BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5337

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599009.1|  PREDICTED: probable protein phosphatase 2C 5       166   6e-52   Nicotiana tomentosiformis
ref|XP_009799456.1|  PREDICTED: probable protein phosphatase 2C 5       166   7e-52   Nicotiana sylvestris
ref|XP_006344713.1|  PREDICTED: probable protein phosphatase 2C 5...    166   2e-51   
ref|XP_004230274.1|  PREDICTED: probable protein phosphatase 2C 5       162   3e-50   Solanum lycopersicum
ref|XP_011092109.1|  PREDICTED: probable protein phosphatase 2C 5       156   7e-48   Sesamum indicum [beniseed]
ref|XP_007031084.1|  Phosphatase 2C family protein                      151   1e-45   Theobroma cacao [chocolate]
gb|KHG19035.1|  hypothetical protein F383_08660                         147   7e-45   Gossypium arboreum [tree cotton]
gb|KJB45378.1|  hypothetical protein B456_007G303500                    145   1e-44   Gossypium raimondii
gb|KJB45380.1|  hypothetical protein B456_007G303500                    145   1e-44   Gossypium raimondii
ref|XP_008370399.1|  PREDICTED: probable protein phosphatase 2C 5       145   3e-44   Malus domestica [apple tree]
emb|CAN74505.1|  hypothetical protein VITISV_015889                     142   5e-44   Vitis vinifera
ref|XP_002282985.1|  PREDICTED: probable protein phosphatase 2C 5       142   5e-44   Vitis vinifera
ref|XP_006472159.1|  PREDICTED: probable protein phosphatase 2C 5...    147   2e-43   Citrus sinensis [apfelsine]
ref|XP_006433490.1|  hypothetical protein CICLE_v10001248mg             147   2e-43   Citrus clementina [clementine]
ref|XP_008245693.1|  PREDICTED: probable protein phosphatase 2C 5       147   2e-43   Prunus mume [ume]
ref|XP_007205239.1|  hypothetical protein PRUPE_ppa006100mg             147   3e-43   
ref|XP_007205238.1|  hypothetical protein PRUPE_ppa006100mg             147   4e-43   
ref|XP_009626600.1|  PREDICTED: probable protein phosphatase 2C 5       159   2e-42   Nicotiana tomentosiformis
ref|XP_004494559.1|  PREDICTED: probable protein phosphatase 2C 5...    138   2e-42   Cicer arietinum [garbanzo]
ref|XP_012088951.1|  PREDICTED: probable protein phosphatase 2C 5...    144   2e-42   
ref|XP_012088949.1|  PREDICTED: probable protein phosphatase 2C 5...    143   3e-42   Jatropha curcas
ref|XP_012088950.1|  PREDICTED: probable protein phosphatase 2C 5...    143   3e-42   Jatropha curcas
ref|XP_009338205.1|  PREDICTED: probable protein phosphatase 2C 5       139   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_006604795.1|  PREDICTED: probable protein phosphatase 2C 5...    137   3e-41   Glycine max [soybeans]
ref|XP_003554626.1|  PREDICTED: probable protein phosphatase 2C 5...    137   4e-41   
gb|KHG19034.1|  hypothetical protein F383_08660                         145   4e-41   Gossypium arboreum [tree cotton]
ref|XP_003626183.1|  hypothetical protein MTR_7g112430                  134   6e-41   Medicago truncatula
gb|EPS69183.1|  hypothetical protein M569_05581                         140   6e-41   Genlisea aurea
ref|XP_007163342.1|  hypothetical protein PHAVU_001G226800g             136   1e-40   Phaseolus vulgaris [French bean]
ref|XP_009759573.1|  PREDICTED: probable protein phosphatase 2C 5       154   2e-40   Nicotiana sylvestris
ref|XP_011466159.1|  PREDICTED: probable protein phosphatase 2C 5       154   2e-40   Fragaria vesca subsp. vesca
ref|XP_002512477.1|  protein phosphatase, putative                      130   3e-39   Ricinus communis
gb|KHN20267.1|  Hypothetical protein glysoja_023830                     131   4e-39   Glycine soja [wild soybean]
ref|XP_010674109.1|  PREDICTED: probable protein phosphatase 2C 5       132   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008450571.1|  PREDICTED: probable protein phosphatase 2C 5       127   5e-38   Cucumis melo [Oriental melon]
ref|XP_004135583.1|  PREDICTED: probable protein phosphatase 2C 5       127   9e-38   Cucumis sativus [cucumbers]
gb|EYU37269.1|  hypothetical protein MIMGU_mgv1a006832mg                146   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_007144975.1|  hypothetical protein PHAVU_007G199100g             136   2e-37   Phaseolus vulgaris [French bean]
gb|KHN16084.1|  Hypothetical protein glysoja_012060                     130   9e-37   Glycine soja [wild soybean]
ref|XP_006382433.1|  hypothetical protein POPTR_0005s02110g             129   2e-36   Populus trichocarpa [western balsam poplar]
gb|KJB26348.1|  hypothetical protein B456_004G237900                    143   2e-36   Gossypium raimondii
gb|KHG06373.1|  hypothetical protein F383_32810                         142   2e-36   Gossypium arboreum [tree cotton]
gb|KJB26350.1|  hypothetical protein B456_004G237900                    142   3e-36   Gossypium raimondii
emb|CDP17226.1|  unnamed protein product                                142   3e-36   Coffea canephora [robusta coffee]
ref|XP_003521674.1|  PREDICTED: probable protein phosphatase 2C 5...    133   2e-35   Glycine max [soybeans]
gb|KHN03953.1|  Hypothetical protein glysoja_022639                     133   2e-35   Glycine soja [wild soybean]
ref|XP_011036917.1|  PREDICTED: probable protein phosphatase 2C 5...    127   5e-35   Populus euphratica
ref|XP_011036918.1|  PREDICTED: probable protein phosphatase 2C 5...    127   5e-35   Populus euphratica
gb|KCW60535.1|  hypothetical protein EUGRSUZ_H03276                     130   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010024104.1|  PREDICTED: probable protein phosphatase 2C 5       130   2e-34   Eucalyptus grandis [rose gum]
ref|XP_002318970.1|  phosphatase 2C family protein                      115   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_008388502.1|  PREDICTED: probable protein phosphatase 2C 5       134   5e-33   
gb|KEH43094.1|  protein phosphatase 2C family protein                   121   6e-33   Medicago truncatula
ref|XP_003591191.1|  hypothetical protein MTR_1g083750                  121   6e-33   Medicago truncatula
ref|XP_010528916.1|  PREDICTED: probable protein phosphatase 2C 5       127   6e-33   Tarenaya hassleriana [spider flower]
ref|XP_010259436.1|  PREDICTED: probable protein phosphatase 2C 5...    120   6e-33   
ref|XP_010259431.1|  PREDICTED: probable protein phosphatase 2C 5...    120   8e-33   
gb|ABD28356.2|  Protein phosphatase 2C-like                             121   1e-32   Medicago truncatula
ref|XP_011023736.1|  PREDICTED: probable protein phosphatase 2C 5...    114   1e-32   Populus euphratica
ref|XP_011023738.1|  PREDICTED: probable protein phosphatase 2C 5...    113   1e-32   Populus euphratica
ref|XP_011023737.1|  PREDICTED: probable protein phosphatase 2C 5...    114   1e-32   Populus euphratica
gb|ACJ83645.1|  unknown                                                 121   6e-32   Medicago truncatula
ref|XP_004495681.1|  PREDICTED: probable protein phosphatase 2C 5...    118   2e-31   
ref|XP_004495680.1|  PREDICTED: probable protein phosphatase 2C 5...    117   4e-31   Cicer arietinum [garbanzo]
ref|XP_006417602.1|  hypothetical protein EUTSA_v10007698mg             114   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010905680.1|  PREDICTED: probable protein phosphatase 2C 33      109   5e-30   Elaeis guineensis
ref|XP_010245443.1|  PREDICTED: probable protein phosphatase 2C 5       111   6e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010553723.1|  PREDICTED: probable protein phosphatase 2C 5       118   9e-30   Tarenaya hassleriana [spider flower]
ref|XP_010475741.1|  PREDICTED: probable protein phosphatase 2C 5       112   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010489746.1|  PREDICTED: probable protein phosphatase 2C 5       112   6e-29   Camelina sativa [gold-of-pleasure]
emb|CDX95002.1|  BnaC05g06690D                                          110   7e-29   
ref|XP_010458188.1|  PREDICTED: probable protein phosphatase 2C 5       111   9e-29   Camelina sativa [gold-of-pleasure]
gb|AFK41874.1|  unknown                                                 120   2e-28   Medicago truncatula
ref|XP_010938321.1|  PREDICTED: probable protein phosphatase 2C 33      104   6e-28   
ref|XP_010099267.1|  putative protein phosphatase 2C 15                 108   2e-27   
ref|XP_008795536.1|  PREDICTED: probable protein phosphatase 2C 33      102   2e-27   Phoenix dactylifera
gb|AIZ68189.1|  putative protein phosphatase 2C 33                      105   2e-27   Ornithogalum longebracteatum [sea-onion]
ref|XP_008807757.1|  PREDICTED: probable protein phosphatase 2C 33      108   2e-27   Phoenix dactylifera
ref|XP_006307591.1|  hypothetical protein CARUB_v10009213mg             106   4e-27   Capsella rubella
emb|CDY31109.1|  BnaA08g26590D                                          105   4e-27   Brassica napus [oilseed rape]
ref|XP_009110849.1|  PREDICTED: probable protein phosphatase 2C 5       105   5e-27   Brassica rapa
ref|XP_010906997.1|  PREDICTED: probable protein phosphatase 2C 3...    103   6e-27   
emb|CAN76446.1|  hypothetical protein VITISV_010117                     102   6e-27   Vitis vinifera
emb|CDY32154.1|  BnaCnng06630D                                          104   1e-26   Brassica napus [oilseed rape]
ref|XP_004299042.1|  PREDICTED: probable protein phosphatase 2C 15      105   1e-26   Fragaria vesca subsp. vesca
ref|XP_009411651.1|  PREDICTED: probable protein phosphatase 2C 33      108   2e-26   
ref|XP_009386662.1|  PREDICTED: probable protein phosphatase 2C 33    99.0    2e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK92834.1|  unknown                                               87.8    3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010264732.1|  PREDICTED: probable protein phosphatase 2C 15      101   5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_002279675.1|  PREDICTED: probable protein phosphatase 2C 15      101   6e-26   
ref|XP_009357108.1|  PREDICTED: probable protein phosphatase 2C 15      102   7e-26   Pyrus x bretschneideri [bai li]
ref|XP_006378470.1|  hypothetical protein POPTR_0010s13130g             102   7e-26   
ref|XP_006842367.2|  PREDICTED: probable protein phosphatase 2C 15    99.8    8e-26   
gb|ERN04042.1|  hypothetical protein AMTR_s00079p00186650             99.8    1e-25   Amborella trichopoda
ref|XP_007222389.1|  hypothetical protein PRUPE_ppa006061mg             102   1e-25   Prunus persica
ref|XP_008339644.1|  PREDICTED: probable protein phosphatase 2C 15      102   1e-25   Malus domestica [apple tree]
ref|XP_006448418.1|  hypothetical protein CICLE_v10015330mg             100   1e-25   Citrus clementina [clementine]
ref|XP_002312412.1|  phosphatase 2C family protein                      100   2e-25   
ref|NP_172388.1|  putative protein phosphatase 2C                       100   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008243272.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    101   2e-25   
ref|XP_007044253.1|  Phosphatase 2C family protein                    99.8    3e-25   
ref|XP_002892487.1|  hypothetical protein ARALYDRAFT_471002           99.8    4e-25   
ref|XP_009356234.1|  PREDICTED: probable protein phosphatase 2C 15    99.8    7e-25   Pyrus x bretschneideri [bai li]
ref|XP_010279327.1|  PREDICTED: probable protein phosphatase 2C 15    96.3    1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_002465394.1|  hypothetical protein SORBIDRAFT_01g037810        99.0    1e-24   Sorghum bicolor [broomcorn]
ref|XP_008351008.1|  PREDICTED: probable protein phosphatase 2C 15    99.0    2e-24   
ref|XP_008389261.1|  PREDICTED: probable protein phosphatase 2C 15    98.6    2e-24   
ref|XP_012082143.1|  PREDICTED: probable protein phosphatase 2C 1...    109   2e-24   
ref|XP_012082136.1|  PREDICTED: probable protein phosphatase 2C 1...    109   2e-24   Jatropha curcas
ref|XP_011022405.1|  PREDICTED: probable protein phosphatase 2C 15    96.3    3e-24   Populus euphratica
ref|XP_008792836.1|  PREDICTED: probable protein phosphatase 2C 1...    106   2e-23   Phoenix dactylifera
ref|XP_010511830.1|  PREDICTED: probable protein phosphatase 2C 15    94.0    2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002888662.1|  hypothetical protein ARALYDRAFT_894606           94.0    2e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_009588473.1|  PREDICTED: probable protein phosphatase 2C 3...  94.0    2e-23   Nicotiana tomentosiformis
ref|XP_009588467.1|  PREDICTED: probable protein phosphatase 2C 1...  94.0    2e-23   Nicotiana tomentosiformis
ref|XP_010320753.1|  PREDICTED: probable protein phosphatase 2C 15    93.6    2e-23   
ref|XP_008792835.1|  PREDICTED: probable protein phosphatase 2C 1...    106   2e-23   
ref|XP_009588474.1|  PREDICTED: probable protein phosphatase 2C 3...  94.0    2e-23   
ref|XP_006645937.1|  PREDICTED: probable protein phosphatase 2C 3...  92.8    3e-23   Oryza brachyantha
ref|NP_177008.1|  putative protein phosphatase 2C 15                  93.2    4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009767026.1|  PREDICTED: probable protein phosphatase 2C 3...  93.2    4e-23   Nicotiana sylvestris
dbj|BAH20040.1|  AT1G68410                                            92.8    4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009767028.1|  PREDICTED: probable protein phosphatase 2C 3...  93.2    5e-23   Nicotiana sylvestris
ref|XP_009767020.1|  PREDICTED: probable protein phosphatase 2C 1...  93.2    5e-23   Nicotiana sylvestris
ref|XP_004984655.1|  PREDICTED: probable protein phosphatase 2C 3...  94.0    6e-23   Setaria italica
gb|AFW88634.1|  putative protein phosphatase 2C family protein        94.7    9e-23   
ref|XP_006344157.1|  PREDICTED: probable protein phosphatase 2C 1...  93.6    9e-23   Solanum tuberosum [potatoes]
ref|XP_010044241.1|  PREDICTED: probable protein phosphatase 2C 15    92.0    1e-22   Eucalyptus grandis [rose gum]
ref|NP_001049866.1|  Os03g0301700                                     92.4    1e-22   
gb|ABR17671.1|  unknown                                                 101   2e-22   Picea sitchensis
emb|CDY44900.1|  BnaA02g13820D                                        90.9    2e-22   Brassica napus [oilseed rape]
ref|XP_006302270.1|  hypothetical protein CARUB_v10020313mg           90.9    2e-22   Capsella rubella
ref|NP_001149558.1|  LOC100283184                                     94.7    2e-22   Zea mays [maize]
ref|XP_010415460.1|  PREDICTED: probable protein phosphatase 2C 15    90.1    3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008797622.1|  PREDICTED: probable protein phosphatase 2C 3     87.0    4e-22   Phoenix dactylifera
ref|XP_009385409.1|  PREDICTED: probable protein phosphatase 2C 3     90.5    4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010906996.1|  PREDICTED: probable protein phosphatase 2C 3...    102   4e-22   Elaeis guineensis
emb|CDP00657.1|  unnamed protein product                              89.0    5e-22   Coffea canephora [robusta coffee]
sp|Q0JMD4.2|P2C03_ORYSJ  RecName: Full=Probable protein phosphata...  89.4    7e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70750.1|  hypothetical protein OsI_02161                        89.7    7e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_010470790.1|  PREDICTED: probable protein phosphatase 2C 15    89.0    7e-22   Camelina sativa [gold-of-pleasure]
ref|XP_007142943.1|  hypothetical protein PHAVU_007G030400g           90.1    8e-22   Phaseolus vulgaris [French bean]
ref|XP_004135083.1|  PREDICTED: probable protein phosphatase 2C 15    87.8    1e-21   Cucumis sativus [cucumbers]
ref|NP_001151513.1|  LOC100285147                                     87.4    2e-21   Zea mays [maize]
ref|XP_008446622.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  87.4    2e-21   Cucumis melo [Oriental melon]
ref|XP_003567758.1|  PREDICTED: probable protein phosphatase 2C 3...  90.9    2e-21   Brachypodium distachyon [annual false brome]
ref|XP_006469091.1|  PREDICTED: probable protein phosphatase 2C 3...    100   2e-21   Citrus sinensis [apfelsine]
dbj|BAJ89158.1|  predicted protein                                    85.9    4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002527010.1|  protein phosphatase, putative                    99.8    5e-21   Ricinus communis
ref|XP_002455646.1|  hypothetical protein SORBIDRAFT_03g016300        85.5    5e-21   Sorghum bicolor [broomcorn]
ref|XP_009127629.1|  PREDICTED: probable protein phosphatase 2C 15    85.5    7e-21   Brassica rapa
ref|XP_004497062.1|  PREDICTED: probable protein phosphatase 2C 1...  86.3    1e-20   Cicer arietinum [garbanzo]
emb|CDX81511.1|  BnaC02g18150D                                        84.7    1e-20   
ref|XP_011076402.1|  PREDICTED: probable protein phosphatase 2C 1...  84.0    1e-20   Sesamum indicum [beniseed]
ref|XP_006649947.1|  PREDICTED: probable protein phosphatase 2C 3...  87.0    2e-20   Oryza brachyantha
ref|XP_004968827.1|  PREDICTED: probable protein phosphatase 2C 3...  83.6    2e-20   Setaria italica
gb|KHG10433.1|  hypothetical protein F383_12376                       82.8    3e-20   Gossypium arboreum [tree cotton]
ref|XP_003558102.1|  PREDICTED: probable protein phosphatase 2C 33    90.1    3e-20   Brachypodium distachyon [annual false brome]
ref|XP_003562410.1|  PREDICTED: probable protein phosphatase 2C 33    87.4    3e-20   Brachypodium distachyon [annual false brome]
ref|NP_001043180.2|  Os01g0513100                                     83.6    4e-20   
ref|XP_003555914.1|  PREDICTED: probable protein phosphatase 2C 1...  84.0    5e-20   Glycine max [soybeans]
ref|XP_010230932.1|  PREDICTED: probable protein phosphatase 2C 3...  85.9    5e-20   Brachypodium distachyon [annual false brome]
gb|ABR16488.1|  unknown                                               97.1    5e-20   Picea sitchensis
gb|KHN06682.1|  Hypothetical protein glysoja_021228                   83.6    7e-20   Glycine soja [wild soybean]
ref|XP_003536672.1|  PREDICTED: probable protein phosphatase 2C 1...  83.6    7e-20   Glycine max [soybeans]
ref|NP_001060712.1|  Os07g0690400                                     85.9    9e-20   
gb|KJB31458.1|  hypothetical protein B456_005G192600                  80.5    1e-19   Gossypium raimondii
gb|KJB31457.1|  hypothetical protein B456_005G192600                  80.5    1e-19   Gossypium raimondii
emb|CDY17840.1|  BnaC08g04540D                                        78.6    2e-19   Brassica napus [oilseed rape]
ref|XP_006393585.1|  hypothetical protein EUTSA_v10011502mg           80.1    2e-19   Eutrema salsugineum [saltwater cress]
gb|EYU30003.1|  hypothetical protein MIMGU_mgv1a006840mg              82.4    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_006307584.1|  hypothetical protein CARUB_v10009209mg           79.0    3e-19   
ref|XP_006307585.1|  hypothetical protein CARUB_v10009209mg           79.0    4e-19   
emb|CDY17018.1|  BnaA08g03820D                                        78.6    5e-19   Brassica napus [oilseed rape]
ref|XP_009107427.1|  PREDICTED: probable protein phosphatase 2C 12    78.6    5e-19   Brassica rapa
ref|XP_010500262.1|  PREDICTED: probable protein phosphatase 2C 12    78.6    6e-19   Camelina sativa [gold-of-pleasure]
ref|NP_564504.1|  putative protein phosphatase 2C 12                  78.2    6e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK06878.1|  predicted protein                                    85.5    6e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002894042.1|  hypothetical protein ARALYDRAFT_473885           78.2    6e-19   
gb|AAK92805.1|  unknown protein                                       78.2    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958778.1|  PREDICTED: probable protein phosphatase 2C 3...  82.4    7e-19   Setaria italica
gb|EPS73050.1|  hypothetical protein M569_01706                       79.0    8e-19   Genlisea aurea
ref|XP_006658990.1|  PREDICTED: probable protein phosphatase 2C 3...  82.0    1e-18   
emb|CDY17078.1|  BnaC06g00110D                                        75.9    1e-18   Brassica napus [oilseed rape]
gb|EMT17740.1|  Putative protein phosphatase 2C 33                    82.4    2e-18   
ref|XP_009118925.1|  PREDICTED: probable protein phosphatase 2C 12    75.1    2e-18   Brassica rapa
emb|CDY06741.1|  BnaA10g05200D                                        75.1    3e-18   
ref|XP_010532299.1|  PREDICTED: probable protein phosphatase 2C 1...  77.0    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_010922151.1|  PREDICTED: probable protein phosphatase 2C 3     92.0    3e-18   Elaeis guineensis
ref|XP_010479140.1|  PREDICTED: probable protein phosphatase 2C 12    75.9    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010461537.1|  PREDICTED: probable protein phosphatase 2C 12    75.9    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010519103.1|  PREDICTED: probable protein phosphatase 2C 12    79.0    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_002461259.1|  hypothetical protein SORBIDRAFT_02g043760        79.3    7e-18   Sorghum bicolor [broomcorn]
gb|KJB58458.1|  hypothetical protein B456_009G211100                  74.3    1e-17   Gossypium raimondii
gb|KDO38779.1|  hypothetical protein CISIN_1g033174mg                 86.3    1e-17   Citrus sinensis [apfelsine]
dbj|BAJ94997.1|  predicted protein                                    79.3    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB58459.1|  hypothetical protein B456_009G211100                  74.3    3e-17   Gossypium raimondii
gb|KJB58457.1|  hypothetical protein B456_009G211100                  74.3    3e-17   Gossypium raimondii
gb|KHG12192.1|  hypothetical protein F383_19798                       74.3    3e-17   Gossypium arboreum [tree cotton]
gb|ACF85382.1|  unknown                                               77.0    3e-17   Zea mays [maize]
gb|KHG12193.1|  hypothetical protein F383_19798                       74.3    4e-17   Gossypium arboreum [tree cotton]
ref|NP_001140347.1|  putative protein phosphatase 2C family protein   77.8    4e-17   Zea mays [maize]
ref|NP_001141091.1|  putative protein phosphatase 2C family protein   76.6    5e-17   Zea mays [maize]
ref|XP_010539072.1|  PREDICTED: probable protein phosphatase 2C 1...  75.5    7e-17   Tarenaya hassleriana [spider flower]
ref|XP_010539071.1|  PREDICTED: probable protein phosphatase 2C 1...  75.5    7e-17   Tarenaya hassleriana [spider flower]
ref|XP_009145043.1|  PREDICTED: probable protein phosphatase 2C 1...  72.0    8e-17   
ref|XP_008797258.1|  PREDICTED: probable protein phosphatase 2C 1...  70.5    9e-17   
ref|XP_011030187.1|  PREDICTED: probable protein phosphatase 2C 12    74.7    1e-16   Populus euphratica
gb|ACN31161.1|  unknown                                               71.2    1e-16   Zea mays [maize]
emb|CDY43845.1|  BnaA05g18570D                                        72.0    1e-16   Brassica napus [oilseed rape]
ref|XP_009145042.1|  PREDICTED: probable protein phosphatase 2C 1...  72.0    1e-16   Brassica rapa
ref|XP_007017286.1|  Phosphatase 2C family protein isoform 2          74.7    1e-16   
ref|XP_007017285.1|  Phosphatase 2C family protein isoform 1          74.7    1e-16   
ref|XP_010275585.1|  PREDICTED: probable protein phosphatase 2C 12    72.8    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006374959.1|  phosphatase 2C family protein                    72.0    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006448422.1|  hypothetical protein CICLE_v10018105mg           84.3    6e-16   
ref|XP_002510242.1|  protein phosphatase, putative                    75.1    7e-16   
ref|XP_007222388.1|  hypothetical protein PRUPE_ppa006058mg           71.6    1e-15   Prunus persica
ref|XP_008220215.1|  PREDICTED: probable protein phosphatase 2C 12    71.6    1e-15   Prunus mume [ume]
ref|XP_010916634.1|  PREDICTED: probable protein phosphatase 2C 12    69.7    2e-15   Elaeis guineensis
ref|XP_011654105.1|  PREDICTED: probable protein phosphatase 2C 1...  70.9    2e-15   Cucumis sativus [cucumbers]
ref|XP_004141247.1|  PREDICTED: probable protein phosphatase 2C 1...  70.9    3e-15   Cucumis sativus [cucumbers]
ref|XP_010674112.1|  PREDICTED: probable protein phosphatase 2C 5...  80.1    4e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006581239.1|  PREDICTED: probable protein phosphatase 2C 1...  67.4    5e-15   Glycine max [soybeans]
gb|KHN22311.1|  Hypothetical protein glysoja_022067                   67.4    5e-15   Glycine soja [wild soybean]
ref|XP_003528265.1|  PREDICTED: probable protein phosphatase 2C 1...  67.4    5e-15   Glycine max [soybeans]
ref|XP_006581240.1|  PREDICTED: probable protein phosphatase 2C 1...  67.4    6e-15   Glycine max [soybeans]
ref|XP_010269263.1|  PREDICTED: probable protein phosphatase 2C 12    68.9    7e-15   Nelumbo nucifera [Indian lotus]
emb|CDP01349.1|  unnamed protein product                              67.4    9e-15   Coffea canephora [robusta coffee]
ref|XP_008797259.1|  PREDICTED: probable protein phosphatase 2C 1...  70.5    1e-14   Phoenix dactylifera
ref|XP_008452534.1|  PREDICTED: probable protein phosphatase 2C 1...  70.9    2e-14   Cucumis melo [Oriental melon]
ref|XP_009409307.1|  PREDICTED: probable protein phosphatase 2C 12    66.6    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008452538.1|  PREDICTED: probable protein phosphatase 2C 1...  70.9    2e-14   Cucumis melo [Oriental melon]
ref|XP_012071676.1|  PREDICTED: probable protein phosphatase 2C 12    66.2    2e-14   Jatropha curcas
ref|XP_004499068.1|  PREDICTED: probable protein phosphatase 2C 1...  67.0    2e-14   
ref|XP_010674111.1|  PREDICTED: probable protein phosphatase 2C 5...  78.2    2e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004292819.1|  PREDICTED: probable protein phosphatase 2C 12    67.4    2e-14   Fragaria vesca subsp. vesca
ref|XP_004499069.1|  PREDICTED: probable protein phosphatase 2C 1...  66.6    2e-14   Cicer arietinum [garbanzo]
ref|XP_003550341.1|  PREDICTED: probable protein phosphatase 2C 1...  68.9    2e-14   Glycine max [soybeans]
ref|XP_010088393.1|  putative protein phosphatase 2C 5                80.1    3e-14   
ref|XP_006434797.1|  hypothetical protein CICLE_v10001232mg           64.3    4e-14   Citrus clementina [clementine]
gb|KDO84217.1|  hypothetical protein CISIN_1g045195mg                 64.3    4e-14   Citrus sinensis [apfelsine]
ref|XP_006473344.1|  PREDICTED: probable protein phosphatase 2C 1...  64.3    4e-14   
ref|XP_006595966.1|  PREDICTED: probable protein phosphatase 2C 1...  68.2    4e-14   Glycine max [soybeans]
ref|XP_006473342.1|  PREDICTED: probable protein phosphatase 2C 1...  64.3    4e-14   Citrus sinensis [apfelsine]
ref|XP_003545307.1|  PREDICTED: probable protein phosphatase 2C 1...  67.8    4e-14   Glycine max [soybeans]
ref|XP_008805255.1|  PREDICTED: probable protein phosphatase 2C 12    65.1    5e-14   Phoenix dactylifera
ref|XP_004242956.1|  PREDICTED: probable protein phosphatase 2C 12    67.0    5e-14   Solanum lycopersicum
ref|XP_011627378.1|  PREDICTED: probable protein phosphatase 2C 3...  76.6    5e-14   Amborella trichopoda
gb|AES59470.2|  catalytic/protein phosphatase type 2C                 66.6    7e-14   Medicago truncatula
ref|XP_003589219.1|  Protein phosphatase 2C-like protein              66.2    8e-14   
ref|XP_004487674.1|  PREDICTED: probable protein phosphatase 2C 1...  66.6    9e-14   Cicer arietinum [garbanzo]
emb|CDY25665.1|  BnaC05g25440D                                        62.0    1e-13   Brassica napus [oilseed rape]
ref|XP_010092060.1|  putative protein phosphatase 2C 12               63.5    1e-13   
ref|XP_007160841.1|  hypothetical protein PHAVU_001G021200g           63.9    1e-13   Phaseolus vulgaris [French bean]
emb|CAN78409.1|  hypothetical protein VITISV_023178                   63.9    3e-13   Vitis vinifera
ref|XP_003603027.1|  hypothetical protein MTR_3g101540                63.2    4e-13   Medicago truncatula
ref|XP_002284640.1|  PREDICTED: probable protein phosphatase 2C 12    63.5    4e-13   Vitis vinifera
gb|KEH35748.1|  catalytic/protein phosphatase type 2C                 63.2    4e-13   Medicago truncatula
gb|AFK36110.1|  unknown                                               66.6    4e-13   Medicago truncatula
ref|XP_010681640.1|  PREDICTED: probable protein phosphatase 2C 15    75.9    5e-13   
ref|XP_008805807.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  65.9    5e-13   
ref|XP_006855339.1|  PREDICTED: probable protein phosphatase 2C 3...  77.0    6e-13   Amborella trichopoda
ref|XP_007136673.1|  hypothetical protein PHAVU_009G064200g           60.1    8e-13   Phaseolus vulgaris [French bean]
ref|XP_011629229.1|  PREDICTED: probable protein phosphatase 2C 1...  60.5    8e-13   Amborella trichopoda
ref|XP_006829727.2|  PREDICTED: probable protein phosphatase 2C 1...  60.5    8e-13   Amborella trichopoda
gb|ERM97143.1|  hypothetical protein AMTR_s00126p00104180             60.1    1e-12   Amborella trichopoda
ref|XP_010259435.1|  PREDICTED: probable protein phosphatase 2C 5...  75.9    1e-12   Nelumbo nucifera [Indian lotus]
gb|EYU36299.1|  hypothetical protein MIMGU_mgv1a006731mg              60.5    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_010228539.1|  PREDICTED: probable protein phosphatase 2C 1...  63.5    1e-12   Brachypodium distachyon [annual false brome]
ref|XP_010228538.1|  PREDICTED: probable protein phosphatase 2C 1...  63.5    1e-12   
gb|KHN04510.1|  Hypothetical protein glysoja_019597                   65.9    1e-12   Glycine soja [wild soybean]
ref|XP_008658741.1|  PREDICTED: ca2+/calmodulin-dependent protein...  60.5    2e-12   Zea mays [maize]
ref|XP_003523598.2|  PREDICTED: probable protein phosphatase 2C 1...  65.5    2e-12   Glycine max [soybeans]
ref|XP_006448420.1|  hypothetical protein CICLE_v10018331mg           56.2    2e-12   
ref|XP_008646497.1|  PREDICTED: putative protein phosphatase 2C f...  61.6    2e-12   
ref|NP_001170543.1|  putative protein phosphatase 2C family protein   61.6    2e-12   
ref|XP_008646491.1|  PREDICTED: putative protein phosphatase 2C f...  61.6    2e-12   Zea mays [maize]
ref|XP_006578015.1|  PREDICTED: probable protein phosphatase 2C 1...  65.5    2e-12   Glycine max [soybeans]
ref|XP_004984131.1|  PREDICTED: probable protein phosphatase 2C 1...  61.2    2e-12   
ref|XP_002467747.1|  hypothetical protein SORBIDRAFT_01g033320        61.2    3e-12   
ref|XP_004984130.1|  PREDICTED: probable protein phosphatase 2C 1...  61.2    3e-12   
ref|XP_006578016.1|  PREDICTED: probable protein phosphatase 2C 1...  65.5    3e-12   
ref|XP_010061763.1|  PREDICTED: probable protein phosphatase 2C 12    61.6    3e-12   
ref|XP_006578014.1|  PREDICTED: probable protein phosphatase 2C 1...  65.5    3e-12   
ref|XP_009401437.1|  PREDICTED: probable protein phosphatase 2C 1...  58.2    3e-12   
ref|XP_002302440.2|  phosphatase 2C family protein                    59.7    3e-12   
gb|KJB63822.1|  hypothetical protein B456_010G018200                  58.9    3e-12   
ref|XP_011017216.1|  PREDICTED: probable protein phosphatase 2C 12    59.7    3e-12   
ref|XP_011016491.1|  PREDICTED: probable protein phosphatase 2C 12    59.3    3e-12   
ref|XP_010036140.1|  PREDICTED: probable protein phosphatase 2C 12    71.6    4e-12   
ref|XP_008658742.1|  PREDICTED: ca2+/calmodulin-dependent protein...  60.5    4e-12   
ref|XP_006651470.1|  PREDICTED: probable protein phosphatase 2C 1...  62.8    4e-12   
ref|NP_001152457.1|  Ca2+/calmodulin-dependent protein kinase pho...  60.5    5e-12   
ref|XP_008658739.1|  PREDICTED: ca2+/calmodulin-dependent protein...  60.5    5e-12   
ref|XP_008658738.1|  PREDICTED: ca2+/calmodulin-dependent protein...  60.5    5e-12   
ref|XP_008658740.1|  PREDICTED: ca2+/calmodulin-dependent protein...  60.5    5e-12   
gb|KCW66457.1|  hypothetical protein EUGRSUZ_F00253                   70.9    5e-12   
ref|XP_011074446.1|  PREDICTED: probable protein phosphatase 2C 12    58.9    5e-12   
ref|XP_010059966.1|  PREDICTED: probable protein phosphatase 2C 12    71.2    6e-12   
gb|ACN27318.1|  unknown                                               60.1    6e-12   
ref|XP_009359088.1|  PREDICTED: probable protein phosphatase 2C 12    58.5    7e-12   
ref|XP_010667515.1|  PREDICTED: probable protein phosphatase 2C 12    59.3    7e-12   
ref|XP_009610734.1|  PREDICTED: probable protein phosphatase 2C 1...  57.8    9e-12   
ref|XP_011083856.1|  PREDICTED: probable protein phosphatase 2C 1...  57.4    9e-12   
ref|XP_009610735.1|  PREDICTED: probable protein phosphatase 2C 1...  57.8    1e-11   
ref|XP_009764892.1|  PREDICTED: probable protein phosphatase 2C 1...  57.8    1e-11   
ref|XP_011083857.1|  PREDICTED: probable protein phosphatase 2C 1...  57.4    1e-11   
ref|XP_009764893.1|  PREDICTED: probable protein phosphatase 2C 1...  57.4    1e-11   
ref|XP_011083859.1|  PREDICTED: probable protein phosphatase 2C 1...  57.4    1e-11   
ref|XP_011083858.1|  PREDICTED: probable protein phosphatase 2C 1...  57.0    1e-11   
ref|XP_009367363.1|  PREDICTED: probable protein phosphatase 2C 12    57.4    1e-11   
ref|XP_008361008.1|  PREDICTED: probable protein phosphatase 2C 12    57.4    2e-11   
ref|XP_008393818.1|  PREDICTED: probable protein phosphatase 2C 12    57.4    2e-11   
ref|XP_009781091.1|  PREDICTED: probable protein phosphatase 2C 12    55.1    2e-11   
gb|EPS63832.1|  hypothetical protein M569_10947                       55.1    2e-11   
ref|XP_004957026.1|  PREDICTED: probable protein phosphatase 2C 6...  61.6    2e-11   
ref|XP_009620218.1|  PREDICTED: probable protein phosphatase 2C 12    54.7    2e-11   
ref|XP_006660705.1|  PREDICTED: probable protein phosphatase 2C 6...  57.8    3e-11   
ref|XP_010943029.1|  PREDICTED: probable protein phosphatase 2C 1...  59.3    4e-11   
ref|XP_009413632.1|  PREDICTED: probable protein phosphatase 2C 12    58.2    5e-11   
ref|XP_001757865.1|  predicted protein                                62.8    5e-11   
ref|XP_010943030.1|  PREDICTED: probable protein phosphatase 2C 1...  59.3    6e-11   
gb|EEC77369.1|  hypothetical protein OsI_16091                        52.0    6e-11   
ref|NP_001063382.1|  Os09g0459600                                     57.0    6e-11   
gb|AAK52556.1|AC079853_9  Unknown protein                             58.9    6e-11   
gb|EAZ09387.1|  hypothetical protein OsI_31661                        57.0    6e-11   
ref|XP_009380915.1|  PREDICTED: probable protein phosphatase 2C 12    58.2    7e-11   
gb|EEE61087.1|  hypothetical protein OsJ_14978                        52.4    9e-11   
gb|EYU25409.1|  hypothetical protein MIMGU_mgv1a006684mg              55.8    1e-10   
ref|XP_004238165.1|  PREDICTED: probable protein phosphatase 2C 12    55.1    1e-10   
ref|XP_006354899.1|  PREDICTED: probable protein phosphatase 2C 1...  55.1    1e-10   
gb|EMS67839.1|  putative protein phosphatase 2C 33                    65.5    2e-10   
ref|XP_002986557.1|  hypothetical protein SELMODRAFT_235036           54.7    4e-10   
ref|XP_004952708.1|  PREDICTED: probable protein phosphatase 2C 1...  52.8    4e-10   
gb|EPS58059.1|  hypothetical protein M569_16756                       55.5    6e-10   
ref|XP_006653467.1|  PREDICTED: probable protein phosphatase 2C 4...  53.9    8e-10   
ref|XP_004952709.1|  PREDICTED: probable protein phosphatase 2C 1...  52.4    2e-09   
ref|XP_004975776.1|  PREDICTED: probable protein phosphatase 2C 4...  53.1    2e-09   
ref|XP_010939442.1|  PREDICTED: probable protein phosphatase 2C 1...  66.6    2e-09   
emb|CAE01570.2|  OSJNBa0064H22.20                                     52.0    4e-09   
sp|Q7XTC7.3|P2C40_ORYSJ  RecName: Full=Probable protein phosphata...  52.0    4e-09   
ref|XP_002462493.1|  hypothetical protein SORBIDRAFT_02g026710        51.2    4e-09   
ref|XP_003578238.1|  PREDICTED: probable protein phosphatase 2C 69    52.4    4e-09   
ref|XP_009771631.1|  PREDICTED: probable protein phosphatase 2C 12    55.5    4e-09   
ref|NP_001047178.1|  Os02g0567200                                     55.5    5e-09   
emb|CAH67094.1|  H0818E04.11                                          52.0    5e-09   
ref|XP_006648761.1|  PREDICTED: probable protein phosphatase 2C 1...  55.1    5e-09   
ref|XP_010939443.1|  PREDICTED: probable protein phosphatase 2C 1...  64.7    6e-09   
gb|EEC73439.1|  hypothetical protein OsI_07726                        54.7    6e-09   
ref|XP_010239966.1|  PREDICTED: probable protein phosphatase 2C 4...  46.2    9e-09   
gb|EMS59956.1|  putative protein phosphatase 2C 40                    45.8    1e-08   
ref|XP_002979083.1|  hypothetical protein SELMODRAFT_109752           49.3    2e-08   
gb|AAL31893.1|AF419561_1  At1g09160/T12M4_13                          63.5    2e-08   
gb|EPS59533.1|  hypothetical protein M569_15272                       51.2    2e-08   
gb|KJB29498.1|  hypothetical protein B456_005G103200                  63.5    2e-08   
gb|KJB29497.1|  hypothetical protein B456_005G103200                  63.5    2e-08   
ref|NP_001146789.1|  putative protein phosphatase 2C family protein   50.4    5e-08   
dbj|BAK04527.1|  predicted protein                                    50.1    6e-08   
ref|XP_002454036.1|  hypothetical protein SORBIDRAFT_04g023510        50.4    6e-08   
ref|XP_008677565.1|  PREDICTED: uncharacterized protein LOC100382...  50.4    6e-08   
ref|XP_008677561.1|  PREDICTED: uncharacterized protein LOC100382...  50.1    6e-08   
gb|ACF84293.1|  unknown                                               47.4    1e-07   
ref|XP_003575194.1|  PREDICTED: probable protein phosphatase 2C 15    49.3    1e-07   
gb|ACN33405.1|  unknown                                               47.0    1e-07   
ref|NP_001151313.1|  catalytic/ protein phosphatase type 2C           47.0    1e-07   
dbj|BAK00932.1|  predicted protein                                    46.6    1e-07   
gb|ACL54755.1|  unknown                                               49.3    1e-07   
gb|AFW62683.1|  putative protein phosphatase 2C family protein        49.3    1e-07   
ref|XP_003581291.1|  PREDICTED: probable protein phosphatase 2C 4...  46.2    2e-07   
gb|EMT09218.1|  Putative protein phosphatase 2C 69                    53.1    3e-07   
ref|XP_001759688.1|  predicted protein                                53.5    4e-07   
emb|CDM82896.1|  unnamed protein product                              59.3    5e-07   
gb|ACL54158.1|  unknown                                               44.7    5e-07   
ref|NP_001149520.1|  catalytic/ protein phosphatase type 2C           44.7    5e-07   
ref|XP_001781498.1|  predicted protein                                53.9    6e-07   
ref|NP_001141493.1|  uncharacterized protein LOC100273605             44.7    9e-07   
ref|XP_008651098.1|  PREDICTED: uncharacterized protein LOC100273...  44.7    9e-07   
gb|EMS65150.1|  putative protein phosphatase 2C 69                    51.2    9e-07   
gb|EMT30108.1|  Putative protein phosphatase 2C 3                     58.2    1e-06   
gb|ACF87139.1|  unknown                                               57.4    2e-06   
gb|KEH22033.1|  protein phosphatase 2C family protein                 48.5    1e-05   
gb|ACR38631.1|  unknown                                               53.9    2e-05   
ref|NP_001052931.2|  Os04g0449400                                     43.5    2e-05   
gb|AIB05857.1|  orphans transcription factor                          53.9    3e-05   
ref|XP_011076426.1|  PREDICTED: probable protein phosphatase 2C 1...  50.4    4e-04   
ref|XP_011076418.1|  PREDICTED: probable protein phosphatase 2C 1...  50.4    5e-04   



>ref|XP_009599009.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana tomentosiformis]
Length=428

 Score =   166 bits (421),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLFAVGVVEELFEEGSAMLAER  485
            VVDIIPYD P LPPTP KKQ+L +S +FGR+S N RSNKL AVGVVEELFEEGSAMLAER
Sbjct  297  VVDIIPYDHPVLPPTPRKKQNLLTSFLFGRRSQNARSNKLSAVGVVEELFEEGSAMLAER  356

Query  484  LGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LGKDFP DSS G+FRCAVCQADQP SEGL VNSGPFF
Sbjct  357  LGKDFPLDSSSGLFRCAVCQADQPASEGLSVNSGPFF  393


 Score = 65.1 bits (157),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL ATC RKKDAMEGKR SRP + A
Sbjct  391  PFFSPASKPWEGPFLCATCRRKKDAMEGKRPSRPTITA  428



>ref|XP_009799456.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana sylvestris]
Length=428

 Score =   166 bits (421),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLFAVGVVEELFEEGSAMLAER  485
            VVDIIPYD P LPPTP KKQ+L +S +FGR+S N RSNKL AVGVVEELFEEGSAMLAER
Sbjct  297  VVDIIPYDHPVLPPTPRKKQNLLTSFLFGRRSQNARSNKLSAVGVVEELFEEGSAMLAER  356

Query  484  LGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LGKDFP DSS G+FRCAVCQADQP SEGL VNSGPFF
Sbjct  357  LGKDFPLDSSSGLFRCAVCQADQPASEGLSVNSGPFF  393


 Score = 65.1 bits (157),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL ATC RKKDAMEGKR SRP + A
Sbjct  391  PFFSPASKPWEGPFLCATCRRKKDAMEGKRPSRPTITA  428



>ref|XP_006344713.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Solanum tuberosum]
 ref|XP_006344714.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Solanum tuberosum]
Length=427

 Score =   166 bits (421),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLFAVGVVEELFEEGSAMLAER  485
            VVDIIPYD P LPPTP KKQ+L +S +FGR+S N RSNKL AVGVVEELFEEGSAMLAER
Sbjct  296  VVDIIPYDHPILPPTPRKKQNLLTSFLFGRRSQNARSNKLSAVGVVEELFEEGSAMLAER  355

Query  484  LGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LGKDFP DSS G+FRCAVCQADQP SEGL VNSGPFF
Sbjct  356  LGKDFPLDSSSGLFRCAVCQADQPASEGLSVNSGPFF  392


 Score = 63.5 bits (153),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL +TC RKKDAMEGKR SRP + A
Sbjct  390  PFFSPASKPWEGPFLCSTCRRKKDAMEGKRPSRPIITA  427



>ref|XP_004230274.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
 ref|XP_010313289.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
 ref|XP_010313296.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
Length=427

 Score =   162 bits (411),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLFAVGVVEELFEEGSAMLAER  485
            VVDIIPYD P LPPTP KKQ+L +S +F R+S N RSNKL AVGVVEELFEEGSAMLAER
Sbjct  296  VVDIIPYDHPILPPTPRKKQNLLTSFLFRRRSQNARSNKLSAVGVVEELFEEGSAMLAER  355

Query  484  LGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LGKDFP DSS G+FRCAVCQADQP SEGL VNSGPFF
Sbjct  356  LGKDFPLDSSSGLFRCAVCQADQPASEGLSVNSGPFF  392


 Score = 63.5 bits (153),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF P+  PWEGPFL ATC RKKDAMEGKR SRP + A
Sbjct  390  PFFSPSSKPWEGPFLCATCRRKKDAMEGKRPSRPIITA  427



>ref|XP_011092109.1| PREDICTED: probable protein phosphatase 2C 5 [Sesamum indicum]
Length=428

 Score =   156 bits (394),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR-SNKLFAVGVVEELFEEGSAMLAE  488
            VVDIIPYD P LPPTP KKQ+L SSLIFG++  N + +N+L AVGVVEELFEEGSAMLAE
Sbjct  296  VVDIIPYDHPILPPTPKKKQNLLSSLIFGKRYQNAKGANRLSAVGVVEELFEEGSAMLAE  355

Query  487  RLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            RLGKDFP DS+ G+FRCA+CQ DQPPS+GL VNSGPFF
Sbjct  356  RLGKDFPLDSNSGLFRCAICQVDQPPSDGLSVNSGPFF  393


 Score = 62.0 bits (149),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF P+  PWEGPFL A+C RKKDAMEGK+ SRP V A
Sbjct  391  PFFSPSSKPWEGPFLCASCRRKKDAMEGKKPSRPTVTA  428



>ref|XP_007031084.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOY11586.1| Phosphatase 2C family protein [Theobroma cacao]
Length=428

 Score =   151 bits (382),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LPPTP KKQ++FSSL+FG++S N     +NKL  VGVVEELFEEGSAML
Sbjct  294  VVDIIPCDHPVLPPTPRKKQNVFSSLLFGKRSQNSTNKTTNKLSVVGVVEELFEEGSAML  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ GIF+CAVCQ DQPPSEGL VNSGPFF
Sbjct  354  AERLGKDFPMNTNSGIFKCAVCQVDQPPSEGLTVNSGPFF  393


 Score = 59.3 bits (142),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            PFF PA  PWEGPFL   C +KKDAMEGKR SRP V
Sbjct  391  PFFSPASKPWEGPFLCTNCRKKKDAMEGKRPSRPTV  426



>gb|KHG19035.1| hypothetical protein F383_08660 [Gossypium arboreum]
Length=397

 Score =   147 bits (370),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+P LP TP+KKQ+  SS +FG++S    N  +NKL AVGVVEELFEEGSAML
Sbjct  263  VVDIIPSDQPVLPSTPMKKQNALSSFLFGKRSQTSTNKTTNKLSAVGVVEELFEEGSAML  322

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ G+F+CAVCQ DQPP+EGL VNSGPFF
Sbjct  323  AERLGKDFPMNTNSGLFKCAVCQVDQPPAEGLTVNSGPFF  362


 Score = 61.2 bits (147),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL   C +KKDAMEGKR  RP V+A
Sbjct  360  PFFSPASKPWEGPFLCTNCRKKKDAMEGKRSGRPTVLA  397



>gb|KJB45378.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
 gb|KJB45379.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
 gb|KJB45381.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
Length=420

 Score =   145 bits (366),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+P LP TP+KKQ+  SS +FG++S    N  +NKL AVGVVEELFEEGSAML
Sbjct  286  VVDIIPSDQPVLPSTPMKKQNALSSFLFGKRSQTSTNKTTNKLSAVGVVEELFEEGSAML  345

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP + + G+F+CAVCQ DQPP+EGL VNSGPFF
Sbjct  346  AERLGKDFPMNKNSGLFKCAVCQVDQPPAEGLTVNSGPFF  385


 Score = 62.4 bits (150),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL   C +KKDAMEGKR SRP V+A
Sbjct  383  PFFSPASKPWEGPFLCTNCRKKKDAMEGKRSSRPTVLA  420



>gb|KJB45380.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
Length=418

 Score =   145 bits (365),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+P LP TP+KKQ+  SS +FG++S    N  +NKL AVGVVEELFEEGSAML
Sbjct  284  VVDIIPSDQPVLPSTPMKKQNALSSFLFGKRSQTSTNKTTNKLSAVGVVEELFEEGSAML  343

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP + + G+F+CAVCQ DQPP+EGL VNSGPFF
Sbjct  344  AERLGKDFPMNKNSGLFKCAVCQVDQPPAEGLTVNSGPFF  383


 Score = 62.4 bits (150),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL   C +KKDAMEGKR SRP V+A
Sbjct  381  PFFSPASKPWEGPFLCTNCRKKKDAMEGKRSSRPTVLA  418



>ref|XP_008370399.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
 ref|XP_008370400.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
Length=427

 Score =   145 bits (367),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP   P LPPTP+KK ++ +SLIFG+KS N   ++NKL A+GVVEELFEEGSAML 
Sbjct  294  VVDIIPSGHPVLPPTPMKKPNMLASLIFGKKSQNSVNKTNKLSAIGVVEELFEEGSAMLD  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKD P D++ GIFRCAVCQ DQPP EGL VNSGPFF
Sbjct  354  ERLGKDSPVDANSGIFRCAVCQVDQPPVEGLSVNSGPFF  392


 Score = 60.5 bits (145),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PFF PA  PWEGPFL A C  KKDAMEGKR +RP V+
Sbjct  390  PFFSPASKPWEGPFLCAKCQTKKDAMEGKRLTRPTVV  426



>emb|CAN74505.1| hypothetical protein VITISV_015889 [Vitis vinifera]
Length=406

 Score =   142 bits (359),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            VVD+IP D P LPPTP KKQ++ SS IFG++S NF    +NKL AVGVVEELFEEGSAML
Sbjct  270  VVDMIPSDNPVLPPTPKKKQNMLSSFIFGKRSQNFMNKSTNKLSAVGVVEELFEEGSAML  329

Query  493  AERLGKDFPXDSSFGIFRCAVCQA--DQPPSEGLFVNSGPFF  374
            AERLGKD P +++ G+FRCAVCQ   DQ PS+GL VNSGPFF
Sbjct  330  AERLGKDIPSNTNSGLFRCAVCQVDQDQSPSDGLSVNSGPFF  371


 Score = 62.8 bits (151),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL A C +KKDAMEGKR SRP + A
Sbjct  369  PFFSPASKPWEGPFLCANCRKKKDAMEGKRPSRPTITA  406



>ref|XP_002282985.1| PREDICTED: probable protein phosphatase 2C 5 [Vitis vinifera]
 emb|CBI39560.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   142 bits (359),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            VVD+IP D P LPPTP KKQ++ SS IFG++S NF    +NKL AVGVVEELFEEGSAML
Sbjct  294  VVDMIPSDNPVLPPTPKKKQNMLSSFIFGKRSQNFMNKSTNKLSAVGVVEELFEEGSAML  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQA--DQPPSEGLFVNSGPFF  374
            AERLGKD P +++ G+FRCAVCQ   DQ PS+GL VNSGPFF
Sbjct  354  AERLGKDIPSNTNSGLFRCAVCQVDQDQSPSDGLSVNSGPFF  395


 Score = 62.4 bits (150),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL A C +KKDAMEGKR SRP + A
Sbjct  393  PFFSPASKPWEGPFLCANCRKKKDAMEGKRPSRPTITA  430



>ref|XP_006472159.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Citrus sinensis]
 ref|XP_006472160.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Citrus sinensis]
Length=427

 Score =   147 bits (372),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D P   PTP KKQ++ SSLIFG+K+H+    SNKL AVGVVEELFEEGSAMLA
Sbjct  294  VVDIIPSDHPVPAPTPRKKQNVLSSLIFGKKAHDSMKTSNKLAAVGVVEELFEEGSAMLA  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLG+DFP ++S G+FRCAVCQ DQPPS+GL VNSGP+F
Sbjct  354  ERLGRDFPSNASSGLFRCAVCQVDQPPSDGLSVNSGPYF  392


 Score = 55.8 bits (133),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            P+F P   PWEGPFL A C +KKDAMEGKR   P VI 
Sbjct  390  PYFSPTSKPWEGPFLCANCRKKKDAMEGKRPGIPTVIT  427



>ref|XP_006433490.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 ref|XP_006433491.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|ESR46730.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|ESR46731.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|KDO81742.1| hypothetical protein CISIN_1g014281mg [Citrus sinensis]
 gb|KDO81743.1| hypothetical protein CISIN_1g014281mg [Citrus sinensis]
Length=427

 Score =   147 bits (372),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D P   PTP KKQ++ SSLIFG+K+H+    SNKL AVGVVEELFEEGSAMLA
Sbjct  294  VVDIIPSDHPVPAPTPRKKQNVLSSLIFGKKAHDSMKTSNKLAAVGVVEELFEEGSAMLA  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLG+DFP ++S G+FRCAVCQ DQPPS+GL VNSGP+F
Sbjct  354  ERLGRDFPSNASSGLFRCAVCQVDQPPSDGLSVNSGPYF  392


 Score = 55.8 bits (133),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            P+F P   PWEGPFL A C +KKDAMEGKR   P VI
Sbjct  390  PYFSPTSKPWEGPFLCANCRKKKDAMEGKRPGIPTVI  426



>ref|XP_008245693.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
 ref|XP_008245698.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
 ref|XP_008245707.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
Length=428

 Score =   147 bits (371),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D P LPPTP+KKQ++ +SLIFG+K+ N   + NKL +VGVVEELFEEGSAMLA
Sbjct  294  VVDIIPSDHPVLPPTPMKKQNILASLIFGKKTRNSVNKRNKLSSVGVVEELFEEGSAMLA  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKD   D++ G+FRCAVCQ DQPP EGL VNSGPFF
Sbjct  354  ERLGKDSTLDANSGLFRCAVCQVDQPPVEGLSVNSGPFF  392


 Score = 55.8 bits (133),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PFF PA  PWEG FL A C  KKDAMEGKR S P VI
Sbjct  390  PFFSPASKPWEGLFLCAKCRNKKDAMEGKRLSTPTVI  426



>ref|XP_007205239.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
 gb|EMJ06438.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
Length=427

 Score =   147 bits (372),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D P LPPTP+KKQ++ +SLIFG+K+ N   + NKL +VGVVEELFEEGSAMLA
Sbjct  294  VVDIIPSDHPVLPPTPMKKQNILASLIFGKKTRNSVNKRNKLSSVGVVEELFEEGSAMLA  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKD   D++ G+FRCAVCQ DQPP EGL VNSGPFF
Sbjct  354  ERLGKDSTLDANSGLFRCAVCQVDQPPVEGLSVNSGPFF  392


 Score = 55.1 bits (131),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PFF PA  PWEG FL A C  KKDAMEG+R S P VI
Sbjct  390  PFFSPASKPWEGLFLCAKCRNKKDAMEGRRLSTPTVI  426



>ref|XP_007205238.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
 gb|EMJ06437.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
Length=381

 Score =   147 bits (371),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D P LPPTP+KKQ++ +SLIFG+K+ N   + NKL +VGVVEELFEEGSAMLA
Sbjct  248  VVDIIPSDHPVLPPTPMKKQNILASLIFGKKTRNSVNKRNKLSSVGVVEELFEEGSAMLA  307

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKD   D++ G+FRCAVCQ DQPP EGL VNSGPFF
Sbjct  308  ERLGKDSTLDANSGLFRCAVCQVDQPPVEGLSVNSGPFF  346


 Score = 55.1 bits (131),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PFF PA  PWEG FL A C  KKDAMEG+R S P VI
Sbjct  344  PFFSPASKPWEGLFLCAKCRNKKDAMEGRRLSTPTVI  380



>ref|XP_009626600.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana tomentosiformis]
Length=427

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLFAVGVVEELFEEGSAMLAER  485
            VVDIIPYD P LPPTP K+Q+L SS IFGR+S N RS KL  VG+VEELFEEGSAMLAER
Sbjct  296  VVDIIPYDHPVLPPTPRKRQNLLSSFIFGRRSQNSRSKKLSTVGIVEELFEEGSAMLAER  355

Query  484  LGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LGKDFP +SS G+FRCA+CQ DQP SEGL VNSGPFF
Sbjct  356  LGKDFPLNSSSGLFRCAICQVDQPASEGLSVNSGPFF  392


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -3

Query  423  QISRQARACLLIRV-PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            Q+ + A   L +   PFF PA  PWEGPFL A C RKKDAMEGKR SR A+ A
Sbjct  375  QVDQPASEGLSVNSGPFFSPASKPWEGPFLCANCRRKKDAMEGKRPSRAALTA  427



>ref|XP_004494559.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Cicer arietinum]
 ref|XP_004494560.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Cicer arietinum]
Length=429

 Score =   138 bits (348),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LPPTP KKQ++ ++L+FG+KS N     ++KL AVGVVEELFEEGSAML
Sbjct  294  VVDIIPSDLPVLPPTPRKKQNMLTTLLFGKKSDNSSNKATSKLSAVGVVEELFEEGSAML  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
             ERLGKDFP + +  IFRCA+CQ DQPP  GL VNSGPFF
Sbjct  354  IERLGKDFPFNKNSEIFRCAICQVDQPPGNGLSVNSGPFF  393


 Score = 61.2 bits (147),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL   C +KKDAMEGKR SRP V A
Sbjct  391  PFFSPASKPWEGPFLCTNCRKKKDAMEGKRPSRPTVTA  428



>ref|XP_012088951.1| PREDICTED: probable protein phosphatase 2C 5 isoform X3 [Jatropha 
curcas]
Length=370

 Score =   144 bits (362),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LPP P KKQ++ SSL+FG+KS N+    +NKL AVGVVEELFEEGSAML
Sbjct  236  VVDIIPSDLPVLPPIPRKKQNMLSSLLFGKKSLNYVNKATNKLSAVGVVEELFEEGSAML  295

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ G+FRCAVCQ DQPP++ L VNSG FF
Sbjct  296  AERLGKDFPSNTNTGLFRCAVCQVDQPPTDSLSVNSGSFF  335


 Score = 56.2 bits (134),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   PWEGPFL   C +KKDAMEGKR SRP V A
Sbjct  334  FFSPGSKPWEGPFLCPNCRKKKDAMEGKRPSRPIVTA  370



>ref|XP_012088949.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Jatropha 
curcas]
 gb|KDP23425.1| hypothetical protein JCGZ_23258 [Jatropha curcas]
Length=437

 Score =   143 bits (360),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LPP P KKQ++ SSL+FG+KS N+    +NKL AVGVVEELFEEGSAML
Sbjct  303  VVDIIPSDLPVLPPIPRKKQNMLSSLLFGKKSLNYVNKATNKLSAVGVVEELFEEGSAML  362

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ G+FRCAVCQ DQPP++ L VNSG FF
Sbjct  363  AERLGKDFPSNTNTGLFRCAVCQVDQPPTDSLSVNSGSFF  402


 Score = 56.2 bits (134),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   PWEGPFL   C +KKDAMEGKR SRP V A
Sbjct  401  FFSPGSKPWEGPFLCPNCRKKKDAMEGKRPSRPIVTA  437



>ref|XP_012088950.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Jatropha 
curcas]
Length=428

 Score =   143 bits (360),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LPP P KKQ++ SSL+FG+KS N+    +NKL AVGVVEELFEEGSAML
Sbjct  294  VVDIIPSDLPVLPPIPRKKQNMLSSLLFGKKSLNYVNKATNKLSAVGVVEELFEEGSAML  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ G+FRCAVCQ DQPP++ L VNSG FF
Sbjct  354  AERLGKDFPSNTNTGLFRCAVCQVDQPPTDSLSVNSGSFF  393


 Score = 56.2 bits (134),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   PWEGPFL   C +KKDAMEGKR SRP V A
Sbjct  392  FFSPGSKPWEGPFLCPNCRKKKDAMEGKRPSRPIVTA  428



>ref|XP_009338205.1| PREDICTED: probable protein phosphatase 2C 5 [Pyrus x bretschneideri]
 ref|XP_009338206.1| PREDICTED: probable protein phosphatase 2C 5 [Pyrus x bretschneideri]
Length=427

 Score =   139 bits (351),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP   P L PTP+KK ++ +SLIFG+KS N   ++NKL A+GVVEELFEEGSAML 
Sbjct  294  VVDIIPSGHPVLRPTPMKKPNMLASLIFGKKSQNSVNKTNKLSAIGVVEELFEEGSAMLD  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKD P D++ GIFRCAVCQ DQPP EGL VNSG FF
Sbjct  354  ERLGKDSPVDANSGIFRCAVCQVDQPPVEGLSVNSGSFF  392


 Score = 57.8 bits (138),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            FF PA  PWEGPFL A C  KKDAMEGKR +RP V+
Sbjct  391  FFSPASKPWEGPFLCAKCQTKKDAMEGKRLTRPTVV  426



>ref|XP_006604795.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X3 
[Glycine max]
Length=427

 Score =   137 bits (344),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF-GRKSHNFR---SNKLFAVGVVEELFEEGSAM  497
            VVDIIP D P LPP P KK ++ +SL+F G+KS N     +NKL AVGVVEELFEEGSAM
Sbjct  292  VVDIIPSDLPVLPPIPRKKHNMLTSLLFFGKKSENSMNKATNKLSAVGVVEELFEEGSAM  351

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            L ERLGKDFP + + GIFRCAVCQ DQPP +GL +NSGPFF
Sbjct  352  LTERLGKDFPLNKNSGIFRCAVCQMDQPPGDGLSMNSGPFF  392


 Score = 58.9 bits (141),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL   C +KKDAMEGK+ SRP V A
Sbjct  390  PFFSPASNPWEGPFLCTNCWKKKDAMEGKKPSRPTVTA  427



>ref|XP_003554626.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Glycine max]
 ref|XP_006604794.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Glycine max]
 gb|KHN43329.1| Hypothetical protein glysoja_001912 [Glycine soja]
Length=429

 Score =   137 bits (344),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF-GRKSHNFR---SNKLFAVGVVEELFEEGSAM  497
            VVDIIP D P LPP P KK ++ +SL+F G+KS N     +NKL AVGVVEELFEEGSAM
Sbjct  294  VVDIIPSDLPVLPPIPRKKHNMLTSLLFFGKKSENSMNKATNKLSAVGVVEELFEEGSAM  353

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            L ERLGKDFP + + GIFRCAVCQ DQPP +GL +NSGPFF
Sbjct  354  LTERLGKDFPLNKNSGIFRCAVCQMDQPPGDGLSMNSGPFF  394


 Score = 58.9 bits (141),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL   C +KKDAMEGK+ SRP V A
Sbjct  392  PFFSPASNPWEGPFLCTNCWKKKDAMEGKKPSRPTVTA  429



>gb|KHG19034.1| hypothetical protein F383_08660 [Gossypium arboreum]
Length=416

 Score =   145 bits (366),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+P LP TP+KKQ+  SS +FG++S    N  +NKL AVGVVEELFEEGSAML
Sbjct  274  VVDIIPSDQPVLPSTPMKKQNALSSFLFGKRSQTSTNKTTNKLSAVGVVEELFEEGSAML  333

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ G+F+CAVCQ DQPP+EGL VNSGPFF
Sbjct  334  AERLGKDFPMNTNSGLFKCAVCQVDQPPAEGLTVNSGPFF  373


 Score = 50.1 bits (118),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
            PFF PA  PWEGPFL   C +KKDAMEGK  +
Sbjct  371  PFFSPASKPWEGPFLCTNCRKKKDAMEGKSAN  402



>ref|XP_003626183.1| hypothetical protein MTR_7g112430 [Medicago truncatula]
 gb|AES82401.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=428

 Score =   134 bits (338),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P L PTP KK ++ ++L FG+KS N     ++KL AVGVVEELFEEGSAML
Sbjct  294  VVDIIPSDHPVLLPTPKKKHNMLTTLFFGKKSENSTNKATSKLSAVGVVEELFEEGSAML  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
             ERLGKDFP D +  IFRCA+CQ DQPP  GL VNSGPFF
Sbjct  354  IERLGKDFPFDKNSEIFRCAICQVDQPPGNGLSVNSGPFF  393


 Score = 60.5 bits (145),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGPFL   C  KKDAMEGKR SRP V A
Sbjct  391  PFFSPASKPWEGPFLCTNCRNKKDAMEGKRPSRPTVTA  428



>gb|EPS69183.1| hypothetical protein M569_05581, partial [Genlisea aurea]
Length=425

 Score =   140 bits (354),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 83/102 (81%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPA-LPPTPIKKQSLFSSLIFGRKSHNFRS----NKLFAVGVVEELFEEGSA  500
            VVDIIPYD+P  +PPT  KK++  SS +FG++ H+  +    N+L A+GVVEELFEEGSA
Sbjct  295  VVDIIPYDQPVFVPPTHRKKKNFVSSFLFGKRGHDSATKGSANRLSAIGVVEELFEEGSA  354

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            MLAERLGKDFP DS+ G+FRCA+CQADQPP EGL VNSGPFF
Sbjct  355  MLAERLGKDFPLDSNSGLFRCAICQADQPPGEGLSVNSGPFF  396


 Score = 54.3 bits (129),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
            PFF PA  PWEGPFL A+C RKKDAMEGK+
Sbjct  394  PFFSPASKPWEGPFLCASCRRKKDAMEGKK  423



>ref|XP_007163342.1| hypothetical protein PHAVU_001G226800g [Phaseolus vulgaris]
 gb|ESW35336.1| hypothetical protein PHAVU_001G226800g [Phaseolus vulgaris]
Length=429

 Score =   136 bits (342),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLI-FGRKSHNF---RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D P LPPTP KK ++ +SL+ FG+++ N     +NKL AVGVVEELFEEGSAM
Sbjct  294  VVDIIPSDLPVLPPTPRKKHNMLTSLLYFGKRTENSVNKATNKLSAVGVVEELFEEGSAM  353

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            L ERLGKDFP + + GIFRCAVCQ DQPP + L VNSGPFF
Sbjct  354  LTERLGKDFPLNKNSGIFRCAVCQVDQPPGDSLSVNSGPFF  394


 Score = 57.8 bits (138),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA  PWEGP L   C +KKDAMEGKR SR  VIA
Sbjct  392  PFFSPASNPWEGPLLCTNCRKKKDAMEGKRPSRTTVIA  429



>ref|XP_009759573.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana sylvestris]
Length=427

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLFAVGVVEELFEEGSAMLAER  485
            VVDIIPYD   LPPTP KKQ+LFSS I+G+ S N RS KL  VG+VEELFEEGSAMLAER
Sbjct  296  VVDIIPYDHLVLPPTPRKKQNLFSSFIYGKISQNSRSKKLSTVGIVEELFEEGSAMLAER  355

Query  484  LGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LGKDFP +SS G+FRCA+CQ DQP SEGL VNSGPFF
Sbjct  356  LGKDFPLNSSSGLFRCAICQVDQPASEGLSVNSGPFF  392


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -3

Query  423  QISRQARACLLIRV-PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            Q+ + A   L +   PFF PA  PWEGPFL A C RKKDAMEGKR SR A+ A
Sbjct  375  QVDQPASEGLSVNSGPFFSPASKPWEGPFLCANCRRKKDAMEGKRPSRAALTA  427



>ref|XP_011466159.1| PREDICTED: probable protein phosphatase 2C 5 [Fragaria vesca 
subsp. vesca]
Length=426

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHN-FRSNKLFAVGVVEELFEEGSAMLAE  488
            VVDIIP +RP LPPTP KKQ++ +SLIFG+KS N  ++NKL AVGVVEELFEEGSAMLAE
Sbjct  294  VVDIIPSERPVLPPTPRKKQNMLTSLIFGKKSQNGSKTNKLSAVGVVEELFEEGSAMLAE  353

Query  487  RLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            RLGKD P D++ GIFRCAVCQ DQP SEGL VNSGPFF
Sbjct  354  RLGKDIPLDANSGIFRCAVCQVDQPQSEGLSVNSGPFF  391


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -3

Query  411  QARACLLIRVPFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            Q+    +   PFF P+  PWEGPFL A C RKKDAMEGKR S P V
Sbjct  379  QSEGLSVNSGPFFSPSSKPWEGPFLCAVCRRKKDAMEGKRMSTPTV  424



>ref|XP_002512477.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF49929.1| protein phosphatase, putative [Ricinus communis]
Length=436

 Score =   130 bits (327),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 4/100 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LPP P KKQS+ +SL FG+K   S N  +NKL AVGVVEELFEEGSAML
Sbjct  303  VVDIIPSDVPVLPPIPRKKQSMLTSL-FGKKPLNSLNKTTNKLSAVGVVEELFEEGSAML  361

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ G++RCAVCQ DQ P++ L VNS  FF
Sbjct  362  AERLGKDFPSNTNSGLYRCAVCQVDQTPTDSLSVNSASFF  401


 Score = 58.9 bits (141),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   PWEGPFL   C +KKDAMEGKR SRP VIA
Sbjct  400  FFSPGSKPWEGPFLCPNCRKKKDAMEGKRPSRPTVIA  436



>gb|KHN20267.1| Hypothetical protein glysoja_023830 [Glycine soja]
Length=428

 Score =   131 bits (330),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LP  P KK+++ +SL+FG+KS N     +NKL AVGVVEELFEEGSAML
Sbjct  294  VVDIIPSDHPVLPTIPRKKRNVLTSLLFGKKSQNSTNKGTNKLSAVGVVEELFEEGSAML  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
             ERLGKDFP +++  IFRCAVCQADQP  + L +N+GPFF
Sbjct  354  TERLGKDFPSNTNPEIFRCAVCQADQPSVDSLSMNTGPFF  393


 Score = 57.0 bits (136),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF P   PWEGPFL   C +KKDAMEGKR +RP+  A
Sbjct  391  PFFPPVSKPWEGPFLCTNCQKKKDAMEGKRSTRPSETA  428



>ref|XP_010674109.1| PREDICTED: probable protein phosphatase 2C 5 [Beta vulgaris subsp. 
vulgaris]
Length=427

 Score =   132 bits (333),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP   P LPP P KK    S LIFG+KSHN   +S+KL AVG VEELFEEGSAML 
Sbjct  294  VVDIIPSVHPVLPPLPQKKHHGLSGLIFGKKSHNLASKSSKLSAVGAVEELFEEGSAMLE  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKDFP +   G+FRCA+CQ DQP +EGL +NSG FF
Sbjct  354  ERLGKDFPMNPESGLFRCAICQVDQPTNEGLSLNSGTFF  392


 Score = 54.3 bits (129),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            FF P+  PWEGPFL A C RKKDAMEGKR  +P +
Sbjct  391  FFSPSSKPWEGPFLCANCRRKKDAMEGKRPIKPTI  425



>ref|XP_008450571.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450572.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450573.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450574.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
Length=428

 Score =   127 bits (320),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 5/101 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP-TPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAM  497
            VVDIIP ++P L P TP KKQ++ +S  FG+K   S    +NKL AVGVVEELFEEGSAM
Sbjct  294  VVDIIPSEQPILSPSTPRKKQNVLTSF-FGKKYPSSLGKSANKLSAVGVVEELFEEGSAM  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LAERLGKDFP D + GIF+CAVCQADQPP+E L +NSGPFF
Sbjct  353  LAERLGKDFPSDPNSGIFKCAVCQADQPPNENLSMNSGPFF  393


 Score = 57.4 bits (137),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            PFF P+  PWEGPFL ATC +KKDAMEGKR  +P +
Sbjct  391  PFFSPSSKPWEGPFLCATCRKKKDAMEGKRPIKPTI  426



>ref|XP_004135583.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis sativus]
 ref|XP_011659677.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis sativus]
 ref|XP_011659683.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis sativus]
 gb|KGN66026.1| hypothetical protein Csa_1G568550 [Cucumis sativus]
Length=428

 Score =   127 bits (319),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 5/101 (5%)
 Frame = -2

Query  664  VVDIIPYDRPAL-PPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP ++P L P TP KKQ++ +S  FG+K  N     +NKL AVGVVEELFEEGSAM
Sbjct  294  VVDIIPSEQPFLIPSTPRKKQNVLTSF-FGKKYPNSLGKSANKLSAVGVVEELFEEGSAM  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LAERLGKDFP D + GIF+CAVCQADQPP+E L +NSGPFF
Sbjct  353  LAERLGKDFPSDPNSGIFKCAVCQADQPPNENLSMNSGPFF  393


 Score = 57.4 bits (137),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            PFF P+  PWEGPFL ATC +KKDAMEGKR  +P +
Sbjct  391  PFFSPSSKPWEGPFLCATCRKKKDAMEGKRPIKPTI  426



>gb|EYU37269.1| hypothetical protein MIMGU_mgv1a006832mg [Erythranthe guttata]
Length=430

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPP-TPIKKQSLFSSLIFGRKSHNFR--SNKLFAVGVVEELFEEGSAML  494
            VVDIIPYD P LPP  P KKQ+L +SL+FG+K HN    +NKL  VGVVEELFEEGSAML
Sbjct  298  VVDIIPYDHPVLPPPMPKKKQNLLTSLLFGKKFHNSSKGTNKLSTVGVVEELFEEGSAML  357

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            A+RLGKDFP DS+ G+FRCA+CQ DQP SEGL VNSGPFF
Sbjct  358  ADRLGKDFPLDSNSGLFRCAICQVDQPASEGLSVNSGPFF  397


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  423  QISRQARACLLIRV-PFFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
            Q+ + A   L +   PFF P+  PWEGPFL A+C RKKDAMEGK+
Sbjct  380  QVDQPASEGLSVNSGPFFSPSSKPWEGPFLCASCRRKKDAMEGKK  424



>ref|XP_007144975.1| hypothetical protein PHAVU_007G199100g [Phaseolus vulgaris]
 gb|ESW16969.1| hypothetical protein PHAVU_007G199100g [Phaseolus vulgaris]
Length=429

 Score =   136 bits (343),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LP  P KK ++ +SL+FG+KS N     +NKL AVGVVEELFEEGSAML
Sbjct  294  VVDIIPSDHPVLPTIPTKKHNMLTSLLFGKKSKNSTNKSTNKLSAVGVVEELFEEGSAML  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
             ERLGKDFP +++ G FRCAVCQADQP  +GL VN+G FF
Sbjct  354  TERLGKDFPSNTNSGTFRCAVCQADQPSVDGLSVNTGSFF  393


 Score = 46.6 bits (109),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPA  277
            F  P   PWEGP L   C +KKDAMEGKR S P+
Sbjct  393  FSPPVSKPWEGPLLCTNCQKKKDAMEGKRSSMPS  426



>gb|KHN16084.1| Hypothetical protein glysoja_012060 [Glycine soja]
Length=428

 Score =   130 bits (328),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKS---HNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LP  P KK+S+ +SL+FG+KS    N  +NKL AVGVVEELFEEGSAML
Sbjct  294  VVDIIPSDHPMLPAIPRKKRSVLTSLLFGKKSPNSTNKGNNKLSAVGVVEELFEEGSAML  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
             ERLGKDFP +S+ GIFRCAVCQADQP  + + +N+G FF
Sbjct  354  TERLGKDFPSNSNPGIFRCAVCQADQPSVDSVSMNTGSFF  393


 Score = 50.1 bits (118),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   PWEG FL   C +KKDAMEGKR +RP+  A
Sbjct  392  FFPPVSKPWEGLFLCTNCQKKKDAMEGKRSTRPSETA  428



>ref|XP_006382433.1| hypothetical protein POPTR_0005s02110g [Populus trichocarpa]
 gb|ERP60230.1| hypothetical protein POPTR_0005s02110g [Populus trichocarpa]
Length=443

 Score =   129 bits (325),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D   LPP P KK ++FSSL+FG+K   S +  +NKL AVGVVEELFEEGSA+L
Sbjct  309  VVDIIPSDILFLPPIPRKKHNMFSSLLFGKKALSSVSKSTNKLSAVGVVEELFEEGSAVL  368

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ GI RCAVCQ DQ P++GL VNSG FF
Sbjct  369  AERLGKDFPVNTNSGIHRCAVCQVDQTPADGLSVNSGSFF  408


 Score = 50.4 bits (119),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   P EGPFL + C +KKDAMEGKR SR  V A
Sbjct  407  FFSPGSKPCEGPFLCSNCRKKKDAMEGKRPSRTTVTA  443



>gb|KJB26348.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
 gb|KJB26351.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
 gb|KJB26352.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
Length=428

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+P LP TP KKQ++ SS++F +KS NF    +NKL A+GVVEELFEEGSA+L
Sbjct  294  VVDIIPSDQPVLPSTPRKKQNMLSSILFRKKSLNFTNKTTNKLSAIGVVEELFEEGSAVL  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ GIFRCAVCQ DQPP+EGL ++SGPFF
Sbjct  354  AERLGKDFPTNANSGIFRCAVCQVDQPPAEGLTMSSGPFF  393


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  408  ARACLLIRVPFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            A    +   PFF      WEGPFL   C +KKDAMEGKR SRP V+A
Sbjct  382  AEGLTMSSGPFFSHGSKHWEGPFLCTNCRKKKDAMEGKRPSRPTVVA  428



>gb|KHG06373.1| hypothetical protein F383_32810 [Gossypium arboreum]
Length=428

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+P LP TP KKQ++ SS++F +KS NF    +NKL A+GVVEELFEEGSA+L
Sbjct  294  VVDIIPSDQPVLPSTPRKKQNMLSSILFRKKSLNFTNKTTNKLSAIGVVEELFEEGSAVL  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ GIFRCAVCQ DQPP+EGL ++SGPFF
Sbjct  354  AERLGKDFPTNANSGIFRCAVCQVDQPPAEGLTLSSGPFF  393


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  408  ARACLLIRVPFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            A    L   PFF      WEGPFL   C +KKDAMEGKR SRP V+A
Sbjct  382  AEGLTLSSGPFFSQGSKRWEGPFLCTNCQKKKDAMEGKRPSRPTVVA  428



>gb|KJB26350.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
Length=421

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+P LP TP KKQ++ SS++F +KS NF    +NKL A+GVVEELFEEGSA+L
Sbjct  287  VVDIIPSDQPVLPSTPRKKQNMLSSILFRKKSLNFTNKTTNKLSAIGVVEELFEEGSAVL  346

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ GIFRCAVCQ DQPP+EGL ++SGPFF
Sbjct  347  AERLGKDFPTNANSGIFRCAVCQVDQPPAEGLTMSSGPFF  386


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  408  ARACLLIRVPFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            A    +   PFF      WEGPFL   C +KKDAMEGKR SRP V+A
Sbjct  375  AEGLTMSSGPFFSHGSKHWEGPFLCTNCRKKKDAMEGKRPSRPTVVA  421



>emb|CDP17226.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIPYD P LPPTP KK +L +SL FG++S N     S+KL AVG VEELFEEGSAML
Sbjct  295  VVDIIPYDHPVLPPTPKKKHTLLNSLFFGKRSENSMNKGSSKLSAVGAVEELFEEGSAML  354

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +S+ G+F+CA+CQ DQ P +GL VNSGPFF
Sbjct  355  AERLGKDFPLNSNSGLFKCAICQVDQQPGDGLSVNSGPFF  394


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -3

Query  423  QISRQARACLLIRV-PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            Q+ +Q    L +   PFF P   PWEGPFL ATC +KKDAMEGKR S+P + A
Sbjct  377  QVDQQPGDGLSVNSGPFFSPGSKPWEGPFLCATCRKKKDAMEGKRPSKPVITA  429



>ref|XP_003521674.1| PREDICTED: probable protein phosphatase 2C 5-like [Glycine max]
Length=426

 Score =   133 bits (335),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 79/102 (77%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF-GRKSHNF---RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D P LPP P KK ++ +SL+F G+KS N     +NKL AVGVVEELFEEGSAM
Sbjct  294  VVDIIPSDLPVLPPIPRKKHNMLTSLLFFGKKSENSVNKATNKLSAVGVVEELFEEGSAM  353

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPS-EGLFVNSGPFF  374
            L ERLGKDFP + + GIFRCAVCQ DQPP  +GL VNSGPFF
Sbjct  354  LTERLGKDFPLNKNSGIFRCAVCQVDQPPGDDGLSVNSGPFF  395


 Score = 43.1 bits (100),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 24/38 (63%), Gaps = 4/38 (11%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA      PFL   C +KKDAMEGKR SR ++ A
Sbjct  393  PFFSPA----SSPFLCTNCQKKKDAMEGKRPSRASITA  426



>gb|KHN03953.1| Hypothetical protein glysoja_022639 [Glycine soja]
Length=426

 Score =   133 bits (335),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 79/102 (77%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF-GRKSHNFR---SNKLFAVGVVEELFEEGSAM  497
            VVDIIP D P LPP P KK ++ +SL+F G+KS N     +NKL AVGVVEELFEEGSAM
Sbjct  294  VVDIIPSDLPVLPPIPRKKHNMLTSLLFFGKKSENSMNKATNKLSAVGVVEELFEEGSAM  353

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPS-EGLFVNSGPFF  374
            L ERLGKDFP + + GIFRCAVCQ DQPP  +GL VNSGPFF
Sbjct  354  LTERLGKDFPLNKNSGIFRCAVCQVDQPPGDDGLSVNSGPFF  395


 Score = 43.1 bits (100),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 24/38 (63%), Gaps = 4/38 (11%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            PFF PA      PFL   C +KKDAMEGKR SR ++ A
Sbjct  393  PFFSPA----SSPFLCTNCQKKKDAMEGKRPSRASITA  426



>ref|XP_011036917.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Populus 
euphratica]
Length=437

 Score =   127 bits (319),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRS---NKLFAVGVVEELFEEGSAML  494
            VVDIIP D   LP  P KK ++FSSL+FG+K+ N  S   NKL AVG+VEELFEEGSA+L
Sbjct  303  VVDIIPSDILFLPTIPRKKHNMFSSLLFGKKALNSVSKSTNKLSAVGLVEELFEEGSAVL  362

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ GI RCAVCQ DQ P++GL VNSG FF
Sbjct  363  AERLGKDFPVNTNSGIHRCAVCQVDQTPADGLSVNSGSFF  402


 Score = 48.1 bits (113),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   P +G FL + C +KKDAMEGKR SRP V A
Sbjct  401  FFSPGSKPCDGLFLCSNCRKKKDAMEGKRPSRPTVTA  437



>ref|XP_011036918.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Populus 
euphratica]
Length=428

 Score =   127 bits (319),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRS---NKLFAVGVVEELFEEGSAML  494
            VVDIIP D   LP  P KK ++FSSL+FG+K+ N  S   NKL AVG+VEELFEEGSA+L
Sbjct  294  VVDIIPSDILFLPTIPRKKHNMFSSLLFGKKALNSVSKSTNKLSAVGLVEELFEEGSAVL  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP +++ GI RCAVCQ DQ P++GL VNSG FF
Sbjct  354  AERLGKDFPVNTNSGIHRCAVCQVDQTPADGLSVNSGSFF  393


 Score = 48.1 bits (113),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   P +G FL + C +KKDAMEGKR SRP V A
Sbjct  392  FFSPGSKPCDGLFLCSNCRKKKDAMEGKRPSRPTVTA  428



>gb|KCW60535.1| hypothetical protein EUGRSUZ_H03276 [Eucalyptus grandis]
Length=415

 Score =   130 bits (328),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D P +PPTP KKQS  S+ + G+KS   N  ++KL AVG VEELFEEGSAMLA
Sbjct  282  VVDIIPSDIPVIPPTPKKKQSFLSTFLSGKKSQSVNKATSKLSAVGAVEELFEEGSAMLA  341

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKDFP + S G F+CAVCQ DQPP++ L  NSG FF
Sbjct  342  ERLGKDFPSNQSPGTFKCAVCQVDQPPADNLTANSGSFF  380


 Score = 42.7 bits (99),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            FF P     EGPFL   C +KKDAMEGK+ SR  V
Sbjct  379  FFSPTSKSGEGPFLCTICRKKKDAMEGKKPSRSLV  413



>ref|XP_010024104.1| PREDICTED: probable protein phosphatase 2C 5 [Eucalyptus grandis]
Length=427

 Score =   130 bits (328),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D P +PPTP KKQS  S+ + G+KS   N  ++KL AVG VEELFEEGSAMLA
Sbjct  294  VVDIIPSDIPVIPPTPKKKQSFLSTFLSGKKSQSVNKATSKLSAVGAVEELFEEGSAMLA  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKDFP + S G F+CAVCQ DQPP++ L  NSG FF
Sbjct  354  ERLGKDFPSNQSPGTFKCAVCQVDQPPADNLTANSGSFF  392


 Score = 42.7 bits (99),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            FF P     EGPFL   C +KKDAMEGK+ SR  V
Sbjct  391  FFSPTSKSGEGPFLCTICRKKKDAMEGKKPSRSLV  425



>ref|XP_002318970.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE94893.1| phosphatase 2C family protein [Populus trichocarpa]
Length=436

 Score =   115 bits (287),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LPP P KK ++FSSL FG+K   S +  + KL AVG VEELFEEGSA+L
Sbjct  303  VVDIIPSDIPVLPPIPRKKHNMFSSL-FGKKALSSVSKSTKKLSAVGAVEELFEEGSAIL  361

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERL K FP +++ G+ RCAVCQ DQ P + L VNSG FF
Sbjct  362  AERLSKYFPANANSGLCRCAVCQVDQTPGDSLSVNSGSFF  401


 Score = 57.8 bits (138),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   PWEGPFL + C +KKDAMEGKR SRP V+ 
Sbjct  400  FFTPGSKPWEGPFLCSNCQKKKDAMEGKRSSRPTVMT  436



>ref|XP_008388502.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
 ref|XP_008388503.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
Length=427

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP     LPP PIKK ++ +SLIFG+K+ N   ++NKL A+GVVEELFEEGSAML 
Sbjct  294  VVDIIPSGHTVLPPPPIKKXNMLASLIFGKKNQNSMNKTNKLSAIGVVEELFEEGSAMLD  353

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGKD P +++ GIFRCAVCQ DQP  EGL VNS PFF
Sbjct  354  ERLGKDSPLNANSGIFRCAVCQVDQPQVEGLSVNSAPFF  392


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  411  QARACLLIRVPFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            Q     +   PFF PA  PWEGPFL A C  KKDAMEGKR +RP V+
Sbjct  380  QVEGLSVNSAPFFSPASKPWEGPFLCAKCQNKKDAMEGKRLTRPTVV  426



>gb|KEH43094.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=331

 Score =   121 bits (304),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALP--PTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSA  500
            VVDIIP D P LP   TP KK ++ SSL+FG+KS N     +NKL AVGVVEELFEEGSA
Sbjct  202  VVDIIPSDYPVLPMPATPRKKHNVLSSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSA  261

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ML ERLG + P D++ GI RCAVC ADQP  +GL VN+  F 
Sbjct  262  MLTERLGNNVPSDTNSGIHRCAVCLADQPSGDGLSVNNDHFI  303


 Score = 46.6 bits (109),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
            F  P   PWEGPFL   C +KKDAMEGKR
Sbjct  302  FITPVSKPWEGPFLCTNCQKKKDAMEGKR  330



>ref|XP_003591191.1| hypothetical protein MTR_1g083750 [Medicago truncatula]
 gb|AES61442.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=423

 Score =   121 bits (304),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALP--PTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSA  500
            VVDIIP D P LP   TP KK ++ SSL+FG+KS N     +NKL AVGVVEELFEEGSA
Sbjct  294  VVDIIPSDYPVLPMPATPRKKHNVLSSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSA  353

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ML ERLG + P D++ GI RCAVC ADQP  +GL VN+  F 
Sbjct  354  MLTERLGNNVPSDTNSGIHRCAVCLADQPSGDGLSVNNDHFI  395


 Score = 46.6 bits (109),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
            F  P   PWEGPFL   C +KKDAMEGKR
Sbjct  394  FITPVSKPWEGPFLCTNCQKKKDAMEGKR  422



>ref|XP_010528916.1| PREDICTED: probable protein phosphatase 2C 5 [Tarenaya hassleriana]
Length=422

 Score =   127 bits (319),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D   LPPTP KKQ+ FSS +FG+KS NF     NKL AVGVVEELFEEGSA+L
Sbjct  294  VVDIIPSDYLVLPPTPRKKQNAFSSFLFGKKSKNFNVKTGNKLSAVGVVEELFEEGSAVL  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLGKD P ++  G+ +CAVCQAD+  +EGL  N G    +  K
Sbjct  354  AERLGKDMPSNTDTGLLKCAVCQADESHAEGLSTNGGALLSSASK  398


 Score = 40.8 bits (94),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKR  292
            WEGPFL  TC +KKDAMEGKR
Sbjct  400  WEGPFLCTTCKKKKDAMEGKR  420



>ref|XP_010259436.1| PREDICTED: probable protein phosphatase 2C 5 isoform X3 [Nelumbo 
nucifera]
Length=339

 Score =   120 bits (301),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 9/106 (8%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            VVDIIP +   LP TP KKQ++ SS IFG++S N     +NKL +VGVVEELFEEGSAML
Sbjct  202  VVDIIPPEHSVLPSTPRKKQNVISSFIFGKRSQNSINKLTNKLSSVGVVEELFEEGSAML  261

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFV------NSGPFF  374
            +ERLGKDFP  ++ G FRCA+CQ D+PP++G  V      NSG F+
Sbjct  262  SERLGKDFPQKTNSGQFRCAICQVDEPPTDGSEVQSAKCANSGSFY  307


 Score = 47.8 bits (112),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRP  280
            F+ P   PWEGPFL  +C  K DAMEGKR S+P
Sbjct  306  FYSPTSKPWEGPFLCTSCRTKMDAMEGKRPSQP  338



>ref|XP_010259431.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259432.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259433.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
Length=432

 Score =   120 bits (300),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 9/106 (8%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            VVDIIP +   LP TP KKQ++ SS IFG++S N     +NKL +VGVVEELFEEGSAML
Sbjct  295  VVDIIPPEHSVLPSTPRKKQNVISSFIFGKRSQNSINKLTNKLSSVGVVEELFEEGSAML  354

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFV------NSGPFF  374
            +ERLGKDFP  ++ G FRCA+CQ D+PP++G  V      NSG F+
Sbjct  355  SERLGKDFPQKTNSGQFRCAICQVDEPPTDGSEVQSAKCANSGSFY  400


 Score = 47.8 bits (112),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRP  280
            F+ P   PWEGPFL  +C  K DAMEGKR S+P
Sbjct  399  FYSPTSKPWEGPFLCTSCRTKMDAMEGKRPSQP  431



>gb|ABD28356.2| Protein phosphatase 2C-like [Medicago truncatula]
Length=440

 Score =   121 bits (304),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALP--PTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSA  500
            VVDIIP D P LP   TP KK ++ SSL+FG+KS N     +NKL AVGVVEELFEEGSA
Sbjct  294  VVDIIPSDYPVLPMPATPRKKHNVLSSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSA  353

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ML ERLG + P D++ GI RCAVC ADQP  +GL VN+  F 
Sbjct  354  MLTERLGNNVPSDTNSGIHRCAVCLADQPSGDGLSVNNDHFI  395


 Score = 45.8 bits (107),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSR  283
            F  P   PWEGPFL   C +KKDAMEGK  S 
Sbjct  394  FITPVSKPWEGPFLCTNCQKKKDAMEGKSVSN  425



>ref|XP_011023736.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Populus 
euphratica]
Length=437

 Score =   114 bits (284),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LP  P KK ++FSSL FG+K   S +  + KL AVGVVEELFEEGSA+L
Sbjct  304  VVDIIPSDIPVLPAIPRKKHNMFSSL-FGKKALSSVSKSTKKLSAVGVVEELFEEGSAIL  362

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERL K FP +++ G+ RCAVCQ DQ P + L VNSG FF
Sbjct  363  AERLSKYFPANANSGLCRCAVCQVDQTPGDSLSVNSGSFF  402


 Score = 53.1 bits (126),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   P EGPFL + C +KKDAMEGKR SRP V+ 
Sbjct  401  FFSPGSKPREGPFLCSNCQKKKDAMEGKRSSRPTVMT  437



>ref|XP_011023738.1| PREDICTED: probable protein phosphatase 2C 5 isoform X3 [Populus 
euphratica]
Length=428

 Score =   113 bits (283),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LP  P KK ++FSSL FG+K   S +  + KL AVGVVEELFEEGSA+L
Sbjct  295  VVDIIPSDIPVLPAIPRKKHNMFSSL-FGKKALSSVSKSTKKLSAVGVVEELFEEGSAIL  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERL K FP +++ G+ RCAVCQ DQ P + L VNSG FF
Sbjct  354  AERLSKYFPANANSGLCRCAVCQVDQTPGDSLSVNSGSFF  393


 Score = 53.5 bits (127),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   P EGPFL + C +KKDAMEGKR SRP V+ 
Sbjct  392  FFSPGSKPREGPFLCSNCQKKKDAMEGKRSSRPTVMT  428



>ref|XP_011023737.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Populus 
euphratica]
Length=436

 Score =   114 bits (284),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P LP  P KK ++FSSL FG+K   S +  + KL AVGVVEELFEEGSA+L
Sbjct  303  VVDIIPSDIPVLPAIPRKKHNMFSSL-FGKKALSSVSKSTKKLSAVGVVEELFEEGSAIL  361

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERL K FP +++ G+ RCAVCQ DQ P + L VNSG FF
Sbjct  362  AERLSKYFPANANSGLCRCAVCQVDQTPGDSLSVNSGSFF  401


 Score = 53.1 bits (126),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVIA  268
            FF P   P EGPFL + C +KKDAMEGKR SRP V+ 
Sbjct  400  FFSPGSKPREGPFLCSNCQKKKDAMEGKRSSRPTVMT  436



>gb|ACJ83645.1| unknown [Medicago truncatula]
Length=165

 Score =   121 bits (303),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALP--PTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSA  500
            VVDIIP D P LP   TP KK ++ SSL+FG+KS N     +NKL AVGVVEELFEEGSA
Sbjct  36   VVDIIPSDYPVLPMPATPRKKHNVLSSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSA  95

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ML ERLG + P D++ GI RCAVC ADQP  +GL VN+  F 
Sbjct  96   MLTERLGNNVPSDTNSGIHRCAVCLADQPSGDGLSVNNDHFI  137


 Score = 43.9 bits (102),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
            F  P   PWEGPFL   C +KKDAM GKR
Sbjct  136  FITPVFKPWEGPFLCTNCQKKKDAMGGKR  164



>ref|XP_004495681.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Cicer arietinum]
Length=331

 Score =   118 bits (295),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPI--KKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSA  500
            VVDIIP D P  P T    KK ++ SSL+FG+KS N     +NKL A+GVVEELFEEGSA
Sbjct  202  VVDIIPSDYPLSPMTTTLRKKHNMLSSLLFGKKSQNTTNKGTNKLSAIGVVEELFEEGSA  261

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNS  386
            ML ERLGKD P + + GIFRCAVC ADQP S+GL  N+
Sbjct  262  MLTERLGKDVPSNMNSGIFRCAVCLADQPSSDGLSANT  299


 Score = 44.7 bits (104),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
               P   PWEGPFL   C +KKDAMEGKR
Sbjct  302  IITPVSKPWEGPFLCTNCQKKKDAMEGKR  330



>ref|XP_004495680.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Cicer arietinum]
Length=423

 Score =   117 bits (294),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPI--KKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSA  500
            VVDIIP D P  P T    KK ++ SSL+FG+KS N     +NKL A+GVVEELFEEGSA
Sbjct  294  VVDIIPSDYPLSPMTTTLRKKHNMLSSLLFGKKSQNTTNKGTNKLSAIGVVEELFEEGSA  353

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNS  386
            ML ERLGKD P + + GIFRCAVC ADQP S+GL  N+
Sbjct  354  MLTERLGKDVPSNMNSGIFRCAVCLADQPSSDGLSANT  391


 Score = 44.7 bits (104),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
               P   PWEGPFL   C +KKDAMEGKR
Sbjct  394  IITPVSKPWEGPFLCTNCQKKKDAMEGKR  422



>ref|XP_006417602.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 ref|XP_006417603.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 dbj|BAJ34364.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35955.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 gb|ESQ35956.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
Length=428

 Score =   114 bits (285),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDI+P D  AL PTP KKQ+  +S +  +K   ++N   NKL +VGVVEELFEEGSA+L
Sbjct  294  VVDIVPSDHLALAPTPRKKQNTLTSFLSRKKQTDTNNKNGNKLSSVGVVEELFEEGSAVL  353

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            A+RLGKD P ++  G+ +CAVCQ DQ P+E L  + GP   +  K
Sbjct  354  ADRLGKDLPSNTDTGLLKCAVCQIDQSPAEDLLSDEGPIISSASK  398


 Score = 44.7 bits (104),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            P    A   WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  391  PIISSASKRWEGPFLCTICKKKKDAMEGKRPSKGSV  426



>ref|XP_010905680.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
 ref|XP_010905681.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=455

 Score =   109 bits (273),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 72/102 (71%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIP--YDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSA  500
            VVDIIP   DR  LP +P K Q+ F+SL+FG+K  N     +NKL +VG VEELFEEGSA
Sbjct  315  VVDIIPPSSDRCVLPSSPKKHQNKFTSLLFGKKLQNTAGKHTNKLSSVGAVEELFEEGSA  374

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            +L ERLGK+FP  ++   FRCA+CQ DQP SEGL   +G +F
Sbjct  375  ILEERLGKNFPLKANSSPFRCAICQMDQPRSEGLSAIAGTYF  416


 Score = 48.5 bits (114),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            +F P   PWEGP+L   C RKKDAMEGKR S+  V
Sbjct  415  YFSPPSKPWEGPYLCVECRRKKDAMEGKRLSQSTV  449



>ref|XP_010245443.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
 ref|XP_010245444.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
 ref|XP_010245446.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
Length=428

 Score =   111 bits (278),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            V DIIP +   LP T  KKQ++ +SLIF +KS N     +NKL +VGVVEELFEEGSAML
Sbjct  295  VADIIPPEHSVLPLTSGKKQNMLTSLIFRKKSQNSINKLTNKLSSVGVVEELFEEGSAML  354

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLGKDFP   + G F+CA+CQ D+PPS+ +  NSG  +
Sbjct  355  AERLGKDFPLIKNSGQFKCAICQVDEPPSD-VLSNSGSLY  393


 Score = 47.0 bits (110),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            PWEGPFL  TC  K DAMEGKR SRP V
Sbjct  399  PWEGPFLCTTCRTKMDAMEGKRPSRPKV  426



>ref|XP_010553723.1| PREDICTED: probable protein phosphatase 2C 5 [Tarenaya hassleriana]
Length=429

 Score =   118 bits (296),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 5/99 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSLIFGRKSHNFRS---NKLFAVGVVEELFEEGSA  500
            VVD++P D   LPPT  P KKQS FSS +FG+K  N  +   NKL AVGVVEELFEEGSA
Sbjct  294  VVDLVPSDNLVLPPTLTPRKKQSAFSSFLFGKKPKNVNNKTGNKLSAVGVVEELFEEGSA  353

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            +LAERLGKD P ++  G+ +CAVCQAD+ P+EGL ++ G
Sbjct  354  VLAERLGKDIPSNTDTGLLKCAVCQADESPAEGLSIDGG  392


 Score = 38.9 bits (89),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKR  292
            WEGPFL   C +KKDAMEGKR
Sbjct  403  WEGPFLCTNCKKKKDAMEGKR  423



>ref|XP_010475741.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010475742.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   112 bits (280),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRS----NKLFAVGVVEELFEEGSAM  497
            VVDI+P D  AL PTPIKKQ+ F+S +  RK+H   +    NKL AVGVVEELFEEGSA+
Sbjct  294  VVDIVPSDHLALSPTPIKKQNAFTSFL-SRKNHTATNHKNGNKLSAVGVVEELFEEGSAV  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGL  398
            LA+RLGKD P ++  G+ +CAVCQ D+ P EGL
Sbjct  353  LADRLGKDLPSNTENGLLKCAVCQTDESPGEGL  385


 Score = 42.4 bits (98),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  400  WEGPFLCTICKKKKDAMEGKRPSKGSV  426



>ref|XP_010489746.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010489753.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   112 bits (280),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRS----NKLFAVGVVEELFEEGSAM  497
            VVDI+P D  AL PTPIKKQ+ F+S +  RK+H   +    NKL AVGVVEELFEEGSA+
Sbjct  294  VVDIVPSDHLALSPTPIKKQNAFTSFL-SRKNHTATNHKNGNKLSAVGVVEELFEEGSAV  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGL  398
            LA+RLGKD P ++  G+ +CAVCQ D+ P EGL
Sbjct  353  LADRLGKDLPSNTENGLLKCAVCQTDESPGEGL  385


 Score = 42.4 bits (98),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  400  WEGPFLCTICKKKKDAMEGKRPSKGSV  426



>emb|CDX95002.1| BnaC05g06690D [Brassica napus]
Length=329

 Score =   110 bits (274),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDI+P D   L PTP KKQ+  ++ +   K   ++N   NKL  VGVVEELFEEGSA+L
Sbjct  195  VVDIVPADHLTLAPTPSKKQNTLTAFLSRTKHSDTNNKNGNKLSYVGVVEELFEEGSAVL  254

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            A+RLGKD   ++  G+ +CAVCQ DQ P+EGL  N GP   +  K
Sbjct  255  ADRLGKDLLSNTDTGLLKCAVCQIDQSPAEGLSSNEGPIVSSASK  299


 Score = 44.7 bits (104),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  381  PFFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            P    A   WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  292  PIVSSASKRWEGPFLCTICKKKKDAMEGKRPSKVSV  327



>ref|XP_010458188.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010458189.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   111 bits (278),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRS----NKLFAVGVVEELFEEGSAM  497
            VVDI+P D  AL PTP+KKQ+ F+S +  RK+H   +    NKL AVGVVEELFEEGSA+
Sbjct  294  VVDIVPSDHLALSPTPVKKQNAFTSFL-SRKNHTATNHKNGNKLSAVGVVEELFEEGSAV  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGL  398
            LA+RLGKD P ++  G+ +CAVCQ D+ P EGL
Sbjct  353  LADRLGKDLPSNTENGLLKCAVCQTDESPGEGL  385


 Score = 42.4 bits (98),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  400  WEGPFLCTICKKKKDAMEGKRPSKGSV  426



>gb|AFK41874.1| unknown [Medicago truncatula]
Length=468

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALP--PTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSA  500
            VVDIIP D P LP   TP KK ++ SSL+FG+KS N     +NKL AVGVVEELFEEGSA
Sbjct  294  VVDIIPSDYPVLPMPATPRKKHNVLSSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSA  353

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ML ERLG + P D++ GI RCAVC ADQP  +GL VN+  F 
Sbjct  354  MLTERLGNNVPSDTNSGIHRCAVCLADQPSGDGLSVNNDHFI  395



>ref|XP_010938321.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=433

 Score =   104 bits (259),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -2

Query  622  TPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAMLAERLGKDFPXDSSF  452
            +P K Q+ F+SL+FGRKS N     +NKL +VGVVEELFEEGSA+L ERLGK+FP  ++ 
Sbjct  313  SPKKHQNKFTSLLFGRKSQNTAGKHTNKLSSVGVVEELFEEGSAILEERLGKNFPLKANS  372

Query  451  GIFRCAVCQADQPPSEGLFVNSGPFF  374
            G FRCA+CQ DQ P+EGL    G +F
Sbjct  373  GPFRCAICQVDQTPNEGLSATVGSYF  398


 Score = 47.0 bits (110),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            +F P   P EGP+L   C RKKDAMEGKR SR  V
Sbjct  397  YFSPTSKPQEGPYLCVECRRKKDAMEGKRRSRTTV  431



>ref|XP_010099267.1| putative protein phosphatase 2C 15 [Morus notabilis]
 gb|EXB77531.1| putative protein phosphatase 2C 15 [Morus notabilis]
Length=526

 Score =   108 bits (270),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D  A P TP KKQ+ F +L+F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  309  VVDIIPPDNSAQPSTPPKKQNKFRALLFRKKSRDSVNKLSKKLSAVGIVEELFEEGSAML  368

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  369  AERLGNDDSMGQSTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSAK  414


 Score = 41.6 bits (96),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
             F  +  PW+GPFL A C  KKDAMEGKR
Sbjct  408  IFSTSAKPWQGPFLCAGCRNKKDAMEGKR  436



>ref|XP_008795536.1| PREDICTED: probable protein phosphatase 2C 33 [Phoenix dactylifera]
Length=433

 Score =   102 bits (255),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = -2

Query  631  LPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAMLAERLGKDFPXD  461
            LP +P K Q+ F+SL+FGRK  N     +NKL +VGVVEELFEEGSA+L ERLGK+FP  
Sbjct  310  LPLSPKKHQNKFTSLLFGRKLRNTAGKHANKLSSVGVVEELFEEGSAILEERLGKNFPLK  369

Query  460  SSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ++   FRCA+CQ DQ P+EGL   +G +F
Sbjct  370  ANSAPFRCAICQMDQTPNEGLSATAGSYF  398


 Score = 47.0 bits (110),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            +F P   P EGP+L   C RKKDAMEGKR SR  V
Sbjct  397  YFSPTSKPLEGPYLCVECRRKKDAMEGKRRSRSTV  431



>gb|AIZ68189.1| putative protein phosphatase 2C 33 [Ornithogalum saundersiae]
Length=432

 Score =   105 bits (262),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRS--NKLFAVGVVEELFEEGSAMLA  491
            VVDI+P D    PP+P K Q+   SL    +S N     NKL +VG VEELFEEGSAML 
Sbjct  296  VVDIVPSDHSVSPPSPKKHQNKLRSLFLSLRSQNSAKHPNKLSSVGSVEELFEEGSAMLE  355

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            ERLG +FP  ++   FRCA+CQ DQ P+EGL   +G FF +  K
Sbjct  356  ERLGTNFPSKANSSPFRCAICQTDQAPNEGLSATTGSFFSSSPK  399


 Score = 44.3 bits (103),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSR  283
            FF  +   WEGP+L   C +KKDAMEGKR SR
Sbjct  393  FFSSSPKSWEGPYLCTECRKKKDAMEGKRSSR  424



>ref|XP_008807757.1| PREDICTED: probable protein phosphatase 2C 33 [Phoenix dactylifera]
Length=437

 Score =   108 bits (271),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIP--YDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSA  500
            VVDIIP   D   LP +P K Q+ F+SL+FG+KS N     +NKL +VG VEELFEEGSA
Sbjct  297  VVDIIPPSSDCCVLPSSPKKHQNKFTSLLFGKKSQNTVGKHTNKLSSVGAVEELFEEGSA  356

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            +L ERLGK+FP  ++   FRCA+CQ DQ P+EGL   +G  F
Sbjct  357  ILEERLGKNFPLKANSSPFRCAICQMDQTPNEGLSATAGTHF  398


 Score = 40.8 bits (94),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAV  274
             F P     EGP+L   C RKKDAMEGKR S+  V
Sbjct  397  HFSPTSRSSEGPYLCVECRRKKDAMEGKRLSQSTV  431



>ref|XP_006307591.1| hypothetical protein CARUB_v10009213mg [Capsella rubella]
 gb|EOA40489.1| hypothetical protein CARUB_v10009213mg [Capsella rubella]
Length=428

 Score =   106 bits (264),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 66/93 (71%), Gaps = 5/93 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH----NFRSNKLFAVGVVEELFEEGSAM  497
            VVDI+P D  AL PTP KKQ+ F+S +  RK+H    N   NKL AVG VEELFEEGSA+
Sbjct  294  VVDIVPSDHLALAPTPTKKQNAFTSFL-SRKNHTAANNKNGNKLSAVGAVEELFEEGSAV  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGL  398
            LA+RLGKD   ++  G+ +CAVCQ D+ P EGL
Sbjct  353  LADRLGKDLLSNTETGLLKCAVCQTDEFPGEGL  385


 Score = 42.4 bits (98),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  400  WEGPFLCTICKKKKDAMEGKRPSKGSV  426



>emb|CDY31109.1| BnaA08g26590D [Brassica napus]
Length=427

 Score =   105 bits (263),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 4/105 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDI+P D     PTP KKQ+ F++ +  +K   ++N   NKL +VGV EELFEEGSAML
Sbjct  294  VVDIVPSDHLTSAPTPKKKQNTFTAFLSKKKHTDTNNKNGNKLSSVGV-EELFEEGSAML  352

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            A+RLGKD P ++  G+ +CAVCQ DQ P+E L  N G    +  K
Sbjct  353  ADRLGKDLPSNTDTGLLKCAVCQVDQSPAEALSSNEGSIISSASK  397


 Score = 42.7 bits (99),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  399  WEGPFLCTVCKKKKDAMEGKRPSKGSV  425



>ref|XP_009110849.1| PREDICTED: probable protein phosphatase 2C 5 [Brassica rapa]
 ref|XP_009110850.1| PREDICTED: probable protein phosphatase 2C 5 [Brassica rapa]
Length=427

 Score =   105 bits (263),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 4/105 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDI+P D     PTP KKQ+ F++ +  +K   ++N   NKL +VGV EELFEEGSAML
Sbjct  294  VVDIVPSDHLTSAPTPKKKQNTFTAFLSKKKHTDTNNKNGNKLSSVGV-EELFEEGSAML  352

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            A+RLGKD P ++  G+ +CAVCQ DQ P+E L  N G    +  K
Sbjct  353  ADRLGKDLPSNTDTGLLKCAVCQVDQSPAEALSSNEGSIISSASK  397


 Score = 42.7 bits (99),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  399  WEGPFLCTVCKKKKDAMEGKRPSKGSV  425



>ref|XP_010906997.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Elaeis 
guineensis]
Length=368

 Score =   103 bits (256),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAML  494
            VVDIIP D   LPP+P +K +   SLIF ++S +  S    KL AVG+VEELFEEGSAML
Sbjct  234  VVDIIPPDHSVLPPSPPRKMNKLKSLIFRKRSKDSSSKLAKKLSAVGIVEELFEEGSAML  293

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D      + G+F CA+CQ D  PSEG+ V++G  F    K
Sbjct  294  AERLGNDSSAGQETSGLFTCAICQVDLAPSEGISVHAGSIFSTSSK  339


 Score = 45.1 bits (105),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PWEGPFL A C  KKDAMEGKR S   V+
Sbjct  333  IFSTSSKPWEGPFLCADCCNKKDAMEGKRPSGVTVL  368



>emb|CAN76446.1| hypothetical protein VITISV_010117 [Vitis vinifera]
Length=1001

 Score =   102 bits (255),  Expect(2) = 6e-27, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KKQ+   +L+F ++S    N  S KL A+G+VEELFEEGSAML
Sbjct  263  VVDIIPPDNSIQPSTPPKKQNKLRALLFRKRSRDSVNKLSKKLSAIGIVEELFEEGSAML  322

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG ++ P   + G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  323  AERLGSEECPGQPTSGLFMCAVCQVDLXPSEGISVHAGSIFSTSSK  368


 Score = 45.4 bits (106),  Expect(2) = 6e-27, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -3

Query  375  FXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
            F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  363  FSTSSKPWQGPFLCADCRNKKDAMEGKRPS  392



>emb|CDY32154.1| BnaCnng06630D [Brassica napus]
Length=500

 Score =   104 bits (260),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDI+P D     PTP KKQ+ F++ +  +K   ++N   NKL +VGV EELFEEGSAML
Sbjct  368  VVDIVPSDHLTSAPTPKKKQNTFTAFLSKKKHTDTNNKNGNKLSSVGV-EELFEEGSAML  426

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIKXVG  350
            A+RLGKD P ++  G+ +CAVCQ DQ P E L  N G    A  +  G
Sbjct  427  ADRLGKDLPSNTDTGLLKCAVCQVDQSPGEALSSNEGSISSASKRWEG  474


 Score = 42.4 bits (98),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  472  WEGPFLCTICKKKKDAMEGKRPSKGSV  498



>ref|XP_004299042.1| PREDICTED: probable protein phosphatase 2C 15 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464089.1| PREDICTED: probable protein phosphatase 2C 15 [Fragaria vesca 
subsp. vesca]
Length=429

 Score =   105 bits (261),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    PPTP KKQ+   +L+F +KS +     S KL AVG+VEELFEEGSAML
Sbjct  294  VVDIIPPDNSVQPPTPPKKQNKLRALLFRKKSRDSAHKLSKKLSAVGIVEELFEEGSAML  353

Query  493  AERLGKD--FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLG D      ++ G+F CAVCQ D  PSEG+ V++G  F
Sbjct  354  AERLGSDECTAQSTTSGLFMCAVCQVDLAPSEGISVHAGSIF  395


 Score = 42.0 bits (97),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL + C  KKDAMEGKR S   V+
Sbjct  394  IFSMSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVV  429



>ref|XP_009411651.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   108 bits (269),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D     P+P+K+Q+ F SL FG+K  N   + NKL +VG VEELFEEGSAML 
Sbjct  297  VVDIIPSDHTLPLPSPVKQQNKFRSL-FGKKPQNAAGKPNKLSSVGAVEELFEEGSAMLE  355

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ERLGK F    + G+ RCA+CQ DQ P + LFVNSG  F
Sbjct  356  ERLGKSFSSRENTGLLRCAICQTDQVPDDDLFVNSGDLF  394


 Score = 38.1 bits (87),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F P     EGP+L   C RKKDAMEGKR S
Sbjct  393  LFSPPSKQQEGPYLCVDCRRKKDAMEGKRPS  423



>ref|XP_009386662.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=428

 Score = 99.0 bits (245),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D   LP +P K+Q+ F SL+F +KS NF  + NKL +VG VEELFEEGSAML 
Sbjct  297  VVDIIPTDHTHLPLSPRKQQNKFKSLLFRKKSQNFSGKPNKLSSVGSVEELFEEGSAMLE  356

Query  490  ERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNS  386
            ERLGK    +S  G  RCA+CQ DQ P+  L V S
Sbjct  357  ERLGKIHLKNS--GHLRCAICQMDQAPNNDLSVTS  389


 Score = 47.4 bits (111),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  393  LIRVPFFXPA*XPWEGPFLXATCXRKKDAMEGKR  292
            +  V  F PA  PWEGP+L A C RKKDAMEGKR
Sbjct  387  VTSVDGFCPASNPWEGPYLCADCWRKKDAMEGKR  420



>gb|ABK92834.1| unknown [Populus trichocarpa]
Length=113

 Score = 87.8 bits (216),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 58/79 (73%), Gaps = 4/79 (5%)
 Frame = -2

Query  601  LFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAMLAERLGKDFPXDSSFGIFRCAV  431
            +FSSL FG+K   S +  + KL AVG VEELFEEGSA+LAERL K FP +++ G+ RCAV
Sbjct  1    MFSSL-FGKKALSSVSKSTKKLSAVGAVEELFEEGSAILAERLSKYFPANANSGLCRCAV  59

Query  430  CQADQPPSEGLFVNSGPFF  374
            CQ DQ P + L VNSG FF
Sbjct  60   CQVDQTPGDSLSVNSGSFF  78


 Score = 58.2 bits (139),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            FF P   PWEGPFL + C +KKDAMEGKR SRP V+
Sbjct  77   FFTPGSKPWEGPFLCSNCQKKKDAMEGKRSSRPTVM  112



>ref|XP_010264732.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010264741.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
Length=437

 Score =   101 bits (251),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            +VDIIP + P L  TP KKQ+   SLIF ++S    N  + KL AVG+VEELFEEGSAML
Sbjct  303  IVDIIPPENPLLLLTPPKKQNKLRSLIFRKRSQDSANKLAKKLSAVGIVEELFEEGSAML  362

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +     S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  363  AERLGNESSMGQSTSGLFTCAVCQVDLAPSEGISVHAGSIFSTSSK  408


 Score = 43.9 bits (102),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL A C  KKDAMEGKR S   V+
Sbjct  402  IFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVV  437



>ref|XP_002279675.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644317.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644359.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644395.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644423.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 emb|CBI26983.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   101 bits (251),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KKQ+   +L+F ++S    N  S KL A+G+VEELFEEGSAML
Sbjct  293  VVDIIPPDNSIQPSTPPKKQNKLRALLFRKRSRDSVNKLSKKLSAIGIVEELFEEGSAML  352

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG ++ P   + G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  353  AERLGSEECPGQPTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSSK  398


 Score = 43.5 bits (101),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL A C  KKDAMEGKR S   V+
Sbjct  392  IFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGIKVV  427



>ref|XP_009357108.1| PREDICTED: probable protein phosphatase 2C 15 [Pyrus x bretschneideri]
Length=428

 Score =   102 bits (255),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   +L+F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  293  VVDIIPPDTTEQPSTPPKKINKLRTLLFRKKSRDSANKLSKKLSAVGIVEELFEEGSAML  352

Query  493  AERLGKD--FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D   P  ++ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  353  AERLGSDECTPQSTTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSSK  399


 Score = 41.6 bits (96),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  393  IFSTSSKPWQGPFLCSDCRNKKDAMEGKRPS  423



>ref|XP_006378470.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa]
 gb|ERP56267.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa]
Length=428

 Score =   102 bits (253),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KKQ+   +L+F +KSH   +  S KL A+G+VEELFEEGSAML
Sbjct  294  VVDIIPPDNSIPPSTPPKKQNKLRALLFRKKSHFSASKLSKKLSAIGIVEELFEEGSAML  353

Query  493  AERLGK-DFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG  D    S+ G+F C VCQ D  PSEG+ V++G  F    K
Sbjct  354  AERLGNGDSTSQSTSGLFTCVVCQIDLAPSEGISVHAGSIFSTSSK  399


 Score = 42.7 bits (99),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  393  IFSTSSKPWQGPFLCADCRNKKDAMEGKRPS  423



>ref|XP_006842367.2| PREDICTED: probable protein phosphatase 2C 15 [Amborella trichopoda]
 ref|XP_011622609.1| PREDICTED: probable protein phosphatase 2C 15 [Amborella trichopoda]
Length=439

 Score = 99.8 bits (247),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = -2

Query  664  VVDIIP--YDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSA  500
            VVDIIP  Y  P  PP   KKQ+   S IF ++S    N  + KL AVG+VEELFEEGSA
Sbjct  306  VVDIIPPDYSVPVAPPP--KKQNKLRSFIFRKRSRDSVNKLTKKLSAVGIVEELFEEGSA  363

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            MLAERLG D    +  G+F CAVCQ D  PSEG+ V++G FF
Sbjct  364  MLAERLGNDTSGQTPSGLFTCAVCQVDLAPSEGISVHAGSFF  405


 Score = 44.7 bits (104),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
            FF  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  404  FFSISSKPWQGPFLCADCRNKKDAMEGKRPS  434



>gb|ERN04042.1| hypothetical protein AMTR_s00079p00186650 [Amborella trichopoda]
Length=431

 Score = 99.8 bits (247),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = -2

Query  664  VVDIIP--YDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSA  500
            VVDIIP  Y  P  PP   KKQ+   S IF ++S    N  + KL AVG+VEELFEEGSA
Sbjct  298  VVDIIPPDYSVPVAPPP--KKQNKLRSFIFRKRSRDSVNKLTKKLSAVGIVEELFEEGSA  355

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            MLAERLG D    +  G+F CAVCQ D  PSEG+ V++G FF
Sbjct  356  MLAERLGNDTSGQTPSGLFTCAVCQVDLAPSEGISVHAGSFF  397


 Score = 44.3 bits (103),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
            FF  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  396  FFSISSKPWQGPFLCADCRNKKDAMEGKRPS  426



>ref|XP_007222389.1| hypothetical protein PRUPE_ppa006061mg [Prunus persica]
 gb|EMJ23588.1| hypothetical protein PRUPE_ppa006061mg [Prunus persica]
Length=429

 Score =   102 bits (255),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KKQ+   +L F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  294  VVDIIPPDHSVQPSTPPKKQNKLRALFFRKKSRDSANKLSKKLSAVGIVEELFEEGSAML  353

Query  493  AERLGKD--FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D      ++ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  354  AERLGSDECTAQSTTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSSK  400


 Score = 41.2 bits (95),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  394  IFSTSSKPWQGPFLCSDCCNKKDAMEGKRPS  424



>ref|XP_008339644.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=428

 Score =   102 bits (253),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   +L+F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  293  VVDIIPPDITEQPSTPPKKINKLRTLLFRKKSRDSANKLSKKLSAVGIVEELFEEGSAML  352

Query  493  AERLGKD--FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D   P  ++ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  353  AERLGSDECTPQSTTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSSK  399


 Score = 41.6 bits (96),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  393  IFSTSSKPWQGPFLCSDCRNKKDAMEGKRPS  423



>ref|XP_006448418.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 ref|XP_006448419.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 ref|XP_006468741.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Citrus sinensis]
 ref|XP_006468742.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Citrus sinensis]
 gb|ESR61658.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 gb|ESR61659.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
Length=428

 Score =   100 bits (250),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKS---HNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P  P KKQ+   +L+F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  294  VVDIIPPDNTMQPQPPPKKQNKLRALLFRKKSLDSANKLSKKLSAVGIVEELFEEGSAML  353

Query  493  AERLGKDFP-XDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG + P   S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  354  AERLGNEEPVVQSTSGLFTCAVCQIDLAPSEGISVHAGSIFSTSSK  399


 Score = 42.7 bits (99),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  393  IFSTSSKPWQGPFLCADCRNKKDAMEGKRPS  423



>ref|XP_002312412.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE89779.1| phosphatase 2C family protein [Populus trichocarpa]
Length=428

 Score =   100 bits (249),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLF---AVGVVEELFEEGSAML  494
            VVDIIP D    PPTP KK ++  +L+F +K H+  S       A+G VEELFEEGSAML
Sbjct  294  VVDIIPPDNSIQPPTPPKKHNMLRALLFRKKCHDSSSKLSKKLSAIGTVEELFEEGSAML  353

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D+    S+ G+F C VCQ D  PSEG+ V++G  F    K
Sbjct  354  AERLGNDYSTSQSTSGLFTCVVCQIDLAPSEGISVHAGSIFSTSSK  399


 Score = 42.7 bits (99),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  393  IFSTSSKPWQGPFLCADCRNKKDAMEGKRPS  423



>ref|NP_172388.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 ref|NP_849621.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|O80492.1|P2C05_ARATH RecName: Full=Probable protein phosphatase 2C 5; Short=AtPP2C05 
[Arabidopsis thaliana]
 gb|AAC24088.1| Contains similarity to protein phosphatase 2C (ABI1) gb|X78886 
from A. thaliana [Arabidopsis thaliana]
 gb|ABM06026.1| At1g09160 [Arabidopsis thaliana]
 dbj|BAH19588.1| AT1G09160 [Arabidopsis thaliana]
 gb|AEE28405.1| putative protein phosphatase 2C 5 [Arabidopsis thaliana]
 gb|AEE28406.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=428

 Score =   100 bits (249),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 66/93 (71%), Gaps = 5/93 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH----NFRSNKLFAVGVVEELFEEGSAM  497
            VVDI+P    +L P P+KKQ+ F+S +  RK+H    N   NKL AVGVVEELFEEGSA+
Sbjct  294  VVDIVPSGHLSLAPAPMKKQNPFTSFL-SRKNHMDTNNKNGNKLSAVGVVEELFEEGSAV  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGL  398
            LA+RLGKD   ++  G+ +CAVCQ D+ PSE L
Sbjct  353  LADRLGKDLLSNTETGLLKCAVCQIDESPSEDL  385


 Score = 42.4 bits (98),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  400  WEGPFLCTICKKKKDAMEGKRPSKGSV  426



>ref|XP_008243272.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 15 [Prunus mume]
Length=431

 Score =   101 bits (252),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KKQ+   +L F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  296  VVDIIPPDHSLQPSTPPKKQNKLRTLFFRKKSRDSANKLSKKLSAVGIVEELFEEGSAML  355

Query  493  AERLGKD--FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D      ++ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  356  AERLGSDECTAQSTTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSSK  402


 Score = 41.2 bits (95),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  396  IFSTSSKPWQGPFLCSDCCNKKDAMEGKRPS  426



>ref|XP_007044253.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOY00085.1| Phosphatase 2C family protein [Theobroma cacao]
Length=428

 Score = 99.8 bits (247),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF---GRKSHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P  P KKQ+   +L+F    R S N  S KL AVG+VEELFEEGSAML
Sbjct  294  VVDIIPPDNSIQPLPPPKKQNKLRALLFRKRSRDSANKLSKKLSAVGIVEELFEEGSAML  353

Query  493  AERLGK-DFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG  D    ++ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  354  AERLGNDDSAGQTTSGLFTCAVCQVDLAPSEGISVHAGSIFSTSTK  399


 Score = 42.7 bits (99),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  393  IFSTSTKPWQGPFLCADCRNKKDAMEGKRPS  423



>ref|XP_002892487.1| hypothetical protein ARALYDRAFT_471002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68746.1| hypothetical protein ARALYDRAFT_471002 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score = 99.8 bits (247),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 5/93 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH----NFRSNKLFAVGVVEELFEEGSAM  497
            VVDI+P    +L P P+KKQ+ F+S +  RK+H    N   NKL AVGVVEELFEEGSA+
Sbjct  294  VVDIVPSGHLSLAPAPMKKQNAFTSFL-SRKNHTDSNNKNGNKLSAVGVVEELFEEGSAV  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGL  398
            LA+RLGKD P  +  G+ +CAVCQ D+ P E L
Sbjct  353  LADRLGKDPPSHTETGLLKCAVCQTDEFPGEDL  385


 Score = 42.4 bits (98),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSRPAV  274
            WEGPFL   C +KKDAMEGKR S+ +V
Sbjct  400  WEGPFLCTICKKKKDAMEGKRPSKGSV  426



>ref|XP_009356234.1| PREDICTED: probable protein phosphatase 2C 15 [Pyrus x bretschneideri]
Length=428

 Score = 99.8 bits (247),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D      TP KK + F +L F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  293  VVDIIPPDTTVELSTPPKKINKFRTLFFRKKSRASANKLSKKLSAVGIVEELFEEGSAML  352

Query  493  AERLGKD--FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D   P  ++ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  353  AERLGSDECTPQSTTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSSK  399


 Score = 41.6 bits (96),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  393  IFSTSSKPWQGPFLCSDCRNKKDAMEGKRPS  423



>ref|XP_010279327.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279328.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279329.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279330.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
Length=437

 Score = 96.3 bits (238),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKS---HNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D P +   P KKQ+   +LIF ++S    N  +  L  VG+VEELFEEGSAML
Sbjct  303  VVDIIPPDNPVVHVDPPKKQNKLRALIFRKRSCDSANKLAKSLSTVGIVEELFEEGSAML  362

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +     S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  363  AERLGSESSMGQSTSGLFTCAVCQVDLAPSEGISVHAGSIFSTSTK  408


 Score = 43.9 bits (102),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL A C  KKDAMEGKR S   V+
Sbjct  402  IFSTSTKPWQGPFLCADCRNKKDAMEGKRPSGVKVV  437



>ref|XP_002465394.1| hypothetical protein SORBIDRAFT_01g037810 [Sorghum bicolor]
 gb|EER92392.1| hypothetical protein SORBIDRAFT_01g037810 [Sorghum bicolor]
Length=431

 Score = 99.0 bits (245),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 67/97 (69%), Gaps = 4/97 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D  + PP  +P K Q+   SLIFGR+SH+   +  K  ++G VEE+FEEGSAM
Sbjct  295  VVDIIPSDHCSTPPALSPKKNQNKLRSLIFGRRSHSSVGKLTKSASLGSVEEIFEEGSAM  354

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNS  386
            L ERLG++FP  ++   FRCA+CQ DQ P EGL  ++
Sbjct  355  LEERLGRNFPSKANLPPFRCAICQVDQEPFEGLMTDN  391


 Score = 41.2 bits (95),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPA  277
            PW GP+L + C +KKDAMEGKR +R A
Sbjct  402  PWGGPYLCSDCRKKKDAMEGKRSNRSA  428



>ref|XP_008351008.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=248

 Score = 99.0 bits (245),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK + F +L F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  114  VVDIIPPDTTVEPSTPPKKINKFRTLFFRKKSXASANKLSKKLSAVGIVEELFEEGSAML  173

Query  493  AERLGKD-FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  174  AERLGSDECTPQSTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSSK  219


 Score = 40.8 bits (94),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  213  IFSTSSKPWQGPFLCSDCRNKKDAMEGKRPS  243



>ref|XP_008389261.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
 ref|XP_008360042.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=427

 Score = 98.6 bits (244),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P  P KK + F +L F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  293  VVDIIPPDTTVEPSXPPKKINKFRTLFFRKKSXASANKLSKKLSAVGIVEELFEEGSAML  352

Query  493  AERLGKD-FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D   X S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  353  AERLGSDECTXQSTSGLFMCAVCQVDLAPSEGISVHAGSIFSTSSK  398


 Score = 41.6 bits (96),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  392  IFSTSSKPWQGPFLCSDCRNKKDAMEGKRPS  422



>ref|XP_012082143.1| PREDICTED: probable protein phosphatase 2C 15 isoform X3 [Jatropha 
curcas]
Length=428

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            +VDIIP D    P TP KKQ+  ++L+F +KSH   N  S KL AVG+VEELFEEGSAML
Sbjct  294  IVDIIPPDNSVQPSTPPKKQNKLTALLFRKKSHDSTNKLSKKLSAVGIVEELFEEGSAML  353

Query  493  AERLGK-DFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG  D    S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  354  AERLGNDDTATQSTSGLFTCAVCQVDLAPSEGISVHAGSIFSTSSK  399



>ref|XP_012082136.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Jatropha 
curcas]
 ref|XP_012082137.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Jatropha 
curcas]
 ref|XP_012082139.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Jatropha 
curcas]
 ref|XP_012082140.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Jatropha 
curcas]
 ref|XP_012082141.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Jatropha 
curcas]
 ref|XP_012082142.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Jatropha 
curcas]
 gb|KDP29451.1| hypothetical protein JCGZ_18372 [Jatropha curcas]
Length=432

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            +VDIIP D    P TP KKQ+  ++L+F +KSH   N  S KL AVG+VEELFEEGSAML
Sbjct  298  IVDIIPPDNSVQPSTPPKKQNKLTALLFRKKSHDSTNKLSKKLSAVGIVEELFEEGSAML  357

Query  493  AERLGK-DFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG  D    S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  358  AERLGNDDTATQSTSGLFTCAVCQVDLAPSEGISVHAGSIFSTSSK  403



>ref|XP_011022405.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022414.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022422.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022430.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022439.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022447.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
Length=428

 Score = 96.3 bits (238),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLF---AVGVVEELFEEGSAML  494
            VVDIIP D    PPTP KK +   +L+F +K H+  S       A+G VEELFEEGSAML
Sbjct  294  VVDIIPPDNSIQPPTPPKKHNKLRALLFRKKCHDSSSKLSKKLSAIGTVEELFEEGSAML  353

Query  493  AERLGKD-FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     S+ G+F C VCQ D  PSEG+ V++G  F    K
Sbjct  354  AERLGNDGSTSQSTSGLFTCVVCQIDLAPSEGISVHAGSIFSTSSK  399


 Score = 42.7 bits (99),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  393  IFSTSSKPWQGPFLCADCRNKKDAMEGKRPS  423



>ref|XP_008792836.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008778230.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Phoenix 
dactylifera]
Length=458

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAML  494
            VVDIIP D   LPP+P +K +   SLIF ++S +  S    KL AVG+VEELFEEGSAML
Sbjct  324  VVDIIPPDHSVLPPSPPRKTNKLKSLIFRKRSEDSASKLAKKLSAVGIVEELFEEGSAML  383

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     ++ G+F CA+CQAD  PSEG+ V++G  F    K
Sbjct  384  AERLGNDLSAGQATSGLFTCAICQADLAPSEGISVHAGSIFSTSSK  429



>ref|XP_010511830.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010511832.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=440

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 74/111 (67%), Gaps = 11/111 (10%)
 Frame = -2

Query  664  VVDIIP---YDRPALPPTPIKKQS-LFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGS  503
            VVDIIP   +  P  PP+P KK +  F SL+F +KS+  N  S KL +VG+VEELFEEGS
Sbjct  303  VVDIIPPENFQEP--PPSPPKKHNNFFKSLLFRKKSNSSNKLSKKLSSVGIVEELFEEGS  360

Query  502  AMLAERLGK-DFPXDSSF--GIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AML ERLG  DF  +S+   GIF CA+CQ D  PSEG+ V++G  F   +K
Sbjct  361  AMLDERLGSGDFSKESTTGGGIFTCAICQLDLAPSEGISVHAGSIFSTSLK  411


 Score = 42.4 bits (98),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  405  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  440



>ref|XP_002888662.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64921.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. 
lyrata]
Length=438

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 71/110 (65%), Gaps = 9/110 (8%)
 Frame = -2

Query  664  VVDIIP---YDRPALPPTPIKKQSLFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGSA  500
            VVDIIP   +  P LP  P K  + F SL+F +KS+  N  S KL  VG+VEELFEEGSA
Sbjct  301  VVDIIPPENFQEP-LPSPPKKHNNFFKSLLFRKKSNSSNKLSKKLSTVGIVEELFEEGSA  359

Query  499  MLAERLGK-DFPXDSSF--GIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            MLAERLG  D   +S+   GIF CA+CQ D  PSEG+ V++G  F   +K
Sbjct  360  MLAERLGSGDCSKESTTGGGIFTCAICQLDLAPSEGISVHAGSIFSTSLK  409


 Score = 42.4 bits (98),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  403  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  438



>ref|XP_009588473.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   SL F RKS       S KL A+G+VEELFEEGSAML
Sbjct  243  VVDIIPPDNTVQPATPTKKYNKLQSLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAML  302

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +D    S   +F CA+CQ D   SEG+ V++G  F    K
Sbjct  303  AERLGSEDSNGPSMSSLFICAICQVDLAASEGISVHAGSIFSTSSK  348


 Score = 42.0 bits (97),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  342  IFSTSSKPWQGPFLCADCRDKKDAMEGKRPS  372



>ref|XP_009588467.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588468.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588469.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588470.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588471.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588472.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
Length=429

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   SL F RKS       S KL A+G+VEELFEEGSAML
Sbjct  295  VVDIIPPDNTVQPATPTKKYNKLQSLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAML  354

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +D    S   +F CA+CQ D   SEG+ V++G  F    K
Sbjct  355  AERLGSEDSNGPSMSSLFICAICQVDLAASEGISVHAGSIFSTSSK  400


 Score = 42.0 bits (97),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  394  IFSTSSKPWQGPFLCADCRDKKDAMEGKRPS  424



>ref|XP_010320753.1| PREDICTED: probable protein phosphatase 2C 15 [Solanum lycopersicum]
 ref|XP_010320754.1| PREDICTED: probable protein phosphatase 2C 15 [Solanum lycopersicum]
Length=429

 Score = 93.6 bits (231),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGR---KSHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   SL F R   KS    S KL AVG+VEELFEEGSAML
Sbjct  295  VVDIIPPDNTVQPATPPKKYNKLRSLFFRRNSQKSAGKLSKKLSAVGIVEELFEEGSAML  354

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +D    S  G+F CAVCQ D   SEG+ V++G  F    K
Sbjct  355  AERLGSEDSNGPSMSGLFICAVCQVDLAASEGISVHAGSIFSTSSK  400


 Score = 42.4 bits (98),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  394  IFSTSSKPWQGPFLCADCCNKKDAMEGKRPS  424



>ref|XP_008792835.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008778229.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Phoenix 
dactylifera]
Length=460

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAML  494
            VVDIIP D   LPP+P +K +   SLIF ++S +  S    KL AVG+VEELFEEGSAML
Sbjct  326  VVDIIPPDHSVLPPSPPRKTNKLKSLIFRKRSEDSASKLAKKLSAVGIVEELFEEGSAML  385

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     ++ G+F CA+CQAD  PSEG+ V++G  F    K
Sbjct  386  AERLGNDLSAGQATSGLFTCAICQADLAPSEGISVHAGSIFSTSSK  431



>ref|XP_009588474.1| PREDICTED: probable protein phosphatase 2C 3 isoform X3 [Nicotiana 
tomentosiformis]
Length=369

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   SL F RKS       S KL A+G+VEELFEEGSAML
Sbjct  235  VVDIIPPDNTVQPATPTKKYNKLQSLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAML  294

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +D    S   +F CA+CQ D   SEG+ V++G  F    K
Sbjct  295  AERLGSEDSNGPSMSSLFICAICQVDLAASEGISVHAGSIFSTSSK  340


 Score = 42.0 bits (97),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  334  IFSTSSKPWQGPFLCADCRDKKDAMEGKRPS  364



>ref|XP_006645937.1| PREDICTED: probable protein phosphatase 2C 3-like, partial [Oryza 
brachyantha]
Length=403

 Score = 92.8 bits (229),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+    P+P KK +   SLIF +K+    N  + +L AVG+VEELFEEGSAML
Sbjct  269  VVDIIPPDQTIRHPSPPKKINKLKSLIFRKKAKDQTNKLTKQLSAVGMVEELFEEGSAML  328

Query  493  AERLGKDFP-XDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            +ERLG D     +S  +F CA+CQ D  PSEG+ V++G  F +  K
Sbjct  329  SERLGSDSSGRRTSSSLFTCAICQVDLEPSEGISVHAGSIFSSSSK  374


 Score = 43.1 bits (100),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  368  IFSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKVL  403



>ref|NP_177008.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 ref|NP_001031252.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 sp|Q9M9C6.1|P2C15_ARATH RecName: Full=Probable protein phosphatase 2C 15; Short=AtPP2C15 
[Arabidopsis thaliana]
 gb|AAF26041.1|AC015986_4 putative protein phosphatase; 14863-16856 [Arabidopsis thaliana]
 gb|AAK92818.1| putative protein phosphatase [Arabidopsis thaliana]
 gb|AAM14234.1| putative protein phosphatase [Arabidopsis thaliana]
 gb|AEE34790.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 gb|AEE34791.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
Length=436

 Score = 93.2 bits (230),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 11/111 (10%)
 Frame = -2

Query  664  VVDIIP---YDRPALPPTPIKKQS-LFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGS  503
            VVDIIP   +  P  PP+P KK +  F SL+F +KS+  N  S KL  VG+VEELFEEGS
Sbjct  299  VVDIIPPENFQEP--PPSPPKKHNNFFKSLLFRKKSNSSNKLSKKLSTVGIVEELFEEGS  356

Query  502  AMLAERLGK-DFPXDSSF--GIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AMLAERLG  D   +S+   GIF CA+CQ D  PSEG+ V++G  F   +K
Sbjct  357  AMLAERLGSGDCSKESTTGGGIFTCAICQLDLAPSEGISVHAGSIFSTSLK  407


 Score = 42.4 bits (98),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  401  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  436



>ref|XP_009767026.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score = 93.2 bits (230),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   SL F RKS       S KL A+G+VEELFEEGSAML
Sbjct  243  VVDIIPPDSTIRPATPPKKYNKLQSLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAML  302

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +D    S  G F CAVCQ D   SEG+ V++G  F    K
Sbjct  303  AERLGNEDSNGPSMSGFFICAVCQVDLAASEGISVHAGSIFSTSSK  348


 Score = 42.0 bits (97),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  342  IFSTSSKPWQGPFLCADCRDKKDAMEGKRPS  372



>dbj|BAH20040.1| AT1G68410 [Arabidopsis thaliana]
Length=436

 Score = 92.8 bits (229),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 11/111 (10%)
 Frame = -2

Query  664  VVDIIP---YDRPALPPTPIKKQS-LFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGS  503
            VVDIIP   +  P  PP+P KK +  F SL+F +KS+  N  S KL  VG+VEELFEEGS
Sbjct  299  VVDIIPPENFQEP--PPSPPKKHNNFFKSLLFRKKSNSSNKLSKKLSTVGIVEELFEEGS  356

Query  502  AMLAERLGK-DFPXDSSF--GIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AMLAERLG  D   +S+   GIF CA+CQ D  PSEG+ V++G  F   +K
Sbjct  357  AMLAERLGSGDCSKESTTGGGIFTCAICQLDLAPSEGISVHAGSIFSTSLK  407


 Score = 42.4 bits (98),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  401  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  436



>ref|XP_009767028.1| PREDICTED: probable protein phosphatase 2C 3 isoform X3 [Nicotiana 
sylvestris]
Length=369

 Score = 93.2 bits (230),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   SL F RKS       S KL A+G+VEELFEEGSAML
Sbjct  235  VVDIIPPDSTIRPATPPKKYNKLQSLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAML  294

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +D    S  G F CAVCQ D   SEG+ V++G  F    K
Sbjct  295  AERLGNEDSNGPSMSGFFICAVCQVDLAASEGISVHAGSIFSTSSK  340


 Score = 42.0 bits (97),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  334  IFSTSSKPWQGPFLCADCRDKKDAMEGKRPS  364



>ref|XP_009767020.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767021.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767022.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767023.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767024.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767025.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
Length=429

 Score = 93.2 bits (230),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   SL F RKS       S KL A+G+VEELFEEGSAML
Sbjct  295  VVDIIPPDSTIRPATPPKKYNKLQSLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAML  354

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +D    S  G F CAVCQ D   SEG+ V++G  F    K
Sbjct  355  AERLGNEDSNGPSMSGFFICAVCQVDLAASEGISVHAGSIFSTSSK  400


 Score = 42.0 bits (97),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  394  IFSTSSKPWQGPFLCADCRDKKDAMEGKRPS  424



>ref|XP_004984655.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X1 
[Setaria italica]
Length=430

 Score = 94.0 bits (232),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D  + PP  +P + Q++  SLIFGR+SH+   + +K  ++  VEE+FEEGSAM
Sbjct  294  VVDIIPSDHCSTPPALSPKRNQNMLKSLIFGRRSHSSVGKLSKSASLSSVEEIFEEGSAM  353

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNS  386
            L ERLG++FP  ++   FRCA+CQ DQ P EGL  ++
Sbjct  354  LEERLGRNFPSKANLPPFRCAICQVDQEPFEGLMTDN  390


 Score = 40.8 bits (94),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP+L + C +KKDAMEGKR SR
Sbjct  401  PWGGPYLCSDCRKKKDAMEGKRSSR  425



>gb|AFW88634.1| putative protein phosphatase 2C family protein [Zea mays]
Length=430

 Score = 94.7 bits (234),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D  + PP  +P K Q+    LIFG++SH+   + +K  ++G VEE+FEEGSAM
Sbjct  294  VVDIIPSDHCSTPPALSPKKNQNKLKHLIFGKRSHSSVGKLSKSASLGSVEEIFEEGSAM  353

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNS  386
            L ERLG +FP  ++   FRCA+CQ DQ P EGL  ++
Sbjct  354  LEERLGSNFPPKANLPPFRCAICQVDQEPFEGLMTDN  390


 Score = 39.7 bits (91),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP+L + C +KKDAMEGKR +R
Sbjct  401  PWGGPYLCSGCRKKKDAMEGKRSNR  425



>ref|XP_006344157.1| PREDICTED: probable protein phosphatase 2C 15-like [Solanum tuberosum]
Length=429

 Score = 93.6 bits (231),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P TP KK +   SL F RKSH      S KL AVG+VEELFEEGSA+L
Sbjct  295  VVDIIPPDNTVQPATPPKKYNKLRSLFFRRKSHKSAAKLSKKLSAVGIVEELFEEGSAIL  354

Query  493  AERLG-KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG +D    S   +F CAVCQ D   SEG+ V++G  F    K
Sbjct  355  AERLGSEDSNGPSMSDLFICAVCQVDLAASEGISVHAGSIFSTSSK  400


 Score = 40.8 bits (94),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGK+ S
Sbjct  394  IFSTSSKPWQGPFLCADCCNKKDAMEGKQPS  424



>ref|XP_010044241.1| PREDICTED: probable protein phosphatase 2C 15 [Eucalyptus grandis]
 gb|KCW86301.1| hypothetical protein EUGRSUZ_B02992 [Eucalyptus grandis]
Length=428

 Score = 92.0 bits (227),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D       P KKQ+   +L+F  KS    N  S KL A+G+VEELFEEGSAML
Sbjct  294  VVDIIPPDNSIQIAPPPKKQNKLRALLFRSKSKGSANKLSKKLSAIGIVEELFEEGSAML  353

Query  493  AERLGKD-FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     S+ G+F CAVCQ D   SEG+ V++G  F    K
Sbjct  354  AERLGTDESAGQSTSGLFVCAVCQVDLASSEGISVHAGSIFSTNTK  399


 Score = 41.6 bits (96),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F     PW+GPFL   C  KKDAMEGKR S   V+
Sbjct  393  IFSTNTKPWQGPFLCGDCRNKKDAMEGKRPSGVKVV  428



>ref|NP_001049866.1| Os03g0301700 [Oryza sativa Japonica Group]
 sp|Q10MN6.1|P2C33_ORYSJ RecName: Full=Probable protein phosphatase 2C 33; Short=OsPP2C33 
[Oryza sativa Japonica Group]
 gb|ABF95489.1| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11780.1| Os03g0301700 [Oryza sativa Japonica Group]
 dbj|BAG95269.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95599.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97753.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58898.1| hypothetical protein OsJ_10527 [Oryza sativa Japonica Group]
Length=432

 Score = 92.4 bits (228),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSA  500
            VVDIIP D  + PP+  P K Q+   SL+FGR+SH+      NK  +   VEELFEEGSA
Sbjct  295  VVDIIPSDHSSTPPSLSPKKNQNKLRSLLFGRRSHSSVGKLGNKSASFDSVEELFEEGSA  354

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML ERLG++FP  ++    RCA+CQ DQ P E L  ++G
Sbjct  355  MLDERLGRNFPSKANSSPSRCAICQVDQAPFEDLVTDNG  393


 Score = 41.2 bits (95),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP+L + C +KKDAMEGKR SR
Sbjct  403  PWVGPYLCSDCRKKKDAMEGKRSSR  427



>gb|ABR17671.1| unknown [Picea sitchensis]
Length=208

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF---GRKSHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP +  A    P KKQ+   SLIF    R S N  ++KL AVG+VEELFEEGSAML
Sbjct  75   VVDIIPPEHSAPISLPPKKQNKLRSLIFRKRSRDSMNKLTSKLSAVGIVEELFEEGSAML  134

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLG +    ++ G+F CAVCQ D  PSEG+ V++G FF
Sbjct  135  AERLGSESSLAATSGLFTCAVCQTDLTPSEGISVHAGSFF  174



>emb|CDY44900.1| BnaA02g13820D [Brassica napus]
Length=413

 Score = 90.9 bits (224),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 68/110 (62%), Gaps = 8/110 (7%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT-PIKKQS-LFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P + P+KK +  F SL+F +KS+  N  S KL  V +VEELFEEGSAM
Sbjct  275  VVDIIPPDNSQEPSSSPLKKHNNFFRSLLFRKKSNSSNKLSKKLSTVSIVEELFEEGSAM  334

Query  496  LAERLG----KDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            LAERLG       P     G+F CA+CQ D  PSEG+ V++G  F   +K
Sbjct  335  LAERLGSGDCSKEPTTGGGGLFTCAICQLDLAPSEGISVHAGSIFSTSLK  384


 Score = 42.4 bits (98),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  378  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  413



>ref|XP_006302270.1| hypothetical protein CARUB_v10020313mg [Capsella rubella]
 gb|EOA35168.1| hypothetical protein CARUB_v10020313mg [Capsella rubella]
Length=437

 Score = 90.9 bits (224),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 70/109 (64%), Gaps = 7/109 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    PP   P K  + F SL+F +KS+  N  S KL +VG+VEELFEEGSAM
Sbjct  300  VVDIIPPDNFQEPPPSPPKKHNNFFKSLLFRKKSNSSNKLSKKLSSVGIVEELFEEGSAM  359

Query  496  LAERLGK-DFPXDSSF--GIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            L ERLG  D   +S+   GIF CA+CQ D  PS+G+ V++G  F   +K
Sbjct  360  LDERLGSGDCSKESTTGGGIFTCAICQLDLAPSDGISVHAGSIFSTSLK  408


 Score = 42.4 bits (98),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  402  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  437



>ref|NP_001149558.1| LOC100283184 [Zea mays]
 gb|ACG35830.1| protein phosphatase 2C-like [Zea mays]
Length=430

 Score = 94.7 bits (234),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D  + PP  +P K Q+    LIFG++SH+   + +K  ++G VEE+FEEGSAM
Sbjct  294  VVDIIPSDHCSTPPALSPKKNQNKLKHLIFGKRSHSSVGKLSKSASLGSVEEIFEEGSAM  353

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNS  386
            L ERLG +FP  ++   FRCA+CQ DQ P EGL  ++
Sbjct  354  LEERLGSNFPPKANLPPFRCAICQVDQEPFEGLMTDN  390


 Score = 38.1 bits (87),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP+L + C +K DAMEGKR +R
Sbjct  401  PWGGPYLCSGCRKKNDAMEGKRSNR  425



>ref|XP_010415460.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=442

 Score = 90.1 bits (222),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 70/109 (64%), Gaps = 7/109 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGSAM  497
            VVDIIP +    PP   P K  + F SL+F +KS+  N  + KL +VG+VEELFEEGSAM
Sbjct  305  VVDIIPPENIQEPPPSPPKKHNNFFKSLLFRKKSNSSNKLAKKLSSVGIVEELFEEGSAM  364

Query  496  LAERLGK-DFPXDSSF--GIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            L ERLG  D   +S+   GIF CA+CQ D  PSEG+ V++G  F   +K
Sbjct  365  LDERLGSGDCSKESTTGGGIFTCAICQLDLAPSEGISVHAGSIFSTSLK  413


 Score = 42.4 bits (98),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  407  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  442



>ref|XP_008797622.1| PREDICTED: probable protein phosphatase 2C 3 [Phoenix dactylifera]
Length=434

 Score = 87.0 bits (214),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAML  494
            VVDIIP D    PP+P KK +   SLIF ++S +  S    KL AVG+VEELFEEGSAML
Sbjct  300  VVDIIPPDHSVPPPSPPKKMNKLKSLIFRKRSKDSASKLAKKLSAVGIVEELFEEGSAML  359

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
             ERLG D     ++ G+F CA+CQ D  PSEG+ V++G  F    K
Sbjct  360  EERLGNDSSAGQTTSGLFTCAICQVDLAPSEGISVHAGSLFSTSSK  405


 Score = 44.7 bits (104),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PWEGPFL A C  KKDAMEGKR S   V+
Sbjct  399  LFSTSSKPWEGPFLCADCRNKKDAMEGKRPSGVKVL  434



>ref|XP_009385409.1| PREDICTED: probable protein phosphatase 2C 3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385410.1| PREDICTED: probable protein phosphatase 2C 3 [Musa acuminata 
subsp. malaccensis]
Length=432

 Score = 90.5 bits (223),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSA  500
            VVDI   D+ + PP  TP KK +   S IF RK   S N  + KL AVGVVEELFEEGSA
Sbjct  298  VVDITQTDQSSEPPPSTP-KKVNRLKSFIFRRKPKDSVNKLAKKLSAVGVVEELFEEGSA  356

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            MLAERLG D   + +  +F CA+CQA   PS+G+ V++G  F
Sbjct  357  MLAERLGNDSSAEKTSNVFTCAICQAILVPSKGVSVHAGSIF  398


 Score = 41.6 bits (96),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F     PWEGPFL   C  KKDAMEGKR S   V+
Sbjct  397  IFSTNSKPWEGPFLCDDCRNKKDAMEGKRPSGVKVL  432



>ref|XP_010906996.1| PREDICTED: probable protein phosphatase 2C 3 isoform X1 [Elaeis 
guineensis]
Length=438

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAML  494
            VVDIIP D   LPP+P +K +   SLIF ++S +  S    KL AVG+VEELFEEGSAML
Sbjct  304  VVDIIPPDHSVLPPSPPRKMNKLKSLIFRKRSKDSSSKLAKKLSAVGIVEELFEEGSAML  363

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D      + G+F CA+CQ D  PSEG+ V++G  F    K
Sbjct  364  AERLGNDSSAGQETSGLFTCAICQVDLAPSEGISVHAGSIFSTSSK  409



>emb|CDP00657.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 89.0 bits (219),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFG---RKSHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    PP P KK + F + +     R S +  S KL AVG+VEELFEEGSAML
Sbjct  265  VVDIIPPDNTVQPPAPPKKYNKFQAFLLRKIFRDSSSRLSKKLSAVGIVEELFEEGSAML  324

Query  493  AERLGK-DFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG  D    ++ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  325  AERLGNDDSSGQTTVGLFICAVCQTDLAPSEGISVHAGSIFSTSSK  370


 Score = 42.7 bits (99),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL + C  KKDAMEGKR S   V+
Sbjct  364  IFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVKVV  399



>sp|Q0JMD4.2|P2C03_ORYSJ RecName: Full=Probable protein phosphatase 2C 3; Short=OsPP2C03 
[Oryza sativa Japonica Group]
 gb|EEE54680.1| hypothetical protein OsJ_01986 [Oryza sativa Japonica Group]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVD+IP D+    P+P KK +   SLIF +K+    N  + +L A G+VEELFEEGSAML
Sbjct  350  VVDMIPPDQTIRHPSPPKKINKLKSLIFRKKTKDHPNKLTKQLSAAGMVEELFEEGSAML  409

Query  493  AERLGKDFP-XDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            +ERLG D     +S  +F CA+CQ D  PSEG+ V++G  F
Sbjct  410  SERLGNDSSGRRTSSSLFTCAICQVDLEPSEGISVHAGSIF  450


 Score = 41.6 bits (96),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  457  PWEGPFLCSDCRDKKDAMEGKRPSGVKVL  485



>gb|EEC70750.1| hypothetical protein OsI_02161 [Oryza sativa Indica Group]
Length=485

 Score = 89.7 bits (221),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVD+IP D+    P+P KK +   SLIF +K+    N  + +L A G+VEELFEEGSAML
Sbjct  350  VVDMIPPDQTIRHPSPPKKINKLKSLIFRKKTKDHPNKLTKQLSAAGMVEELFEEGSAML  409

Query  493  AERLGKDFP-XDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            +ERLG D     +S  +F CA+CQ D  PSEG+ V++G  F
Sbjct  410  SERLGNDSSGRRTSSSLFTCAICQVDLEPSEGISVHAGSIF  450


 Score = 41.6 bits (96),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  457  PWEGPFLCSDCRDKKDAMEGKRPSGVKVL  485



>ref|XP_010470790.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010470791.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010470792.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=439

 Score = 89.0 bits (219),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 11/111 (10%)
 Frame = -2

Query  664  VVDIIP---YDRPALPPTPIKKQS-LFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGS  503
            VVDIIP   +  P  PP+P K+ +  F SL+F +KS+  N  + KL +VG+VEELFEEGS
Sbjct  302  VVDIIPPENFQEP--PPSPPKRHNNFFKSLLFRKKSNSSNKLAKKLSSVGIVEELFEEGS  359

Query  502  AMLAERLGK-DFPXDSSF--GIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AML ERLG  D   +S+   GIF CA+CQ D  PSEG+ V++G  F   +K
Sbjct  360  AMLDERLGSGDCSKESTTGGGIFTCAICQLDLAPSEGISVHAGSIFSTSLK  410


 Score = 42.4 bits (98),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  404  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  439



>ref|XP_007142943.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris]
 gb|ESW14937.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris]
Length=431

 Score = 90.1 bits (222),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 68/110 (62%), Gaps = 9/110 (8%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTP--IKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            VVDIIP D   LPPTP   K+  L   L F ++S +  S    KL A+ +VEELFEEGSA
Sbjct  294  VVDIIPPDNE-LPPTPPPQKRNRLRDLLSFRKRSRDSASKLSKKLSAINIVEELFEEGSA  352

Query  499  MLAERLGKDFPXD---SSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            MLAERLG D   +   S+ GIF CAVCQ D  PSEG+ V++G  F    K
Sbjct  353  MLAERLGNDDNLNTGQSTSGIFVCAVCQVDLAPSEGISVHAGSIFSTSSK  402


 Score = 40.8 bits (94),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  396  IFSTSSKPWQGPFLCSDCRDKKDAMEGKRPS  426



>ref|XP_004135083.1| PREDICTED: probable protein phosphatase 2C 15 [Cucumis sativus]
 gb|KGN52100.1| hypothetical protein Csa_5G610350 [Cucumis sativus]
Length=433

 Score = 87.8 bits (216),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKS--HNFRSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP D  A      KKQS+  SL+F +KS   N  S +L A+G VEELFE+GSAMLA
Sbjct  298  VVDIIPPDNSAQSSPLPKKQSVLKSLLFRKKSPSSNKLSKRLSAIGFVEELFEDGSAMLA  357

Query  490  ERLGKDFPXDSSFG---IFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            ERLG      S  G   +F C VCQ D  PSEG+ V++G  F    K
Sbjct  358  ERLGTVELSGSGHGTPNMFTCVVCQVDLAPSEGISVHAGSIFSTSSK  404


 Score = 42.4 bits (98),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  398  IFSTSSKPWQGPFLCADCRNKKDAMEGKRPS  428



>ref|NP_001151513.1| LOC100285147 [Zea mays]
 gb|ACG43141.1| protein phosphatase 2C ABI2 [Zea mays]
Length=484

 Score = 87.4 bits (215),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 5/103 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLF----AVGVVEELFEEGSAM  497
            VVDIIP  +   P +P KK S   S IF +K+ +  S KL     AVG+VEE+FEEGSAM
Sbjct  351  VVDIIPPGQTIRPLSPPKKTSKLKSFIFRKKAKD-PSQKLTKQHSAVGIVEEIFEEGSAM  409

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXA  368
            L+ERLG D     +  +F CA+CQ D  PSEG+ V++G  F +
Sbjct  410  LSERLGPDLDGRRTSSLFTCAICQLDLEPSEGISVHAGSIFSS  452


 Score = 42.7 bits (99),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F     PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  449  IFSSTSRPWEGPFLCSDCREKKDAMEGKRPSGVKVL  484



>ref|XP_008446622.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 15 [Cucumis melo]
Length=434

 Score = 87.4 bits (215),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 64/108 (59%), Gaps = 6/108 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D  A      KKQS+  SL+F +K   S N  S +L A+G VEELFE+GSAML
Sbjct  298  VVDIIPPDNSAQSSPLPKKQSVLKSLLFRKKXSPSSNKLSKRLSAIGFVEELFEDGSAML  357

Query  493  AERLGKDFPXDSSFG---IFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG      S  G   +F C VCQ D  PSEG+ V++G  F    K
Sbjct  358  AERLGTVELSGSGHGTPNMFTCVVCQVDLAPSEGISVHAGSIFSTSSK  405


 Score = 42.4 bits (98),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  399  IFSTSSKPWQGPFLCADCRNKKDAMEGKRPS  429



>ref|XP_003567758.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Brachypodium 
distachyon]
Length=468

 Score = 90.9 bits (224),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 66/106 (62%), Gaps = 5/106 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLF----AVGVVEELFEEGSAM  497
            VVDIIP D+    P+P KK +   SLIF RK     SNKL     +VG+VEE+FEEGSAM
Sbjct  335  VVDIIPPDQTMRLPSPPKKMNKIKSLIF-RKKGKVMSNKLTKQLSSVGMVEEIFEEGSAM  393

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            L+ERLG       +  +F CA+CQ D  PSEG+ V++G  F +  K
Sbjct  394  LSERLGNHSSGRRTSSLFTCAICQVDLDPSEGISVHAGSKFSSSSK  439


 Score = 39.3 bits (90),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  375  FXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            F  +  PW+ PFL + C  KKDAMEGKR S   V+
Sbjct  434  FSSSSKPWQSPFLCSDCRDKKDAMEGKRPSGVKVL  468



>ref|XP_006469091.1| PREDICTED: probable protein phosphatase 2C 3-like, partial [Citrus 
sinensis]
Length=323

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKS---HNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P  P KKQ+   +L+F +KS    N  + KL AVG+VEELFEEGSAML
Sbjct  189  VVDIIPPDNTMQPQPPPKKQNKLRALLFRKKSLDSANKLTKKLSAVGIVEELFEEGSAML  248

Query  493  AERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG + P   S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  249  AERLGNEEPVLQSTSGLFTCAVCQIDLAPSEGISVHAGSIFSTSSK  294



>dbj|BAJ89158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score = 85.9 bits (211),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D+   P +P KK +   SLIF +K+    N  + +L + G+VEE+FEEGSA+L
Sbjct  199  VVDIIPSDQTIRPLSPPKKMNKLKSLIFRKKTKDQPNKLTKQLSSAGMVEEIFEEGSAIL  258

Query  493  AERLGKDF-PXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            +ERLG D     +S  +F CA+CQA   PSEG  V+ G  F +  K
Sbjct  259  SERLGNDSGSWRTSSSLFTCAICQAGLEPSEGTSVHVGSVFSSSSK  304


 Score = 42.7 bits (99),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  298  VFSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKVL  333



>ref|XP_002527010.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF35382.1| protein phosphatase, putative [Ricinus communis]
Length=428

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP +    P TP KKQ+   +L+F +KS    N  S KL AVG+VEELFEEGSAML
Sbjct  294  VVDIIPPENSVQPLTPPKKQNKLRALLFRKKSRDAANKLSKKLSAVGIVEELFEEGSAML  353

Query  493  AERLGKD-FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     S+ G+F CAVCQ D   SEG+ V++G  F    K
Sbjct  354  AERLGNDESTTQSTSGLFTCAVCQVDLASSEGISVHAGSIFSTSSK  399



>ref|XP_002455646.1| hypothetical protein SORBIDRAFT_03g016300 [Sorghum bicolor]
 gb|EES00766.1| hypothetical protein SORBIDRAFT_03g016300 [Sorghum bicolor]
Length=496

 Score = 85.5 bits (210),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 5/103 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLF----AVGVVEELFEEGSAM  497
            VVDIIP  +   P +P KK S   SLIF RK     S KL     AVG+VEE+FEEGSAM
Sbjct  363  VVDIIPPGQTIQPLSPPKKMSKLKSLIF-RKKAKDPSQKLTKQHSAVGIVEEIFEEGSAM  421

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXA  368
            L+ERLG       +  +F CA+CQ D  PSEG+ V++G  F +
Sbjct  422  LSERLGPHSDGRRTSSLFTCAICQLDLEPSEGISVHAGSIFSS  464


 Score = 42.7 bits (99),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  461  IFSSSSRPWEGPFLCSDCRDKKDAMEGKRPSGVKVL  496



>ref|XP_009127629.1| PREDICTED: probable protein phosphatase 2C 15 [Brassica rapa]
Length=426

 Score = 85.5 bits (210),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT-PIKKQS-LFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P + P+KK +  F SL+F +KS+  N  S KL  V +VEELFEEGSAM
Sbjct  286  VVDIIPPDNSQEPSSSPLKKHNNFFRSLLFRKKSNSSNKLSKKLSTVSIVEELFEEGSAM  345

Query  496  LAERLGKD------FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            LAERLG               GIF CA+CQ D  PSEG+ V++G  F   +K
Sbjct  346  LAERLGSGDCSKEPTTGGGGGGIFTCAICQLDLAPSEGISVHAGSIFSTSLK  397


 Score = 42.4 bits (98),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  391  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  426



>ref|XP_004497062.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Cicer arietinum]
 ref|XP_004497063.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Cicer arietinum]
 ref|XP_004497064.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Cicer arietinum]
Length=429

 Score = 86.3 bits (212),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 66/108 (61%), Gaps = 8/108 (7%)
 Frame = -2

Query  664  VVDIIPYDR--PALPPTPIKKQSLFSSLIFGRKSHNFR---SNKLFAVGVVEELFEEGSA  500
            VVDIIP D   P+ PP P K+  L     F +KS +     S KL A+ +VEELFEEGSA
Sbjct  295  VVDIIPPDNELPSTPP-PRKRNKLID-FFFRKKSRDSAGKLSKKLSAINIVEELFEEGSA  352

Query  499  MLAERLGK-DFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            MLAERLG  D    S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  353  MLAERLGNDDNTGQSTSGLFVCAVCQVDLAPSEGISVHAGSIFSTSSK  400


 Score = 41.2 bits (95),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL + C  KKDAMEGKR S
Sbjct  394  IFSTSSKPWQGPFLCSDCRDKKDAMEGKRPS  424



>emb|CDX81511.1| BnaC02g18150D [Brassica napus]
Length=438

 Score = 84.7 bits (208),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 67/115 (58%), Gaps = 13/115 (11%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT-PIKKQS-LFSSLIFGRKSH--NFRSNKLFAVGVVEELFEEGSAM  497
            VVD+IP D    P T P+KK +  F SL+F +KS+  N  S KL  V +VEELFEEGSAM
Sbjct  295  VVDVIPPDNSQEPSTSPLKKHNNFFRSLLFRKKSNSSNKLSKKLSTVSIVEELFEEGSAM  354

Query  496  LAERLGKD---------FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            LAERLG                  GIF CA+CQ D  PSEG+ V++G  F   +K
Sbjct  355  LAERLGSGDCSKEPTTGGGGGGGGGIFTCAICQLDLAPSEGISVHAGSIFSTSLK  409


 Score = 42.4 bits (98),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   VI
Sbjct  403  IFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKVI  438



>ref|XP_011076402.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Sesamum 
indicum]
 ref|XP_011076409.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Sesamum 
indicum]
Length=428

 Score = 84.0 bits (206),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 66/100 (66%), Gaps = 3/100 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    PP   KK +   +L+F +KS+   N  S KL +VG+VEELFEEGSAML
Sbjct  295  VVDIIPPDNRVPPPPTPKKYTKLKALLFRKKSYGSANKLSMKLASVGIVEELFEEGSAML  354

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLG D     +  +F CAVCQAD  P+EG+ V++G  F
Sbjct  355  AERLGNDDTSGQTSSLFVCAVCQADLAPNEGISVHAGSIF  394


 Score = 42.7 bits (99),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL A C  KKDAMEGKR S   V+
Sbjct  393  IFSMSSKPWQGPFLCADCRNKKDAMEGKRPSGVRVV  428



>ref|XP_006649947.1| PREDICTED: probable protein phosphatase 2C 33-like [Oryza brachyantha]
Length=336

 Score = 87.0 bits (214),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 8/99 (8%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSA  500
            VVDIIP D  + PP+  P K Q+   SL+FGR+SH+      +K  + G VEELFEEGSA
Sbjct  202  VVDIIPSDHSSTPPSLSPKKSQNKLRSLLFGRRSHSSVGKLGDKSASFGSVEELFEEGSA  261

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML ERLG++FP  ++    RCA+CQ DQ   E L  ++G
Sbjct  262  MLEERLGRNFPSKAN---PRCAICQVDQAQFEDLVADNG  297


 Score = 39.3 bits (90),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXSR  283
            W GP+L + C +KKDAMEGKR SR
Sbjct  308  WSGPYLCSDCRKKKDAMEGKRSSR  331



>ref|XP_004968827.1| PREDICTED: probable protein phosphatase 2C 3-like [Setaria italica]
Length=483

 Score = 83.6 bits (205),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 64/107 (60%), Gaps = 6/107 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLF----AVGVVEELFEEGSAM  497
            VVDIIP  +   P +P KK +   SLIF RK     S KL       GVVEE+FEEGSAM
Sbjct  349  VVDIIPPGQTIRPASPPKKMNKLKSLIF-RKKAKDPSQKLTKQHSGAGVVEEIFEEGSAM  407

Query  496  LAERLGKDFPXD-SSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            L+ERLG D     +S  +F CA+CQ D  PSEG+ V++G  F +  K
Sbjct  408  LSERLGPDSNGGRTSSSLFTCAICQVDLEPSEGISVHAGSIFSSSSK  454


 Score = 42.7 bits (99),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  448  IFSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKVL  483



>gb|KHG10433.1| hypothetical protein F383_12376 [Gossypium arboreum]
Length=426

 Score = 82.8 bits (203),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF---GRKSHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP +    P    KK +   S +F    R S N  S KL AVG+VEELFEEGSAML
Sbjct  292  VVDIIPPENSPPPSPLPKKPNKLRSFLFRKSSRDSANKLSKKLSAVGIVEELFEEGSAML  351

Query  493  AERLGKD-FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     ++ GIF C VCQ D  PSEG+ V++G  F    K
Sbjct  352  AERLGNDEGAGQTTSGIFTCGVCQVDLAPSEGISVHAGSIFSTSSK  397


 Score = 43.1 bits (100),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  391  IFSTSSKPWQGPFLCAACRNKKDAMEGKRPS  421



>ref|XP_003558102.1| PREDICTED: probable protein phosphatase 2C 33 [Brachypodium distachyon]
Length=433

 Score = 90.1 bits (222),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNF-----RSNKLFAVGVVEELFEEG  506
            VVDIIP D  + PP  +P K Q+   SL+FGR+SH+         K  + G VEELFEEG
Sbjct  294  VVDIIPSDHCSTPPPLSPNKNQNKLRSLLFGRRSHSSVGKLGNRKKSASFGFVEELFEEG  353

Query  505  SAMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            SA L ERLG++ P  + F  FRCA+CQ DQ P E L  ++G
Sbjct  354  SAKLEERLGRNSPSKAKFPPFRCAICQVDQVPFEDLMTDNG  394


 Score = 35.4 bits (80),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            P  GP+L + C +KKDAMEGKR S   V
Sbjct  404  PSAGPYLCSDCKKKKDAMEGKRSSPSTV  431



>ref|XP_003562410.1| PREDICTED: probable protein phosphatase 2C 33 [Brachypodium distachyon]
Length=432

 Score = 87.4 bits (215),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 62/98 (63%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPP-TPIKKQSLFSSLIFGRKSHNFRS---NKLFAVGVVEELFEEGSAM  497
            VVDIIP DR   P  +P + Q+   SL+FGR+SH+       K  + G VEELFEEGSAM
Sbjct  296  VVDIIPSDRLVSPQLSPKRNQNKLKSLLFGRRSHSSVGKFGGKSASFGSVEELFEEGSAM  355

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L ERLG++    ++    RCA+CQADQ P EGL   +G
Sbjct  356  LEERLGRNLSLKAASPPSRCAICQADQEPFEGLMAENG  393


 Score = 38.1 bits (87),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW GP+L   C +KKDAMEGKR S
Sbjct  403  PWGGPYLCLECRKKKDAMEGKRSS  426



>ref|NP_001043180.2| Os01g0513100 [Oryza sativa Japonica Group]
 dbj|BAD73079.1| phosphatase-like protein [Oryza sativa Japonica Group]
 dbj|BAD73271.1| phosphatase-like protein [Oryza sativa Japonica Group]
 dbj|BAF05094.2| Os01g0513100 [Oryza sativa Japonica Group]
Length=133

 Score = 83.6 bits (205),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -2

Query  655  IIPYDRPALPPTPIKKQSLFSSLIFGRKSH---NFRSNKLFAVGVVEELFEEGSAMLAER  485
            +IP D+    P+P KK +   SLIF +K+    N  + +L A G+VEELFEEGSAML+ER
Sbjct  1    MIPPDQTIRHPSPPKKINKLKSLIFRKKTKDHPNKLTKQLSAAGMVEELFEEGSAMLSER  60

Query  484  LGKDFP-XDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LG D     +S  +F CA+CQ D  PSEG+ V++G  F
Sbjct  61   LGNDSSGRRTSSSLFTCAICQVDLEPSEGISVHAGSIF  98


 Score = 41.6 bits (96),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  105  PWEGPFLCSDCRDKKDAMEGKRPSGVKVL  133



>ref|XP_003555914.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Glycine max]
 ref|XP_006605919.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Glycine max]
 ref|XP_006605920.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Glycine max]
 gb|KHN11390.1| Hypothetical protein glysoja_015285 [Glycine soja]
Length=431

 Score = 84.0 bits (206),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 64/109 (59%), Gaps = 7/109 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFR----SNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P  P  K++    L+  RKS        S KL A+ +VEELFEEGSAM
Sbjct  294  VVDIIPPDNELPPTPPPPKRNKLRDLLSFRKSSRDSASKLSKKLSAINIVEELFEEGSAM  353

Query  496  LAERLGKDFPXD---SSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            LAERLG D   +   S+ GIF CAVCQ D  PSEG+ V++G  F    K
Sbjct  354  LAERLGNDDNLNSGQSTSGIFVCAVCQVDLAPSEGISVHAGSIFSTSSK  402


 Score = 40.8 bits (94),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PWEGPFL   C  KKDAMEGKR S
Sbjct  396  IFSTSSKPWEGPFLCFDCRDKKDAMEGKRPS  426



>ref|XP_010230932.1| PREDICTED: probable protein phosphatase 2C 3 isoform X1 [Brachypodium 
distachyon]
Length=470

 Score = 85.9 bits (211),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 66/108 (61%), Gaps = 7/108 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNKLF----AVGVVEELFEEGSAM  497
            VVDIIP D+    P+P KK +   SLIF RK     SNKL     +VG+VEE+FEEGSAM
Sbjct  335  VVDIIPPDQTMRLPSPPKKMNKIKSLIF-RKKGKVMSNKLTKQLSSVGMVEEIFEEGSAM  393

Query  496  LAE--RLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            L+E  RLG       +  +F CA+CQ D  PSEG+ V++G  F +  K
Sbjct  394  LSERCRLGNHSSGRRTSSLFTCAICQVDLDPSEGISVHAGSKFSSSSK  441


 Score = 39.3 bits (90),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  375  FXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            F  +  PW+ PFL + C  KKDAMEGKR S   V+
Sbjct  436  FSSSSKPWQSPFLCSDCRDKKDAMEGKRPSGVKVL  470



>gb|ABR16488.1| unknown [Picea sitchensis]
Length=436

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 69/100 (69%), Gaps = 5/100 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAML  494
            VVD+IP ++ A PP P+KKQS F SL F RKS +  S    K   + +V+E+FEEGSAML
Sbjct  305  VVDLIPPEKSA-PPAPVKKQSKFKSL-FRRKSTDSTSKTVEKQQNIDIVQEIFEEGSAML  362

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            AERLG ++   +  G+F CAVCQ D  PSEG+ V++G FF
Sbjct  363  AERLGSEYAVHTVSGLFACAVCQTDITPSEGISVHAGSFF  402



>gb|KHN06682.1| Hypothetical protein glysoja_021228 [Glycine soja]
Length=431

 Score = 83.6 bits (205),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 65/109 (60%), Gaps = 7/109 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK----SHNFRSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P  P  K++    L+  RK    S +  S KL A+ +VEELFEEGSAM
Sbjct  294  VVDIIPPDNELPPTPPPPKRNKLRDLLSFRKRSRDSASKLSKKLSAINIVEELFEEGSAM  353

Query  496  LAERLGKDFPXD---SSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            LAERLG D   +   S+ GIF CAVCQ D  PSEG+ V++G  F    K
Sbjct  354  LAERLGNDDNLNSGQSTSGIFVCAVCQVDLAPSEGISVHAGSIFSTSSK  402


 Score = 40.8 bits (94),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PWEGPFL   C  KKDAMEGKR S
Sbjct  396  IFSTSSKPWEGPFLCFDCRDKKDAMEGKRPS  426



>ref|XP_003536672.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Glycine max]
 ref|XP_006589677.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Glycine max]
 ref|XP_006589678.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Glycine max]
 ref|XP_006589679.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X4 
[Glycine max]
Length=431

 Score = 83.6 bits (205),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 65/109 (60%), Gaps = 7/109 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRK----SHNFRSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P  P  K++    L+  RK    S +  S KL A+ +VEELFEEGSAM
Sbjct  294  VVDIIPPDNELPPTPPPPKRNKLRDLLSFRKRSRDSASKLSKKLSAINIVEELFEEGSAM  353

Query  496  LAERLGKDFPXD---SSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            LAERLG D   +   S+ GIF CAVCQ D  PSEG+ V++G  F    K
Sbjct  354  LAERLGNDDNLNSGQSTSGIFVCAVCQVDLAPSEGISVHAGSIFSTSSK  402


 Score = 40.8 bits (94),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PWEGPFL   C  KKDAMEGKR S
Sbjct  396  IFSTSSKPWEGPFLCFDCRDKKDAMEGKRPS  426



>ref|NP_001060712.1| Os07g0690400 [Oryza sativa Japonica Group]
 dbj|BAC83509.1| protein phosphatase 2C-like [Oryza sativa Japonica Group]
 dbj|BAF22626.1| Os07g0690400 [Oryza sativa Japonica Group]
 gb|EAZ05225.1| hypothetical protein OsI_27423 [Oryza sativa Indica Group]
 dbj|BAG90982.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86930.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67858.1| hypothetical protein OsJ_25666 [Oryza sativa Japonica Group]
Length=431

 Score = 85.9 bits (211),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSA  500
            VVDIIP D     P  +P + QS F SL+FGR+SH+       K  + G VEELFEEGSA
Sbjct  294  VVDIIPSDYRLTSPQLSPKRNQSKFKSLLFGRRSHSSIGKLGGKSASFGSVEELFEEGSA  353

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ML ERLG++    ++    RCA+CQ DQ P E +    G  +
Sbjct  354  MLEERLGRNLSLKATSAPLRCAICQVDQEPFESMMTEKGGSY  395


 Score = 38.1 bits (87),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP+L   C +KKDAMEGKR S 
Sbjct  402  PWGGPYLCLECRKKKDAMEGKRSSH  426



>gb|KJB31458.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
Length=427

 Score = 80.5 bits (197),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF---GRKSHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP +    P    KK +   S +F    R S N  S KL AVG+VEELFEEGSAML
Sbjct  293  VVDIIPPESSPPPSPLPKKPNKLRSFLFRKSSRDSANKLSKKLSAVGIVEELFEEGSAML  352

Query  493  AERLGKD-FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     ++ G+F C VCQ D  PSEG+ V++G  F    K
Sbjct  353  AERLGIDEGAGQTTSGLFTCGVCQVDLAPSEGISVHAGSIFSTSSK  398


 Score = 43.1 bits (100),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  392  IFSTSSKPWQGPFLCAACRNKKDAMEGKRPS  422



>gb|KJB31457.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
 gb|KJB31459.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
 gb|KJB31460.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
Length=428

 Score = 80.5 bits (197),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIF---GRKSHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP +    P    KK +   S +F    R S N  S KL AVG+VEELFEEGSAML
Sbjct  294  VVDIIPPESSPPPSPLPKKPNKLRSFLFRKSSRDSANKLSKKLSAVGIVEELFEEGSAML  353

Query  493  AERLGKD-FPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     ++ G+F C VCQ D  PSEG+ V++G  F    K
Sbjct  354  AERLGIDEGAGQTTSGLFTCGVCQVDLAPSEGISVHAGSIFSTSSK  399


 Score = 43.1 bits (100),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXS  286
             F  +  PW+GPFL A C  KKDAMEGKR S
Sbjct  393  IFSTSSKPWQGPFLCAACRNKKDAMEGKRPS  423



>emb|CDY17840.1| BnaC08g04540D [Brassica napus]
Length=428

 Score = 78.6 bits (192),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RKS +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPSEKPAASVPPPKKQGKGMLKSM-FKRKSSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 44.3 bits (103),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  369  PA*XPWEGPFLXATCXRKKDAMEGKRXS  286
            P   PW+GPFL A+C  KKDAMEGKR S
Sbjct  392  PKLRPWDGPFLCASCQEKKDAMEGKRSS  419



>ref|XP_006393585.1| hypothetical protein EUTSA_v10011502mg [Eutrema salsugineum]
 dbj|BAJ34367.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30871.1| hypothetical protein EUTSA_v10011502mg [Eutrema salsugineum]
Length=428

 Score = 80.1 bits (196),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPA--LPPTPIKKQSLFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA  LPP   + + +  S+ F RKS +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPLEKPAASLPPPKKQGKGMLKSM-FKRKSSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>gb|EYU30003.1| hypothetical protein MIMGU_mgv1a006840mg [Erythranthe guttata]
 gb|EYU30004.1| hypothetical protein MIMGU_mgv1a006840mg [Erythranthe guttata]
Length=429

 Score = 82.4 bits (202),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQ-SLFSSLIFGR---KSHNFRSNKLFAVGVVEELFEEGSAM  497
            VVDIIP +     P+P  K+ +   +L+F +   KS    + K+  VG+VE+LFEEGSAM
Sbjct  295  VVDIIPPNNNTPHPSPPPKRFTKLQALLFRKLSSKSSAKLAKKVSDVGIVEQLFEEGSAM  354

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            LAERLG D     + G+F CAVCQ D  P+EG+ V++G  F
Sbjct  355  LAERLGNDDSSGQNCGVFVCAVCQVDLSPNEGISVHAGSIF  395


 Score = 40.0 bits (92),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KK+AMEGKR S   V+
Sbjct  394  IFSMSSKPWQGPFLCGDCLNKKEAMEGKRPSGVKVV  429



>ref|XP_006307584.1| hypothetical protein CARUB_v10009209mg [Capsella rubella]
 gb|EOA40482.1| hypothetical protein CARUB_v10009209mg [Capsella rubella]
Length=428

 Score = 79.0 bits (193),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RKS +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPLEKPAASVPPPKKQGKGMLKSM-FKRKSSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>ref|XP_006307585.1| hypothetical protein CARUB_v10009209mg [Capsella rubella]
 gb|EOA40483.1| hypothetical protein CARUB_v10009209mg [Capsella rubella]
Length=423

 Score = 79.0 bits (193),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RKS +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPLEKPAASVPPPKKQGKGMLKSM-FKRKSSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>emb|CDY17018.1| BnaA08g03820D [Brassica napus]
Length=428

 Score = 78.6 bits (192),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RKS +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPSEKPAASVPPPKKQGKGMLKSM-FKRKSSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 42.7 bits (99),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -3

Query  369  PA*XPWEGPFLXATCXRKKDAMEGKR  292
            P   PW+GPFL A+C  KKDAMEGKR
Sbjct  392  PKLRPWDGPFLCASCQEKKDAMEGKR  417



>ref|XP_009107427.1| PREDICTED: probable protein phosphatase 2C 12 [Brassica rapa]
Length=428

 Score = 78.6 bits (192),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RKS +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPSEKPAASVPPPKKQGKGMLKSM-FKRKSSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 42.7 bits (99),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -3

Query  369  PA*XPWEGPFLXATCXRKKDAMEGKR  292
            P   PW+GPFL A+C  KKDAMEGKR
Sbjct  392  PKLRPWDGPFLCASCQEKKDAMEGKR  417



>ref|XP_010500262.1| PREDICTED: probable protein phosphatase 2C 12 [Camelina sativa]
Length=428

 Score = 78.6 bits (192),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RK+ +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPLEKPAASVPPPKKQGKGMLKSM-FKRKTSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>ref|NP_564504.1| putative protein phosphatase 2C 12 [Arabidopsis thaliana]
 sp|Q9FX08.1|P2C12_ARATH RecName: Full=Probable protein phosphatase 2C 12; Short=AtPP2C12 
[Arabidopsis thaliana]
 gb|AAG11427.1|AC015449_9 Unknown protein [Arabidopsis thaliana]
 gb|AAN12997.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32161.1| putative protein phosphatase 2C 12 [Arabidopsis thaliana]
Length=428

 Score = 78.2 bits (191),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RK+ +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPLEKPAASVPPPKKQGKGMLKSM-FKRKTSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>dbj|BAK06878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=433

 Score = 85.5 bits (210),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNF-----RSNKLFAVGVVEELFEEG  506
            VVDIIP D  + PP  +P + Q+   SL+FGR+SH+         K  + G VEELFEEG
Sbjct  294  VVDIIPSDHCSTPPPSSPKQNQNKLRSLLFGRRSHSSVGKLGNKQKSASFGFVEELFEEG  353

Query  505  SAMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            SAML ERLG++    +    FRCA+CQ DQ P E L  ++G
Sbjct  354  SAMLEERLGRNSLSKAILPPFRCAICQVDQVPFEDLITDNG  394


 Score = 35.8 bits (81),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            P  GP L + C +KKDAMEGKR SR
Sbjct  404  PSSGPCLCSVCRKKKDAMEGKRSSR  428



>ref|XP_002894042.1| hypothetical protein ARALYDRAFT_473885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70301.1| hypothetical protein ARALYDRAFT_473885 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score = 78.2 bits (191),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RK+ +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPLEKPAASVPPPKKQGKGMLKSM-FKRKTSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>gb|AAK92805.1| unknown protein [Arabidopsis thaliana]
Length=428

 Score = 78.2 bits (191),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RK+ +  SN  K +A   VVEELFEEGSA
Sbjct  290  VVDILPLEKPAASVPPPKKQGKGMLKSM-FKRKTSDSSSNIEKEYAEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>ref|XP_004958778.1| PREDICTED: probable protein phosphatase 2C 33-like [Setaria italica]
Length=430

 Score = 82.4 bits (202),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP-TPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P  +P K Q+   SL F R+SH+       K  ++G VEELFEEGSAM
Sbjct  295  VVDIIPSDHLTSPQLSPKKNQNKLKSL-FRRRSHSSVGKLGGKSASIGSVEELFEEGSAM  353

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            L ERLG++    ++   FRCA+CQ DQ P EGL  ++G  +
Sbjct  354  LEERLGRNLSLKAASPPFRCAICQVDQEPFEGLMTDNGDGY  394


 Score = 38.5 bits (88),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP L   C +KKDAMEGKR SR
Sbjct  401  PWGGPHLCLDCRKKKDAMEGKRSSR  425



>gb|EPS73050.1| hypothetical protein M569_01706, partial [Genlisea aurea]
Length=436

 Score = 79.0 bits (193),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = -2

Query  664  VVDIIPYD---RPALPPTPIKKQSLFSSLIFG----RKSHNFRSNKLFAVGVVEELFEEG  506
            VVDI+P D   +   PP P+KK S   S   G    R S N  S KL AV  VEELFEEG
Sbjct  298  VVDIVPPDNAEQSPPPPPPLKKYSKLKSFFMGKRFCRASTNRSSKKLSAVSTVEELFEEG  357

Query  505  SAMLAERLGK-DFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            SAMLAERLG    P   +  +F CA+CQ D  P+EG+ V++G  F
Sbjct  358  SAMLAERLGHGGGPSGETNSLFVCAICQTDLAPNEGISVHAGSIF  402


 Score = 42.0 bits (97),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL A C  KKDAMEGKR S   ++
Sbjct  401  IFSMSSKPWQGPFLCADCRDKKDAMEGKRPSGVKIV  436



>ref|XP_006658990.1| PREDICTED: probable protein phosphatase 2C 33-like [Oryza brachyantha]
Length=404

 Score = 82.0 bits (201),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSA  500
            VVDIIP D     P  +P + QS F SL+FGR+SH+       K  + G VEELFEEGSA
Sbjct  267  VVDIIPSDYRLTSPQLSPKRNQSKFKSLLFGRRSHSSIGKLGGKSASFGSVEELFEEGSA  326

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            ML ERLG++    ++    RCA+CQ DQ   E L   +G  +
Sbjct  327  MLEERLGRNLSLKATSPSSRCAICQVDQETFESLITENGGSY  368


 Score = 38.5 bits (88),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP+L   C +KKDAMEGKR S 
Sbjct  375  PWGGPYLCLECRKKKDAMEGKRSSH  399



>emb|CDY17078.1| BnaC06g00110D [Brassica napus]
Length=429

 Score = 75.9 bits (185),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPA--LPPTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            VVDI+P ++PA  LPP   + + +  S+ F RKS    SN   +      VEELFEEGSA
Sbjct  291  VVDILPSEKPAASLPPPKKQGKGIIKSM-FKRKSSGSSSNTEKEYLEPDEVEELFEEGSA  349

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  388


 Score = 44.3 bits (103),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  369  PA*XPWEGPFLXATCXRKKDAMEGKRXS  286
            P   PW+GPFL A+C  KKDAMEGKR S
Sbjct  393  PKLRPWDGPFLCASCQEKKDAMEGKRSS  420



>gb|EMT17740.1| Putative protein phosphatase 2C 33 [Aegilops tauschii]
Length=451

 Score = 82.4 bits (202),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            VVDIIP D     P  +P + Q+   SL+F R+SH+       K  ++G VEELFEEGSA
Sbjct  314  VVDIIPSDHHLTSPQLSPKRNQNKLKSLLFRRRSHSSVGKVGGKSASIGSVEELFEEGSA  373

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML ERLG++    ++    RCA+CQ DQ P EGL   +G
Sbjct  374  MLEERLGRNLSLKAASPPSRCAICQVDQEPFEGLMEENG  412


 Score = 37.4 bits (85),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW GP+L   C +KKDAMEGKR S
Sbjct  422  PWGGPYLCLECRKKKDAMEGKRPS  445



>ref|XP_009118925.1| PREDICTED: probable protein phosphatase 2C 12 [Brassica rapa]
 ref|XP_009118926.1| PREDICTED: probable protein phosphatase 2C 12 [Brassica rapa]
Length=428

 Score = 75.1 bits (183),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (61%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RKS    SN   +      VEELFEEGSA
Sbjct  290  VVDILPSEKPAASVPPPKKQGKGIIKSM-FKRKSSGSSSNIEKEYLEPDEVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 44.3 bits (103),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  369  PA*XPWEGPFLXATCXRKKDAMEGKRXS  286
            P   PW+GPFL A+C  KKDAMEGKR S
Sbjct  392  PKLRPWDGPFLCASCQEKKDAMEGKRSS  419



>emb|CDY06741.1| BnaA10g05200D [Brassica napus]
Length=428

 Score = 75.1 bits (183),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (61%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RKS    SN   +      VEELFEEGSA
Sbjct  290  VVDILPSEKPAASVPPPKKQGKGIIKSM-FKRKSSGSSSNIEKEYLEPDEVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 44.3 bits (103),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQEKKDAMEGKRSS  419



>ref|XP_010532299.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Tarenaya 
hassleriana]
Length=440

 Score = 77.0 bits (188),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 63/108 (58%), Gaps = 6/108 (6%)
 Frame = -2

Query  664  VVDIIP-YDRPALPPTPIKKQSLFSSLIF--GRKSHNFRSNKLFAVGVVEELFEEGSAML  494
            VVDIIP  +   LP  P K  + F   +F     S N  S KL AVG VEELFEEGSAML
Sbjct  304  VVDIIPPNNAEELPSPPKKHNNFFRXXLFRKKSSSSNKLSEKLSAVGNVEELFEEGSAML  363

Query  493  AERLGKDFPXDSSF---GIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG     + S    G+F CA+CQ D  PSEG+ V++G  F   +K
Sbjct  364  AERLGSGNGEEVSTKTKGMFTCAICQVDLAPSEGISVHAGSIFSTSLK  411


 Score = 42.0 bits (97),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F  +  PW+GPFL   C  KKDAMEGKR S   V+
Sbjct  405  IFSTSLKPWQGPFLCGDCRNKKDAMEGKRPSGVKVL  440



>ref|XP_010922151.1| PREDICTED: probable protein phosphatase 2C 3 [Elaeis guineensis]
 ref|XP_010922158.1| PREDICTED: probable protein phosphatase 2C 3 [Elaeis guineensis]
Length=432

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAML  494
            VVDIIP D    PP+P KK + F SLIF ++S +  S    KL AVG+VEELFEEGSAML
Sbjct  298  VVDIIPPDHSVPPPSPPKKMNKFKSLIFRKRSKDSASKLAKKLSAVGIVEELFEEGSAML  357

Query  493  AERLGKDFP-XDSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            AERLG D     ++ G+F CA+CQAD  PSEG+ V++G  F    K
Sbjct  358  AERLGNDSSGGQTTSGLFTCAICQADLAPSEGISVHAGSLFSTSSK  403



>ref|XP_010479140.1| PREDICTED: probable protein phosphatase 2C 12 [Camelina sativa]
 ref|XP_010479141.1| PREDICTED: probable protein phosphatase 2C 12 [Camelina sativa]
Length=428

 Score = 75.9 bits (185),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RK+ +  SN  K +A    VEELFEEGSA
Sbjct  290  VVDILPLEKPAASVPPPKKQGKGMLKSM-FKRKTSDSSSNIEKEYAEPDEVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>ref|XP_010461537.1| PREDICTED: probable protein phosphatase 2C 12 [Camelina sativa]
Length=428

 Score = 75.9 bits (185),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++PA    P KKQ   +  S+ F RK+ +  SN  K +A    VEELFEEGSA
Sbjct  290  VVDILPLEKPAASVPPPKKQGKGMLKSM-FKRKTSDSSSNIEKEYAEPDEVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 43.1 bits (100),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL A+C  KKDAMEGKR S
Sbjct  396  PWDGPFLCASCQDKKDAMEGKRSS  419



>ref|XP_010519103.1| PREDICTED: probable protein phosphatase 2C 12 [Tarenaya hassleriana]
Length=428

 Score = 79.0 bits (193),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALP-PTPIKKQSLFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSAM  497
            V+DI+P ++PA P P P K+       +F RK+ +  SN  K +A   VVEELFEEGSAM
Sbjct  290  VIDILPPEKPAAPVPGPRKQAKGMLKSMFKRKTSDSSSNIEKEYAEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 39.3 bits (90),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL  +C  KK+AMEGKR S
Sbjct  396  PWDGPFLCVSCQEKKEAMEGKRPS  419



>ref|XP_002461259.1| hypothetical protein SORBIDRAFT_02g043760 [Sorghum bicolor]
 gb|EER97780.1| hypothetical protein SORBIDRAFT_02g043760 [Sorghum bicolor]
Length=429

 Score = 79.3 bits (194),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 61/101 (60%), Gaps = 5/101 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP-TPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P  +P K Q+   SL F R+SH+       K  ++G VEELFEEGSAM
Sbjct  294  VVDIIPSDHLTSPQLSPKKNQNKLKSL-FRRRSHSSVGKLGGKSASIGSVEELFEEGSAM  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            L ERLG++    ++   FRCA+CQ DQ P E L  ++G  +
Sbjct  353  LEERLGRNLSLKAASPPFRCAICQVDQEPFEDLMTDNGGGY  393


 Score = 38.5 bits (88),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP L   C +KKDAMEGKR SR
Sbjct  400  PWGGPHLCLDCRKKKDAMEGKRSSR  424



>gb|KJB58458.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=428

 Score = 74.3 bits (181),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNK----LFAVGVVEELFEEGSAM  497
            VVDI+P ++P+ P  P KK          RK H+  S++         VVEELFEEGSAM
Sbjct  290  VVDILPLEKPSAPLPPPKKAVKGKLKAMFRKKHSEASSQSDKEYMEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ER    +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERFATKYPLCNMFKLFTCAVCQLEMKPGEGISIHAG  387


 Score = 42.7 bits (99),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PW+GPFL +TC  KK+AMEGKR S   V+
Sbjct  396  PWDGPFLCSTCQEKKEAMEGKRPSGNMVV  424



>gb|KDO38779.1| hypothetical protein CISIN_1g033174mg [Citrus sinensis]
Length=125

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = -2

Query  628  PPTPIKKQSLFSSLIFGRKS---HNFRSNKLFAVGVVEELFEEGSAMLAERLG-KDFPXD  461
            P  P KKQ+   +L+F +KS    N  S KL AVG+VEELFEEGSAMLAERLG ++    
Sbjct  3    PQPPPKKQNKLRALLFRKKSLDSANKLSKKLSAVGIVEELFEEGSAMLAERLGNEENVVQ  62

Query  460  SSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  63   STSGLFTCAVCQIDLAPSEGISVHAGSIFSTSSK  96



>dbj|BAJ94997.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=433

 Score = 79.3 bits (194),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP--TPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            VVDIIP D     P  +P + Q+   SL+F R+SH+       K  ++G VEEL EEGSA
Sbjct  296  VVDIIPSDHRLTSPQLSPKRNQNKLKSLLFRRRSHSSVGKFGGKSASIGSVEELLEEGSA  355

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML ERLG++    ++    RCA+CQ DQ P EGL   +G
Sbjct  356  MLEERLGRNLSLKAASPPSRCAICQVDQEPFEGLMEENG  394


 Score = 37.4 bits (85),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW GP+L   C +KKDAMEGKR S
Sbjct  404  PWGGPYLCLECRKKKDAMEGKRPS  427



>gb|KJB58459.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=460

 Score = 74.3 bits (181),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNK----LFAVGVVEELFEEGSAM  497
            VVDI+P ++P+ P  P KK          RK H+  S++         VVEELFEEGSAM
Sbjct  290  VVDILPLEKPSAPLPPPKKAVKGKLKAMFRKKHSEASSQSDKEYMEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ER    +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERFATKYPLCNMFKLFTCAVCQLEMKPGEGISIHAG  387


 Score = 41.2 bits (95),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL +TC  KK+AMEGKR S
Sbjct  396  PWDGPFLCSTCQEKKEAMEGKRPS  419



>gb|KJB58457.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=428

 Score = 74.3 bits (181),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNK----LFAVGVVEELFEEGSAM  497
            VVDI+P ++P+ P  P KK          RK H+  S++         VVEELFEEGSAM
Sbjct  290  VVDILPLEKPSAPLPPPKKAVKGKLKAMFRKKHSEASSQSDKEYMEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ER    +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERFATKYPLCNMFKLFTCAVCQLEMKPGEGISIHAG  387


 Score = 41.2 bits (95),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL +TC  KK+AMEGKR S
Sbjct  396  PWDGPFLCSTCQEKKEAMEGKRPS  419



>gb|KHG12192.1| hypothetical protein F383_19798 [Gossypium arboreum]
Length=428

 Score = 74.3 bits (181),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNK----LFAVGVVEELFEEGSAM  497
            VVDI+P ++P+ P  P KK          RK H+  S++         VVEELFEEGSAM
Sbjct  290  VVDILPLEKPSAPLPPPKKAVKGKLKAMFRKKHSEASSQSDKEYMEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ER    +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERFATKYPLCNMFKLFTCAVCQLEMKPGEGISIHAG  387


 Score = 41.2 bits (95),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL +TC  KK+AMEGKR S
Sbjct  396  PWDGPFLCSTCQEKKEAMEGKRPS  419



>gb|ACF85382.1| unknown [Zea mays]
 tpg|DAA64231.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
Length=337

 Score = 77.0 bits (188),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 59/101 (58%), Gaps = 5/101 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP-TPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P  +P K  +   SL F R+SH+       K  ++G VEELFEEGSAM
Sbjct  202  VVDIIPSDHLTSPQLSPKKNHNKLKSL-FRRRSHSSVGKLGGKSASIGSVEELFEEGSAM  260

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            L ERLG++    +    FRCA+CQ DQ P E L  ++G  +
Sbjct  261  LEERLGRNLSLKAVSAPFRCAICQVDQEPFEDLMRDNGGGY  301


 Score = 38.1 bits (87),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW GP+L   C +KKDAMEGKR S
Sbjct  308  PWGGPYLCLDCRKKKDAMEGKRSS  331



>gb|KHG12193.1| hypothetical protein F383_19798 [Gossypium arboreum]
Length=374

 Score = 74.3 bits (181),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNFRSNK----LFAVGVVEELFEEGSAM  497
            VVDI+P ++P+ P  P KK          RK H+  S++         VVEELFEEGSAM
Sbjct  236  VVDILPLEKPSAPLPPPKKAVKGKLKAMFRKKHSEASSQSDKEYMEPDVVEELFEEGSAM  295

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ER    +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  296  LSERFATKYPLCNMFKLFTCAVCQLEMKPGEGISIHAG  333


 Score = 40.8 bits (94),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL +TC  KK+AMEGKR S
Sbjct  342  PWDGPFLCSTCQEKKEAMEGKRPS  365



>ref|NP_001140347.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|ACF83634.1| unknown [Zea mays]
 gb|ACN31638.1| unknown [Zea mays]
 gb|ACN31791.1| unknown [Zea mays]
 tpg|DAA41819.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB05717.1| orphans transcription factor, partial [Zea mays]
Length=429

 Score = 77.8 bits (190),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 5/101 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP-TPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P  +P K Q+   SL F R+SH+       K  ++G VEELFEEGSAM
Sbjct  294  VVDIIPSDHLTSPQLSPKKNQNKLKSL-FRRRSHSSVRKLGGKSASIGSVEELFEEGSAM  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            L ERLG++    ++   FRCA+CQ DQ P + L  ++G  +
Sbjct  353  LEERLGRNLSLKAASPPFRCAICQVDQEPFQDLMADNGGGY  393


 Score = 37.0 bits (84),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GP L   C +KKDAMEGKR SR
Sbjct  400  PWGGPCLCLDCRKKKDAMEGKRCSR  424



>ref|NP_001141091.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|ACF78579.1| unknown [Zea mays]
 gb|ACG37352.1| Ca2+/calmodulin-dependent protein kinase phosphatase [Zea mays]
 tpg|DAA64230.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB05716.1| orphans transcription factor, partial [Zea mays]
Length=429

 Score = 76.6 bits (187),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 59/101 (58%), Gaps = 5/101 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPP-TPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAM  497
            VVDIIP D    P  +P K  +   SL F R+SH+       K  ++G VEELFEEGSAM
Sbjct  294  VVDIIPSDHLTSPQLSPKKNHNKLKSL-FRRRSHSSVGKLGGKSASIGSVEELFEEGSAM  352

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSGPFF  374
            L ERLG++    +    FRCA+CQ DQ P E L  ++G  +
Sbjct  353  LEERLGRNLSLKAVSAPFRCAICQVDQEPFEDLMRDNGGGY  393


 Score = 38.1 bits (87),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW GP+L   C +KKDAMEGKR S
Sbjct  400  PWGGPYLCLDCRKKKDAMEGKRSS  423



>ref|XP_010539072.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Tarenaya 
hassleriana]
Length=425

 Score = 75.5 bits (184),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 60/98 (61%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALP-PTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAM  497
            VVDI+P ++P  P P P K+       +F RK+ +  SN   +     VVEELFEEGSAM
Sbjct  290  VVDILPPEKPVAPLPAPKKQGKGMLKSMFKRKTSDSCSNIDKEYEEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 38.9 bits (89),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL ++C  KK+AMEGKR
Sbjct  396  PWDGPFLCSSCQEKKEAMEGKR  417



>ref|XP_010539071.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Tarenaya 
hassleriana]
Length=454

 Score = 75.5 bits (184),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 60/98 (61%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALP-PTPIKKQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAM  497
            VVDI+P ++P  P P P K+       +F RK+ +  SN   +     VVEELFEEGSAM
Sbjct  290  VVDILPPEKPVAPLPAPKKQGKGMLKSMFKRKTSDSCSNIDKEYEEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 38.9 bits (89),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL ++C  KK+AMEGKR
Sbjct  396  PWDGPFLCSSCQEKKEAMEGKR  417



>ref|XP_009145043.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Brassica 
rapa]
Length=409

 Score = 72.0 bits (175),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++ A    P KKQ   +  S+ F RK  +  SN  K +A   +VEELFEEGSA
Sbjct  274  VVDILPSEKLAASVPPPKKQGKGMLKSM-FKRKGSDSSSNIEKEYAEPDLVEELFEEGSA  332

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  333  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  371


 Score = 42.0 bits (97),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL A+C  KKDAMEGKR
Sbjct  380  PWDGPFLCASCQEKKDAMEGKR  401



>ref|XP_008797258.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Phoenix 
dactylifera]
Length=433

 Score = 70.5 bits (171),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDR--PALPPTPIKKQSLFSSLIFGRKS--HNFRSNKLFAV-GVVEELFEEGSA  500
            VVDI+P ++  PA+P    +   +F ++ F R+S      S++ ++   VVEE+FEEGSA
Sbjct  291  VVDILPPEKVTPAVPSQKRQGMGVFKNM-FRRRSCESTSHSDRGYSQPDVVEEIFEEGSA  349

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            MLA+RL  ++P  + F +F CAVCQ +  P EG+ V++G
Sbjct  350  MLAKRLDAEYPVRNMFKLFICAVCQVEMKPGEGISVHAG  388


 Score = 43.9 bits (102),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
            PW+GPFL  +C +KK+AMEGKR SR  V+
Sbjct  397  PWDGPFLCRSCQKKKEAMEGKRPSREGVL  425



>ref|XP_011030187.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
Length=429

 Score = 74.7 bits (182),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALP-PTPIK-KQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            V+DI+P ++PA P P P K  + +F S+ F RKS    S    +     VVEEL+EEGSA
Sbjct  291  VIDIVPPEKPAAPLPQPKKLGRGVFKSM-FRRKSSESSSQIDKEYLEPDVVEELYEEGSA  349

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ V++G
Sbjct  350  MLSERLDTKYPLCNMFKLFMCAVCQVEIKPDEGISVHAG  388


 Score = 38.9 bits (89),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL  +C  KK+AMEGKR S
Sbjct  397  PWDGPFLCLSCQEKKEAMEGKRPS  420



>gb|ACN31161.1| unknown [Zea mays]
Length=250

 Score = 71.2 bits (173),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = -2

Query  625  PTPIKKQSLFSSLIFGRKSHNFRSNKLF----AVGVVEELFEEGSAMLAERLGKDFPXDS  458
            P P  K     S IF RK     S KL     AVG+VEE+FEEGSAML+ERLG D     
Sbjct  133  PVPYVK---LKSFIF-RKKAKDPSQKLTKQHSAVGIVEEIFEEGSAMLSERLGPDLDGRR  188

Query  457  SFGIFRCAVCQADQPPSEGLFVNSGPFFXA  368
            +  +F CA+CQ D  PSEG+ V++G  F +
Sbjct  189  TSSLFTCAICQLDLEPSEGISVHAGSIFSS  218


 Score = 42.4 bits (98),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -3

Query  378  FFXPA*XPWEGPFLXATCXRKKDAMEGKRXSRPAVI  271
             F     PWEGPFL + C  KKDAMEGKR S   V+
Sbjct  215  IFSSTSRPWEGPFLCSDCREKKDAMEGKRPSGVKVL  250



>emb|CDY43845.1| BnaA05g18570D [Brassica napus]
Length=424

 Score = 72.0 bits (175),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++ A    P KKQ   +  S+ F RK  +  SN  K +A   +VEELFEEGSA
Sbjct  290  VVDILPSEKLAASVPPPKKQGKGMLKSM-FKRKGSDSSSNIEKEYAEPDLVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 41.6 bits (96),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL A+C  KKDAMEGKR
Sbjct  396  PWDGPFLCASCQEKKDAMEGKR  417



>ref|XP_009145042.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Brassica 
rapa]
Length=425

 Score = 72.0 bits (175),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNFRSN--KLFAV-GVVEELFEEGSA  500
            VVDI+P ++ A    P KKQ   +  S+ F RK  +  SN  K +A   +VEELFEEGSA
Sbjct  290  VVDILPSEKLAASVPPPKKQGKGMLKSM-FKRKGSDSSSNIEKEYAEPDLVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  349  MLSERLDTKYPLCNMFKLFMCAVCQVEVKPGEGVSIHAG  387


 Score = 42.0 bits (97),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL A+C  KKDAMEGKR
Sbjct  396  PWDGPFLCASCQEKKDAMEGKR  417



>ref|XP_007017286.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY14511.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=439

 Score = 74.7 bits (182),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKK--QSLFSSLIFGRKSHNFRS--NKLFAVGVVEELFEEGSAM  497
            VVDI+P ++PA+P  P K+  + +F ++   + S +      +     VVEELFEEGSAM
Sbjct  290  VVDILPQEKPAVPLPPPKRPGKGMFKAMFRKKPSESSSQVDKEYMEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERLDTKYPLCNMFKLFMCAVCQLEMKPGEGISIHAG  387


 Score = 38.9 bits (89),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL ++C  KK+AMEGKR
Sbjct  396  PWDGPFLCSSCQEKKEAMEGKR  417



>ref|XP_007017285.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY14510.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=428

 Score = 74.7 bits (182),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKK--QSLFSSLIFGRKSHNFRS--NKLFAVGVVEELFEEGSAM  497
            VVDI+P ++PA+P  P K+  + +F ++   + S +      +     VVEELFEEGSAM
Sbjct  290  VVDILPQEKPAVPLPPPKRPGKGMFKAMFRKKPSESSSQVDKEYMEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  LSERLDTKYPLCNMFKLFMCAVCQLEMKPGEGISIHAG  387


 Score = 38.9 bits (89),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL ++C  KK+AMEGKR
Sbjct  396  PWDGPFLCSSCQEKKEAMEGKR  417



>ref|XP_010275585.1| PREDICTED: probable protein phosphatase 2C 12 [Nelumbo nucifera]
 ref|XP_010275586.1| PREDICTED: probable protein phosphatase 2C 12 [Nelumbo nucifera]
Length=435

 Score = 72.8 bits (177),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = -2

Query  664  VVDIIPYDR-PALPPTPIKKQSLFSSLIFGRKSHNFRSNKLFAVGVVEELFEEGSAMLAE  488
            VVDI+P ++  +LPP   + + +F S+ F RKS    S       +VEE+FEEGSAMLAE
Sbjct  306  VVDILPQEKQTSLPPHKKQGKGVFKSM-FRRKSAE--STSCLEPDIVEEIFEEGSAMLAE  362

Query  487  RLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVN  389
            RL  ++P  + F +F CAVCQ +  P EG+ V+
Sbjct  363  RLDIEYPLCNLFKLFICAVCQLEMKPGEGISVH  395


 Score = 40.8 bits (94),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPA  277
            PW+GPFL  +C  KK+AMEGKR SR +
Sbjct  406  PWDGPFLCESCQAKKEAMEGKRPSRSS  432



>ref|XP_006374959.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ERP52756.1| phosphatase 2C family protein [Populus trichocarpa]
Length=429

 Score = 72.0 bits (175),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALP-PTPIK-KQSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            V+DI+P ++PA   P P K  + +F S+ F RKS    S    +     VVEEL+EEGSA
Sbjct  291  VIDIVPPEKPAASLPQPKKLGRGVFKSM-FRRKSSESSSQIDKEYLEPDVVEELYEEGSA  349

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ V++G
Sbjct  350  MLSERLDTKYPLCNMFKLFMCAVCQVEIKPDEGISVHAG  388


 Score = 39.7 bits (91),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL  +C  KK+AMEGKR S
Sbjct  397  PWDGPFLCLSCQEKKEAMEGKRQS  420



>ref|XP_006448422.1| hypothetical protein CICLE_v10018105mg [Citrus clementina]
 gb|ESR61662.1| hypothetical protein CICLE_v10018105mg [Citrus clementina]
Length=329

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 63/105 (60%), Gaps = 11/105 (10%)
 Frame = -2

Query  661  VDIIPYDRPALPPTPIKKQSLFSSLIFGRKS---HNFRSNKLFAVGVVEELFEEGSAMLA  491
            VDIIP D    P  P KKQ+   +L+F +KS    N  SNKL       +LFEEGSAMLA
Sbjct  231  VDIIPPDNTMQPQPPPKKQNKLRALLFRKKSLDSANKLSNKL-------KLFEEGSAMLA  283

Query  490  ERLGKDFPX-DSSFGIFRCAVCQADQPPSEGLFVNSGPFFXACIK  359
            ERLG + P   S+ G+F CAVCQ D  PSEG+ V++G  F    K
Sbjct  284  ERLGNEEPVVQSTSGLFTCAVCQVDLVPSEGISVHAGSIFSTSSK  328



>ref|XP_002510242.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF52429.1| protein phosphatase, putative [Ricinus communis]
Length=425

 Score = 75.1 bits (183),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALP-PTPIKK-QSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            V+DI P ++PA P P P K+ + +F S+ F RKS    S    +     VVEELFEEGSA
Sbjct  290  VIDISPPEKPAAPLPAPKKQVKGVFKSM-FRRKSSESSSQVDKEYTEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            MLAERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  349  MLAERLDTKYPLCNMFKLFMCAVCQVEMKPEEGISIHVG  387


 Score = 35.8 bits (81),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGK  295
            PW+GPFL ++C  K++AMEGK
Sbjct  396  PWDGPFLCSSCQEKREAMEGK  416



>ref|XP_007222388.1| hypothetical protein PRUPE_ppa006058mg [Prunus persica]
 gb|EMJ23587.1| hypothetical protein PRUPE_ppa006058mg [Prunus persica]
Length=429

 Score = 71.6 bits (174),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 63/100 (63%), Gaps = 8/100 (8%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS---LFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGS  503
            V+DI+P+++P LP +  KKQ    LF S+ F +K  +  SN   +     +VEELFEEGS
Sbjct  291  VIDILPHEKP-LPLSQPKKQGKGVLFKSM-FRKKHCDSSSNVEKEYIEPDMVEELFEEGS  348

Query  502  AMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            A L+ERL   +P  + F +F CAVCQ +  P EG+ ++SG
Sbjct  349  ASLSERLDTKYPLCNMFKLFMCAVCQVEIKPGEGISIHSG  388


 Score = 38.9 bits (89),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL ++C  K++AMEGKR S
Sbjct  397  PWDGPFLCSSCQEKREAMEGKRPS  420



>ref|XP_008220215.1| PREDICTED: probable protein phosphatase 2C 12 [Prunus mume]
Length=429

 Score = 71.6 bits (174),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 63/100 (63%), Gaps = 8/100 (8%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS---LFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGS  503
            V+DI+P+++P LP +  KKQ    LF S+ F +K  +  SN   +     +VEELFEEGS
Sbjct  291  VIDILPHEKP-LPLSQPKKQGKGVLFKSM-FRKKPCDSSSNVEKEYIEPDMVEELFEEGS  348

Query  502  AMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            A L+ERL   +P  + F +F CAVCQ +  P EG+ ++SG
Sbjct  349  ATLSERLDSKYPLCNMFKLFMCAVCQVEIKPGEGISIHSG  388


 Score = 38.9 bits (89),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL ++C  K++AMEGKR S
Sbjct  397  PWDGPFLCSSCQEKREAMEGKRPS  420



>ref|XP_010916634.1| PREDICTED: probable protein phosphatase 2C 12 [Elaeis guineensis]
Length=422

 Score = 69.7 bits (169),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 8/100 (8%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKK------QSLFSSLIFGRKSHNFRSNKLFAVGVVEELFEEGS  503
            VVDI+P ++ A P  P KK      +SLF    F   SH+   +  F   V+EE+FE+GS
Sbjct  288  VVDILPPEKLAPPVPPPKKSGKGMFKSLFRKQSFESSSHSGTGH--FEPDVLEEMFEDGS  345

Query  502  AMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            A+LA+RL  ++P  + F +F CAVCQ +  P EG+ +++G
Sbjct  346  AVLAQRLNMEYPICNMFKLFMCAVCQLEMKPGEGISLHAG  385


 Score = 39.7 bits (91),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GPFL  TC  K++AMEGKR SR
Sbjct  394  PWHGPFLCRTCQAKREAMEGKRPSR  418



>ref|XP_011654105.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
sativus]
Length=439

 Score = 70.9 bits (172),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRP--ALPPTPIKKQSLFSSLIFGRKSHNFR--SNKLFAVGVVEELFEEGSAM  497
            V+D++P ++P  ALPP   + + +F S+   R S +      +     VVEELFEEGSAM
Sbjct  290  VIDVLPREKPSTALPPPKKQVKGMFKSMFRKRSSESSSHFEREYNEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CA+CQ +  P EG+ + +G
Sbjct  350  LSERLDSKYPVCNMFKLFVCAICQIEIQPREGVSIYAG  387


 Score = 38.1 bits (87),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXS  286
            W+GPFL ++C  KK+AMEGKR S
Sbjct  397  WDGPFLCSSCTEKKEAMEGKRSS  419



>ref|XP_004141247.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Cucumis 
sativus]
 gb|KGN55182.1| hypothetical protein Csa_4G639210 [Cucumis sativus]
Length=428

 Score = 70.9 bits (172),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRP--ALPPTPIKKQSLFSSLIFGRKSHNFR--SNKLFAVGVVEELFEEGSAM  497
            V+D++P ++P  ALPP   + + +F S+   R S +      +     VVEELFEEGSAM
Sbjct  290  VIDVLPREKPSTALPPPKKQVKGMFKSMFRKRSSESSSHFEREYNEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CA+CQ +  P EG+ + +G
Sbjct  350  LSERLDSKYPVCNMFKLFVCAICQIEIQPREGVSIYAG  387


 Score = 38.1 bits (87),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXS  286
            W+GPFL ++C  KK+AMEGKR S
Sbjct  397  WDGPFLCSSCTEKKEAMEGKRSS  419



>ref|XP_010674112.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=161

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP   P LPP P KK    S LIFG+KSHN   +S+KL AVG VEELFEEGSAML 
Sbjct  65   VVDIIPSVHPVLPPLPQKKHHGLSGLIFGKKSHNLASKSSKLSAVGAVEELFEEGSAMLE  124

Query  490  ER  485
            ER
Sbjct  125  ER  126



>ref|XP_006581239.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Glycine max]
Length=437

 Score = 67.4 bits (163),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 10/101 (10%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSL--IFGRKSH---NFRSNKLFAVGVVEELFEEG  506
            V+DI+P ++P   PT  P +K+ +   L  IF +KS     F   +     VV+EL+EEG
Sbjct  292  VIDILPLEKP---PTSVPTQKKPVKGMLKSIFRKKSSESSTFIEKEYLEPDVVQELYEEG  348

Query  505  SAMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            SAML+ERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  349  SAMLSERLETKYPLCNMFKLFICAVCQVEIKPGEGISIHEG  389


 Score = 40.8 bits (94),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPA  277
            PW+GPFL ++C  KK+AMEGKR S  A
Sbjct  398  PWDGPFLCSSCQEKKEAMEGKRTSDLA  424



>gb|KHN22311.1| Hypothetical protein glysoja_022067 [Glycine soja]
Length=429

 Score = 67.4 bits (163),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 10/101 (10%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSL--IFGRKSH---NFRSNKLFAVGVVEELFEEG  506
            V+DI+P ++P   PT  P +K+ +   L  IF +KS     F   +     VV+EL+EEG
Sbjct  292  VIDILPLEKP---PTSVPTQKKPVKGMLKSIFRKKSSESSTFIEKEYLEPDVVQELYEEG  348

Query  505  SAMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            SAML+ERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  349  SAMLSERLETKYPLCNMFKLFICAVCQVEIKPGEGISIHEG  389


 Score = 40.4 bits (93),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL ++C  KK+AMEGKR S
Sbjct  398  PWDGPFLCSSCQEKKEAMEGKRTS  421



>ref|XP_003528265.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Glycine max]
Length=429

 Score = 67.4 bits (163),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 10/101 (10%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSL--IFGRKSH---NFRSNKLFAVGVVEELFEEG  506
            V+DI+P ++P   PT  P +K+ +   L  IF +KS     F   +     VV+EL+EEG
Sbjct  292  VIDILPLEKP---PTSVPTQKKPVKGMLKSIFRKKSSESSTFIEKEYLEPDVVQELYEEG  348

Query  505  SAMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            SAML+ERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  349  SAMLSERLETKYPLCNMFKLFICAVCQVEIKPGEGISIHEG  389


 Score = 40.4 bits (93),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL ++C  KK+AMEGKR S
Sbjct  398  PWDGPFLCSSCQEKKEAMEGKRTS  421



>ref|XP_006581240.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X3 
[Glycine max]
Length=347

 Score = 67.4 bits (163),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 10/101 (10%)
 Frame = -2

Query  664  VVDIIPYDRPALPPT--PIKKQSLFSSL--IFGRKSH---NFRSNKLFAVGVVEELFEEG  506
            V+DI+P ++P   PT  P +K+ +   L  IF +KS     F   +     VV+EL+EEG
Sbjct  202  VIDILPLEKP---PTSVPTQKKPVKGMLKSIFRKKSSESSTFIEKEYLEPDVVQELYEEG  258

Query  505  SAMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            SAML+ERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  259  SAMLSERLETKYPLCNMFKLFICAVCQVEIKPGEGISIHEG  299


 Score = 40.4 bits (93),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPA  277
            PW+GPFL ++C  KK+AMEGKR S  A
Sbjct  308  PWDGPFLCSSCQEKKEAMEGKRTSDLA  334



>ref|XP_010269263.1| PREDICTED: probable protein phosphatase 2C 12 [Nelumbo nucifera]
Length=386

 Score = 68.9 bits (167),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 62/98 (63%), Gaps = 7/98 (7%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKK-QSLFSSLIFGRKSHNFRSN---KLFAVGVVEELFEEGSAM  497
            VVDI+P ++   PP   K+ + +F S+ F RKS+   S+   +     +VEE++EEGSA+
Sbjct  254  VVDILPQEKN--PPVSKKQGKGVFKSM-FCRKSYESTSDWEKEYLEPDIVEEMYEEGSAL  310

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            LA+RL  ++P  + F +F CAVCQ +  P EG+ V+ G
Sbjct  311  LADRLDVEYPLCNMFRLFMCAVCQVEMKPGEGISVHEG  348


 Score = 38.5 bits (88),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL ++C  KK+AMEGKR
Sbjct  357  PWDGPFLCSSCQAKKEAMEGKR  378



>emb|CDP01349.1| unnamed protein product [Coffea canephora]
Length=429

 Score = 67.4 bits (163),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS--LFSSLIFGRKSHNF-RSNKLFAV-GVVEELFEEGSAM  497
            VVDI P ++P  P  P KKQ   +F S+   + S +   + K F+   VVEELFEEGSA 
Sbjct  290  VVDIQPPEKPNPPLAPPKKQGKGVFKSMFRKKPSESSSHTGKEFSEPDVVEELFEEGSAS  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  350  LSERLDTKYPVCNMFKLFVCAVCQVEIKPGEGISIHVG  387


 Score = 39.7 bits (91),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL ++C  KK+AMEGKR S
Sbjct  396  PWDGPFLCSSCQEKKEAMEGKRPS  419



>ref|XP_008797259.1| PREDICTED: probable protein phosphatase 2C 12 isoform X3 [Phoenix 
dactylifera]
Length=432

 Score = 70.5 bits (171),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDR--PALPPTPIKKQSLFSSLIFGRKS--HNFRSNKLFAV-GVVEELFEEGSA  500
            VVDI+P ++  PA+P    +   +F ++ F R+S      S++ ++   VVEE+FEEGSA
Sbjct  291  VVDILPPEKVTPAVPSQKRQGMGVFKNM-FRRRSCESTSHSDRGYSQPDVVEEIFEEGSA  349

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            MLA+RL  ++P  + F +F CAVCQ +  P EG+ V++G
Sbjct  350  MLAKRLDAEYPVRNMFKLFICAVCQVEMKPGEGISVHAG  388


 Score = 36.6 bits (83),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGK  295
            PW+GPFL  +C +KK+AMEGK
Sbjct  397  PWDGPFLCRSCQKKKEAMEGK  417



>ref|XP_008452534.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452535.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452536.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452537.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
Length=439

 Score = 70.9 bits (172),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRP--ALPPTPIKKQSLFSSLIFGRKSHNFR--SNKLFAVGVVEELFEEGSAM  497
            V+D++P ++P  ALPP   + + +F S+   R S +      +     VVEELFEEGSAM
Sbjct  290  VIDVLPREKPSTALPPPKKQVKGMFKSMFRKRSSESSSHFEREYNEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CA+CQ +  P EG+ + +G
Sbjct  350  LSERLDSKYPVCNMFKLFVCAICQIEIQPREGVSIYAG  387


 Score = 35.4 bits (80),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXS  286
            W+GPFL   C  KK+AMEGKR S
Sbjct  397  WDGPFLCLGCTEKKEAMEGKRPS  419



>ref|XP_009409307.1| PREDICTED: probable protein phosphatase 2C 12 [Musa acuminata 
subsp. malaccensis]
Length=432

 Score = 66.6 bits (161),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 9/100 (9%)
 Frame = -2

Query  664  VVDIIPYDR--PALPPTPIKKQSLFSSLIFGRKS-----HNFRSNKLFAVGVVEELFEEG  506
            VVD++P ++  P +PP   +   +F ++ F RKS     H+ R + L    +VEE+FEEG
Sbjct  289  VVDMLPPEKLTPTVPPPKKQGMGVFKNM-FRRKSSESSLHSDR-DCLPESDLVEEIFEEG  346

Query  505  SAMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNS  386
            SA LA+RL  D+P  + F +F CAVCQ +  P EG+ V++
Sbjct  347  SASLAQRLEADYPIRNMFKLFVCAVCQVEMKPGEGISVHA  386


 Score = 39.7 bits (91),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSRPAV  274
            PW+GPFL  +C  KK+AMEGK+ S  ++
Sbjct  397  PWDGPFLCQSCQEKKEAMEGKKTSTDSI  424



>ref|XP_008452538.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Cucumis 
melo]
Length=428

 Score = 70.9 bits (172),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRP--ALPPTPIKKQSLFSSLIFGRKSHNFR--SNKLFAVGVVEELFEEGSAM  497
            V+D++P ++P  ALPP   + + +F S+   R S +      +     VVEELFEEGSAM
Sbjct  290  VIDVLPREKPSTALPPPKKQVKGMFKSMFRKRSSESSSHFEREYNEPDVVEELFEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CA+CQ +  P EG+ + +G
Sbjct  350  LSERLDSKYPVCNMFKLFVCAICQIEIQPREGVSIYAG  387


 Score = 35.4 bits (80),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXS  286
            W+GPFL   C  KK+AMEGKR S
Sbjct  397  WDGPFLCLGCTEKKEAMEGKRPS  419



>ref|XP_012071676.1| PREDICTED: probable protein phosphatase 2C 12 [Jatropha curcas]
 ref|XP_012071677.1| PREDICTED: probable protein phosphatase 2C 12 [Jatropha curcas]
 gb|KDP38368.1| hypothetical protein JCGZ_04293 [Jatropha curcas]
Length=430

 Score = 66.2 bits (160),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSL--IFGRKSHNFRSN---KLFAVGVVEELFEEGSA  500
            V+D++P ++P  P     ++ +   L  +F RKS    S+   +     VVEELFEEGSA
Sbjct  290  VIDLLPQEKPPPPAPAPTRRQMKGMLKSMFRRKSSESSSHVGKEHVEPDVVEELFEEGSA  349

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ +++G
Sbjct  350  MLSERLDTKYPLCNMFKLFMCAVCQMEMKPEEGISIHAG  388


 Score = 39.7 bits (91),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL ++C  KK+AMEGKR S
Sbjct  397  PWDGPFLCSSCQEKKEAMEGKRPS  420



>ref|XP_004499068.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Cicer arietinum]
Length=439

 Score = 67.0 bits (162),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (60%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSL--IFGRKSH---NFRSNKLFAVGVVEELFEEGSA  500
            VVDI+P ++P   P P +K+ +   L  +F +KS    ++   +     VV EL+EEGSA
Sbjct  290  VVDILPQEKPP-APVPHQKKPVKGMLKAMFRKKSSESSSYIDKEYLEPDVVVELYEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ V+ G
Sbjct  349  MLSERLDTKYPLCNMFKLFICAVCQVEIKPGEGISVHEG  387


 Score = 38.9 bits (89),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL ++C  KK+AMEGKR
Sbjct  396  PWDGPFLCSSCQEKKEAMEGKR  417



>ref|XP_010674111.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=181

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF--RSNKLFAVGVVEELFEEGSAMLA  491
            VVDIIP   P LPP P KK    S LIFG+KSHN   +S+KL AVG VEELFEEGSAML 
Sbjct  65   VVDIIPSVHPVLPPLPQKKHHGLSGLIFGKKSHNLASKSSKLSAVGAVEELFEEGSAMLE  124

Query  490  ERL  482
            E +
Sbjct  125  ESV  127



>ref|XP_004292819.1| PREDICTED: probable protein phosphatase 2C 12 [Fragaria vesca 
subsp. vesca]
Length=432

 Score = 67.4 bits (163),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQS---LFSSLIFGRK---SHNFRSNKLFAVGVVEELFEEGS  503
            V+DI+P ++PA P    K+Q    +F S+ F +K   S +    +      VEE++EEGS
Sbjct  292  VIDILPQEKPAAPLAQPKRQGGKGVFKSM-FKKKPCESSSSVEQEYIEPDTVEEIYEEGS  350

Query  502  AMLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            A L+ERL   +P  + F +F CAVCQ +  P EG+ ++SG
Sbjct  351  ASLSERLDSKYPLCNMFKLFMCAVCQVEIKPGEGISIHSG  390


 Score = 38.5 bits (88),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL  +C  K++AMEGKR S
Sbjct  400  PWDGPFLCTSCQEKREAMEGKRPS  423



>ref|XP_004499069.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Cicer arietinum]
Length=428

 Score = 66.6 bits (161),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (60%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSL--IFGRKSH---NFRSNKLFAVGVVEELFEEGSA  500
            VVDI+P ++P   P P +K+ +   L  +F +KS    ++   +     VV EL+EEGSA
Sbjct  290  VVDILPQEKPP-APVPHQKKPVKGMLKAMFRKKSSESSSYIDKEYLEPDVVVELYEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            ML+ERL   +P  + F +F CAVCQ +  P EG+ V+ G
Sbjct  349  MLSERLDTKYPLCNMFKLFICAVCQVEIKPGEGISVHEG  387


 Score = 38.9 bits (89),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL ++C  KK+AMEGKR
Sbjct  396  PWDGPFLCSSCQEKKEAMEGKR  417



>ref|XP_003550341.1| PREDICTED: probable protein phosphatase 2C 12-like [Glycine max]
 gb|KHN12774.1| Hypothetical protein glysoja_008737 [Glycine soja]
Length=428

 Score = 68.9 bits (167),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRP--ALPPTPIKKQSLFSSLIFGR--KSHNFRSNKLFAVGVVEELFEEGSAM  497
            VVDI+P ++P  + P T    + +  S+   +  +S ++   +     VVEEL+EEGSAM
Sbjct  290  VVDILPQEKPPVSAPQTKRPVKGMLKSMFRKKSSESSSYIDKEYMEPDVVEELYEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  350  LSERLDTKYPVCNMFKLFMCAVCQVEIKPGEGISIHEG  387


 Score = 37.0 bits (84),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGK  295
            PW+GPFL ++C  KK+AMEGK
Sbjct  396  PWDGPFLCSSCQEKKEAMEGK  416



>ref|XP_010088393.1| putative protein phosphatase 2C 5 [Morus notabilis]
 gb|EXC35964.1| putative protein phosphatase 2C 5 [Morus notabilis]
Length=368

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHN-FRSNKLFAVGVVEELFEEGSAMLAE  488
            VVDIIP D P LPPTP K+Q++ +SL+FG+KS N     KL AVG VEELFEEGSAML E
Sbjct  303  VVDIIPSDLPVLPPTPRKRQNVLASLLFGKKSQNSVNKAKLSAVGAVEELFEEGSAMLDE  362

Query  487  R  485
            R
Sbjct  363  R  363



>ref|XP_006434797.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 ref|XP_006434798.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 gb|ESR48037.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 gb|ESR48038.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
Length=429

 Score = 64.3 bits (155),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = -2

Query  586  IFGRKSHNFRSN---KLFAVGVVEELFEEGSAMLAERLGKDFPXDSSFGIFRCAVCQADQ  416
            +F RKS    SN   +     VVEELFEEGSAML+ERL   +P  + F +F CA+CQ + 
Sbjct  318  MFRRKSPESSSNTDREYVEPDVVEELFEEGSAMLSERLDTKYPLCNMFKLFMCAICQVEM  377

Query  415  PPSEGLFVNSGPFF  374
             P EG+ +++G  +
Sbjct  378  KPEEGISIHAGSTY  391


 Score = 40.8 bits (94),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL  +C  KKDAMEGKR S
Sbjct  397  PWDGPFLCLSCQEKKDAMEGKRPS  420



>gb|KDO84217.1| hypothetical protein CISIN_1g045195mg, partial [Citrus sinensis]
Length=411

 Score = 64.3 bits (155),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = -2

Query  586  IFGRKSHNFRSN---KLFAVGVVEELFEEGSAMLAERLGKDFPXDSSFGIFRCAVCQADQ  416
            +F RKS    SN   +     VVEELFEEGSAML+ERL   +P  + F +F CA+CQ + 
Sbjct  308  MFRRKSPESSSNTDREYVEPDVVEELFEEGSAMLSERLDTKYPLCNMFKLFMCAICQVEM  367

Query  415  PPSEGLFVNSGPFF  374
             P EG+ +++G  +
Sbjct  368  KPEEGISIHAGSTY  381


 Score = 40.8 bits (94),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL  +C  KKDAMEGKR S
Sbjct  387  PWDGPFLCLSCQEKKDAMEGKRPS  410



>ref|XP_006473344.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X3 
[Citrus sinensis]
Length=429

 Score = 64.3 bits (155),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = -2

Query  586  IFGRKSHNFRSN---KLFAVGVVEELFEEGSAMLAERLGKDFPXDSSFGIFRCAVCQADQ  416
            +F RKS    SN   +     VVEELFEEGSAML+ERL   +P  + F +F CA+CQ + 
Sbjct  318  MFRRKSPESSSNTDREYVEPDVVEELFEEGSAMLSERLDTKYPLCNMFKLFMCAICQVEM  377

Query  415  PPSEGLFVNSGPFF  374
             P EG+ +++G  +
Sbjct  378  KPEEGISIHAGSTY  391


 Score = 40.8 bits (94),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL  +C  KKDAMEGKR S
Sbjct  397  PWDGPFLCLSCQEKKDAMEGKRPS  420



>ref|XP_006595966.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Glycine max]
Length=386

 Score = 68.2 bits (165),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKK--QSLFSSLIFGR--KSHNFRSNKLFAVGVVEELFEEGSAM  497
            VVDI+P ++P +     KK  + +  S+   +  +S ++   +     VVEEL+EEGSAM
Sbjct  248  VVDILPQEKPPVSAPQTKKPVKGMLKSMFRKKSSESSSYIDKEYTEPDVVEELYEEGSAM  307

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  308  LSERLDTKYPVCNMFKLFICAVCQVEIKPGEGISIHEG  345


 Score = 37.0 bits (84),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGK  295
            PW+GPFL ++C  KK+AMEGK
Sbjct  354  PWDGPFLCSSCQEKKEAMEGK  374



>ref|XP_006473342.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Citrus sinensis]
 ref|XP_006473343.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Citrus sinensis]
Length=432

 Score = 64.3 bits (155),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = -2

Query  586  IFGRKSHNFRSN---KLFAVGVVEELFEEGSAMLAERLGKDFPXDSSFGIFRCAVCQADQ  416
            +F RKS    SN   +     VVEELFEEGSAML+ERL   +P  + F +F CA+CQ + 
Sbjct  318  MFRRKSPESSSNTDREYVEPDVVEELFEEGSAMLSERLDTKYPLCNMFKLFMCAICQVEM  377

Query  415  PPSEGLFVNSGPFF  374
             P EG+ +++G  +
Sbjct  378  KPEEGISIHAGSTY  391


 Score = 40.8 bits (94),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXS  286
            PW+GPFL  +C  KKDAMEGKR S
Sbjct  397  PWDGPFLCLSCQEKKDAMEGKRPS  420



>ref|XP_003545307.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Glycine max]
 gb|KHN35672.1| Hypothetical protein glysoja_037582 [Glycine soja]
Length=428

 Score = 67.8 bits (164),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKK--QSLFSSLIFGR--KSHNFRSNKLFAVGVVEELFEEGSAM  497
            VVDI+P ++P +     KK  + +  S+   +  +S ++   +     VVEEL+EEGSAM
Sbjct  290  VVDILPQEKPPVSAPQTKKPVKGMLKSMFRKKSSESSSYIDKEYTEPDVVEELYEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ ++ G
Sbjct  350  LSERLDTKYPVCNMFKLFICAVCQVEIKPGEGISIHEG  387


 Score = 37.0 bits (84),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGK  295
            PW+GPFL ++C  KK+AMEGK
Sbjct  396  PWDGPFLCSSCQEKKEAMEGK  416



>ref|XP_008805255.1| PREDICTED: probable protein phosphatase 2C 12 [Phoenix dactylifera]
Length=441

 Score = 65.1 bits (157),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALP-PTPIKKQSLFSSLIFGRKSHNFRSNK---LFAVGVVEELFEEGSAM  497
            VVDI+P ++ A P P P K        +F ++S    S+     F   V+EE+FE+GSA+
Sbjct  307  VVDILPPEKLAPPVPPPKKSGKGMFKFMFCKQSCESSSHSGTGHFESDVLEEMFEDGSAV  366

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            LA+RL  ++P  + F +F CAVCQ +  P EG+ +++G
Sbjct  367  LAQRLNMEYPICNMFKLFMCAVCQLEMKPGEGISLHAG  404


 Score = 39.7 bits (91),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKRXSR  283
            PW GPFL  TC  K++AMEGKR SR
Sbjct  413  PWHGPFLCRTCQAKREAMEGKRPSR  437



>ref|XP_004242956.1| PREDICTED: probable protein phosphatase 2C 12 [Solanum lycopersicum]
Length=429

 Score = 67.0 bits (162),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKK--QSLFSSLIFGRKSHNFRSNKLFAVG---VVEELFEEGSA  500
            VVDI P ++P  P  P KK  + +F S IF +K+    SN         VVEELFEEGSA
Sbjct  290  VVDIQPLEKPNPPQAPPKKSGKKVFKS-IFRKKTSESCSNTERDYDEPDVVEELFEEGSA  348

Query  499  MLAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
             L++RL   +P  + F +F CA+CQ +  P EG+ ++ G
Sbjct  349  SLSDRLDAKYPICNMFKLFTCAICQVEIKPGEGISIHVG  387


 Score = 37.4 bits (85),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  354  WEGPFLXATCXRKKDAMEGKRXS  286
            W+GPFL ++C  KK+AMEGKR S
Sbjct  397  WDGPFLCSSCQEKKEAMEGKRPS  419



>ref|XP_011627378.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Amborella 
trichopoda]
Length=435

 Score = 76.6 bits (187),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSLIFGRKSHNF---RSNKLFAVGVVEELFEEGSAML  494
            VVDIIP D    P  P +K     S IF +KSH      SNK  + GVVEELFEEGSA+L
Sbjct  306  VVDIIP-DHSHPPMVPQRKARNLWSRIFRKKSHGSVSELSNKPSSDGVVEELFEEGSAIL  364

Query  493  AERLGKDFPXDSSFGIFRCAVCQADQPPSEG  401
             ERLG + P  +  G   C VCQ D P SEG
Sbjct  365  VERLGTNMPMSTRSGRLVCVVCQGDIPRSEG  395


 Score = 27.7 bits (60),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = -3

Query  351  EGPFLXATCXRKKDAMEGKR  292
            + PFL   C  KKDAMEGK+
Sbjct  412  DAPFLCNDCMIKKDAMEGKK  431



>gb|AES59470.2| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=428

 Score = 66.6 bits (161),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 5/98 (5%)
 Frame = -2

Query  664  VVDIIPYDRPALPPTPIKKQSLFSSL--IFGRKSHNFRS--NKLFAVGVVEELFEEGSAM  497
            VVDI+P ++P   P P +K+ +   L  +F +KS    S   +     VV EL+EEGSAM
Sbjct  291  VVDILPQEKPP-APVPHQKKPVKGMLKAMFRKKSSESSSIDKEYMEPDVVVELYEEGSAM  349

Query  496  LAERLGKDFPXDSSFGIFRCAVCQADQPPSEGLFVNSG  383
            L+ERL   +P  + F +F CAVCQ +  P EG+ V+ G
Sbjct  350  LSERLETKYPLCNMFKLFICAVCQVEIKPGEGISVHEG  387


 Score = 37.7 bits (86),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -3

Query  357  PWEGPFLXATCXRKKDAMEGKR  292
            PW+GPFL  +C  KK+AMEGKR
Sbjct  396  PWDGPFLCFSCQEKKEAMEGKR  417



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077441081409