ++IAIA V+LGWITIEMACKPCLE GR A+DR L+P++DPD 
Sbjct  51   MGAVVTAVIAIAAVVLGWITIEMACKPCLETGRRAMDRALDPNHDPDS  98



>ref|XP_010056946.1| PREDICTED: uncharacterized protein LOC104444871 [Eucalyptus grandis]
Length=87

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLN---PDYDPDDHDARVPL-N  361
            M A+T++LIAIAGV+LGWI IE+ACKPCLE+GREA+DR+LN      D  D +AR PL  
Sbjct  1    MAAMTSALIAIAGVVLGWIAIEIACKPCLERGREAIDRSLNPDYDPDDDRDGNARAPLIA  60

Query  362  PDPTP  376
            PDP+P
Sbjct  61   PDPSP  65



>ref|XP_002881345.1| hypothetical protein ARALYDRAFT_902544 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57604.1| hypothetical protein ARALYDRAFT_902544 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNP  319
            M A+T+++IAIAG+ILGWITIE+ACKPCLE GREA+DR+LNP
Sbjct  1    MAAITSAVIAIAGIILGWITIELACKPCLETGREAIDRSLNP  42



>ref|NP_565793.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM14909.1| Expressed protein [Arabidopsis thaliana]
 gb|AAM63102.1| unknown [Arabidopsis thaliana]
 dbj|BAD43075.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43948.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44003.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44527.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44606.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44608.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABD38864.1| At2g34585 [Arabidopsis thaliana]
 gb|AEC08995.1| uncharacterized protein AT2G34585 [Arabidopsis thaliana]
Length=81

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNP  319
            M A+T+++IAIAG+ILGWITIE+ACKPCLE GREA+DR+LNP
Sbjct  1    MAAITSAVIAIAGIILGWITIELACKPCLESGREAIDRSLNP  42



>gb|KFK36361.1| hypothetical protein AALP_AA4G113400 [Arabis alpina]
Length=83

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLN  316
            M ALT++LIAIA VILGWITIEMACKPCLE+GREA+DR+LN
Sbjct  1    MAALTSALIAIAAVILGWITIEMACKPCLEQGREAMDRSLN  41



>ref|XP_006467458.1| PREDICTED: uncharacterized protein LOC102611820 [Citrus sinensis]
Length=76

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +2

Query  230  GVILGWITIEMACKPCLEKGREAVDRNLNPDYDPD---DHDARVPL  358
            GV+LGWI IEMACKPCLEKGREA+DR+LNPDYDPD   D + R PL
Sbjct  13   GVVLGWIAIEMACKPCLEKGREAIDRSLNPDYDPDGDADTNIRAPL  58



>ref|XP_012072115.1| PREDICTED: uncharacterized protein LOC105633999 [Jatropha curcas]
 gb|KDP37983.1| hypothetical protein JCGZ_04626 [Jatropha curcas]
Length=77

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLN----PDYDPDDHDARVPLN  361
            M A+T +LIA+AG+ILGWI IE+ACKPCLEKGREA+DR+LN    PD D    +   PLN
Sbjct  1    MAAITTALIAVAGIILGWIAIEIACKPCLEKGREAIDRSLNPDYDPDDDVVSSNIHAPLN  60

Query  362  PD  367
            P+
Sbjct  61   PN  62



>ref|XP_007147911.1| hypothetical protein PHAVU_006G165400g [Phaseolus vulgaris]
 gb|ESW19905.1| hypothetical protein PHAVU_006G165400g [Phaseolus vulgaris]
Length=72

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 53/60 (88%), Gaps = 3/60 (5%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA---RVPLNP  364
            MGA+T+++IA+ GVILGWITIE+ACKPCLEKGR+A+DR+LNPD+DPD+ +    R PLNP
Sbjct  1    MGAITSAVIAVVGVILGWITIEIACKPCLEKGRQAIDRSLNPDFDPDEDEDTAIRAPLNP  60



>gb|KDO78196.1| hypothetical protein CISIN_1g034996mg [Citrus sinensis]
Length=76

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +2

Query  230  GVILGWITIEMACKPCLEKGREAVDRNLNPDYDPD---DHDARVPL  358
            GV+LGWI IEMACKPCLEKGREA+D++LNPDYDPD   D + R PL
Sbjct  13   GVVLGWIAIEMACKPCLEKGREAIDQSLNPDYDPDGDADTNIRAPL  58



>ref|XP_007025063.1| Uncharacterized protein TCM_029473 [Theobroma cacao]
 gb|EOY27685.1| Uncharacterized protein TCM_029473 [Theobroma cacao]
Length=81

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 3/62 (5%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNL---NPDYDPDDHDARVPLNP  364
            M A+T+++IAIAGV+LGWI IE+ACKPCLE+GREA+DR+L       D +D++ R PLNP
Sbjct  1    MAAITSAVIAIAGVVLGWIAIEIACKPCLERGREAIDRSLNPDYDPDDDNDNNVRAPLNP  60

Query  365  DP  370
             P
Sbjct  61   SP  62



>ref|XP_006295340.1| hypothetical protein CARUB_v10024431mg [Capsella rubella]
 gb|EOA28238.1| hypothetical protein CARUB_v10024431mg [Capsella rubella]
Length=83

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLN  316
            M A+T+++IAIAG+ILGWITIE+ACKPCLE GREA+DR+LN
Sbjct  1    MAAITSAVIAIAGIILGWITIELACKPCLESGREAIDRSLN  41



>ref|XP_010549491.1| PREDICTED: uncharacterized protein LOC104820651 [Tarenaya hassleriana]
Length=87

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHD--ARVPLNPD  367
            M A+T ++IAIAGVILGWITIE+ACKPCLE+GREA+D++LNPDYDPDD     R PL  +
Sbjct  1    MAAITTAVIAIAGVILGWITIEIACKPCLERGREAIDQSLNPDYDPDDDSSAVRAPLLAN  60

Query  368  PTP  376
            P P
Sbjct  61   PQP  63



>ref|XP_006449706.1| hypothetical protein CICLE_v10017916mg [Citrus clementina]
 gb|ESR62946.1| hypothetical protein CICLE_v10017916mg [Citrus clementina]
Length=78

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  230  GVILGWITIEMACKPCLEKGREAVDRNLN  316
            GV+LGWI IEMACKPCLEKGREA+DR+LN
Sbjct  13   GVVLGWIAIEMACKPCLEKGREAIDRSLN  41



>gb|AFG44474.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44480.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
Length=65

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH  340
            MGA  +++I +AG+ L W+T ++A KP L+KG++A+D++L+P +DPDD 
Sbjct  1    MGAFKSTVIVVAGLALAWLTAQVAFKPFLDKGKDAMDKSLDPRHDPDDQ  49



>gb|ADE77763.1| unknown [Picea sitchensis]
Length=83

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            MGA+ +SL A+A + LGW+ IE+A KP L++ R+++++ L+P++DPDD
Sbjct  23   MGAVASSLFAVAAMALGWLAIELAFKPSLDENRDSINKFLDPNHDPDD  70



>gb|ABK23688.1| unknown [Picea sitchensis]
Length=67

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH  340
            MGAL +++I +AG+ L W+T ++A KP L+KG++A+ ++L+P +DPDD 
Sbjct  1    MGALKSTIIVVAGLALAWLTAQIAFKPFLDKGKDAMGKSLDPRHDPDDQ  49



>gb|AEW08948.1| hypothetical protein CL2409Contig1_01, partial [Pinus radiata]
Length=65

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH  340
            MGA  +++I +AG+ L W+T ++A KP L+KG++AVD++L+P +DPDD 
Sbjct  1    MGAFKSTVIVVAGLALAWLTAQVAFKPFLDKGKDAVDKSLDPRHDPDDQ  49



>gb|AFG44463.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44464.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44465.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44466.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44467.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44468.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44469.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44470.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44471.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44472.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44473.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44475.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44476.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44477.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44478.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
 gb|AFG44479.1| hypothetical protein CL2409Contig1_01, partial [Pinus taeda]
Length=65

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDH  340
            MGA  +++I +AG+ L W+T ++A KP L+KG++A+D++L+P +DPDD 
Sbjct  1    MGAFKSTVIVVAGLALAWLTAQVAFKPFLDKGKDAMDKSLDPRHDPDDQ  49



>ref|XP_001759335.1| predicted protein [Physcomitrella patens]
 gb|EDQ76019.1| predicted protein, partial [Physcomitrella patens]
Length=51

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  194  MGALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDA  346
            MGA+  +++ +  + LGW  +E+ACKPC+E GR A++R+L+ DYDPD+  A
Sbjct  1    MGAIVTTVLVVVALFLGWGAVEIACKPCMESGRAAINRSLDLDYDPDNEIA  51



>ref|XP_003570233.1| PREDICTED: uncharacterized protein LOC100835108 [Brachypodium 
distachyon]
Length=126

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  197  GALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVPLNPDPTP  376
            GAL  +++   G++L W+T+E A KP L++ R AV R+ NP  DPD+  A    + D  P
Sbjct  11   GALKTAVVVTGGLVLAWLTVETAFKPFLDRLRAAVSRSTNPSRDPDEDPAAAVPDEDKGP  70

Query  377  A  379
            A
Sbjct  71   A  71



>ref|XP_010684331.1| PREDICTED: 6.7 kDa chloroplast outer envelope membrane protein-like 
[Beta vulgaris subsp. vulgaris]
Length=71

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +2

Query  197  GALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVP  355
            G+L  + I ++ +  GW+ IE+A KP L+K R A+D++ +P YDPD +DA  P
Sbjct  9    GSLKQAAIVMSALAFGWLAIELAFKPWLDKARAALDKS-DPAYDPDINDAVSP  60



>ref|XP_004953688.1| PREDICTED: salt stress root protein RS1-like [Setaria italica]
Length=114

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +2

Query  197  GALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDD  337
            GAL  ++I   G+ L W+T+E A KP L++ R AV RN +P  DPD 
Sbjct  11   GALKTAVIVAGGIALAWVTVETAFKPFLDRLRGAVSRNTDPARDPDQ  57



>gb|EMS45753.1| hypothetical protein TRIUR3_22777 [Triticum urartu]
Length=56

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  260  MACKPCLEKGREAVDRNLNPDYDPDDHDA  346
            MACKPCLE GR A+DR L+P+YDPDD  A
Sbjct  1    MACKPCLETGRRAMDRALDPNYDPDDSPA  29



>ref|NP_001047926.1| Os02g0715400 [Oryza sativa Japonica Group]
 dbj|BAD09168.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09840.1| Os02g0715400 [Oryza sativa Japonica Group]
 gb|EAY87286.1| hypothetical protein OsI_08689 [Oryza sativa Indica Group]
 gb|EAZ24387.1| hypothetical protein OsJ_08142 [Oryza sativa Japonica Group]
Length=101

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  200  ALTASLIAIAGVILGWITIEMACKPCLEKGREAVDRNLNPDYDPDDHDARVP  355
            AL  +++   G++L W T+E A KP L++ R A+ RN +P  DPD+ ++  P
Sbjct  14   ALKTAVVVTGGLVLAWFTMESAFKPFLDRLRGALTRNTDPARDPDEENSAAP  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1267397107886