BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5332

Length=892
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     264   9e-81   Nicotiana tomentosiformis
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     264   9e-81   Nicotiana sylvestris
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     262   5e-80   Solanum lycopersicum
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    261   1e-79   Solanum tuberosum [potatoes]
emb|CDP03239.1|  unnamed protein product                                259   6e-79   Coffea canephora [robusta coffee]
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     256   1e-77   Vitis vinifera
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     253   2e-76   Phoenix dactylifera
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     252   5e-76   Nelumbo nucifera [Indian lotus]
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    248   3e-75   
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     250   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     249   7e-75   
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    248   1e-74   Sesamum indicum [beniseed]
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    248   1e-74   
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             248   2e-74   Phaseolus vulgaris [French bean]
gb|AIR93910.1|  glucanase                                               246   2e-74   Cicer arietinum [garbanzo]
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        248   2e-74   Phaseolus vulgaris [French bean]
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    248   3e-74   Elaeis guineensis
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     247   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    247   4e-74   
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    247   5e-74   Prunus mume [ume]
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            247   5e-74   Prunus persica
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     247   5e-74   Eucalyptus grandis [rose gum]
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    247   6e-74   Glycine max [soybeans]
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     246   6e-74   Glycine soja [wild soybean]
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    247   7e-74   Phoenix dactylifera
gb|AET05176.2|  glucan endo-1,3-beta-glucosidase-like protein           245   1e-73   Medicago truncatula
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     246   1e-73   Elaeis guineensis
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    244   7e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     244   9e-73   Glycine max [soybeans]
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     241   6e-72   Populus euphratica
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     241   8e-72   Fragaria vesca subsp. vesca
gb|KHG04832.1|  hypothetical protein F383_29565                         241   2e-71   Gossypium arboreum [tree cotton]
ref|XP_012076842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    240   2e-71   Jatropha curcas
gb|EYU30694.1|  hypothetical protein MIMGU_mgv1a005031mg                240   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_006451337.1|  hypothetical protein CICLE_v10008080mg             240   2e-71   Citrus clementina [clementine]
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    240   3e-71   Setaria italica
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        239   3e-71   Populus trichocarpa [western balsam poplar]
gb|KJB27172.1|  hypothetical protein B456_004G282300                    239   4e-71   Gossypium raimondii
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          238   6e-71   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71452.1|  hypothetical protein OsI_03677                          239   7e-71   Oryza sativa Indica Group [Indian rice]
ref|NP_001044198.1|  Os01g0739700                                       238   7e-71   
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    239   7e-71   
dbj|BAJ85556.1|  predicted protein                                      238   2e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG26459.1|  hypothetical protein F383_04538                         238   2e-70   Gossypium arboreum [tree cotton]
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    237   2e-70   Oryza brachyantha
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          236   7e-70   Sorghum bicolor [broomcorn]
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     236   1e-69   Cucumis melo [Oriental melon]
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                245   1e-69   
gb|KJB65051.1|  hypothetical protein B456_010G078300                    236   1e-69   Gossypium raimondii
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    234   2e-69   
gb|ACU24280.1|  unknown                                                 230   2e-69   Glycine max [soybeans]
ref|XP_007012993.1|  O-Glycosyl hydrolases family 17 protein isof...    232   2e-69   
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    235   3e-69   Ricinus communis
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    238   4e-69   
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   6e-69   Brachypodium distachyon [annual false brome]
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    233   7e-69   Brachypodium distachyon [annual false brome]
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     233   1e-68   Cucumis sativus [cucumbers]
ref|XP_007012992.1|  O-Glycosyl hydrolases family 17 protein isof...    232   1e-68   
ref|XP_003620800.1|  Glucan endo-1,3-beta-glucosidase                   231   1e-68   
ref|XP_009394833.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    232   2e-68   
ref|XP_003630700.1|  Glucan endo-1,3-beta-glucosidase                   231   5e-68   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     230   5e-68   Glycine soja [wild soybean]
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           230   2e-67   Medicago truncatula
gb|ABD91577.1|  beta-1,3-glucanase                                      230   2e-67   Medicago sativa [alfalfa]
gb|ABD91576.1|  beta-1,3-glucanase                                      230   2e-67   Medicago sativa [alfalfa]
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    229   3e-67   Cicer arietinum [garbanzo]
ref|NP_001144992.1|  uncharacterized protein LOC100278152 precursor     226   2e-66   
emb|CDM84006.1|  unnamed protein product                                226   3e-66   Triticum aestivum [Canadian hard winter wheat]
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     226   3e-66   Triticum urartu
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     227   4e-66   
gb|KJB27173.1|  hypothetical protein B456_004G282300                    226   4e-66   Gossypium raimondii
gb|KDO55852.1|  hypothetical protein CISIN_1g010782mg                   224   7e-66   Citrus sinensis [apfelsine]
gb|EPS73640.1|  hypothetical protein M569_01113                         221   4e-64   Genlisea aurea
ref|XP_010545323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     218   6e-63   Tarenaya hassleriana [spider flower]
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    216   3e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     216   6e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009120169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     215   1e-61   Brassica rapa
emb|CDY32869.1|  BnaC09g33160D                                          214   1e-61   Brassica napus [oilseed rape]
emb|CDY64970.1|  BnaAnng19910D                                          214   2e-61   Brassica napus [oilseed rape]
ref|XP_011626761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     211   2e-60   Amborella trichopoda
ref|XP_010446151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    210   3e-60   
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    210   6e-60   
gb|ERN15184.1|  hypothetical protein AMTR_s00056p00158530               211   7e-60   Amborella trichopoda
ref|XP_006280336.1|  hypothetical protein CARUB_v10026261mg             208   3e-59   Capsella rubella
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               208   3e-59   Arabidopsis lyrata subsp. lyrata
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               208   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401304.1|  hypothetical protein EUTSA_v10013309mg             207   8e-59   Eutrema salsugineum [saltwater cress]
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     200   7e-56   Tarenaya hassleriana [spider flower]
emb|CDY14214.1|  BnaA08g13450D                                          186   9e-51   Brassica napus [oilseed rape]
emb|CDY62033.1|  BnaC03g77660D                                          184   5e-50   Brassica napus [oilseed rape]
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   3e-49   Brassica rapa
emb|CDY06818.1|  BnaC01g09170D                                          180   8e-49   
ref|XP_006412850.1|  hypothetical protein EUTSA_v10024870mg             179   4e-48   Eutrema salsugineum [saltwater cress]
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    178   9e-48   Arabis alpina [alpine rockcress]
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                       177   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                   177   2e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68826.1|  BnaA01g34890D                                          175   3e-47   Brassica napus [oilseed rape]
ref|XP_010447863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010433104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             176   9e-47   Capsella rubella
ref|XP_010438307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     176   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     174   3e-46   Brassica rapa
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein               174   3e-46   
gb|KJB54309.1|  hypothetical protein B456_009G028300                    171   1e-45   Gossypium raimondii
gb|KJB54307.1|  hypothetical protein B456_009G028200                    169   2e-44   Gossypium raimondii
gb|KHG29271.1|  hypothetical protein F383_14120                         167   8e-44   Gossypium arboreum [tree cotton]
ref|NP_567828.3|  glucan endo-1,3-beta-glucosidase 12                   164   1e-42   
gb|KJB54308.1|  hypothetical protein B456_009G028300                    160   2e-41   Gossypium raimondii
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   2e-34   Citrus sinensis [apfelsine]
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             140   3e-34   
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   2e-33   Cucumis melo [Oriental melon]
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   2e-33   Cucumis melo [Oriental melon]
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   5e-33   Cucumis sativus [cucumbers]
ref|XP_011655956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   6e-33   Cucumis sativus [cucumbers]
ref|XP_002969476.1|  hypothetical protein SELMODRAFT_231287             136   7e-33   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              135   9e-33   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              135   1e-32   
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     134   1e-32   Glycine soja [wild soybean]
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   2e-32   Glycine max [soybeans]
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   7e-32   
ref|XP_010905435.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    127   7e-32   
ref|XP_008784817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   9e-32   
ref|XP_008784816.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   9e-32   
ref|XP_002961242.1|  hypothetical protein SELMODRAFT_402967             132   1e-31   
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             132   1e-31   Capsella rubella
gb|EPS73917.1|  hypothetical protein M569_00835                         132   2e-31   Genlisea aurea
ref|XP_006579395.1|  PREDICTED: uncharacterized protein LOC100778...    126   2e-31   
ref|XP_003531315.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   2e-31   Glycine max [soybeans]
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             132   2e-31   Prunus persica
gb|KEH20727.1|  carbohydrate-binding X8 domain protein                  125   4e-31   Medicago truncatula
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     131   4e-31   Solanum lycopersicum
ref|NP_001242238.1|  uncharacterized protein LOC100778330 precursor     125   6e-31   Glycine max [soybeans]
ref|XP_006657748.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   9e-31   Oryza brachyantha
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg             130   9e-31   Citrus clementina [clementine]
emb|CDP01635.1|  unnamed protein product                                130   9e-31   Coffea canephora [robusta coffee]
gb|KHG04965.1|  hypothetical protein F383_30444                         130   1e-30   Gossypium arboreum [tree cotton]
ref|XP_003630021.1|  Glucan endo-1,3-beta-glucosidase                   124   1e-30   Medicago truncatula
ref|XP_004504153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-30   Cicer arietinum [garbanzo]
dbj|BAF01977.1|  putative beta-1,3-glucanase                            127   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001059752.1|  Os07g0510200                                       129   2e-30   
gb|EEC82125.1|  hypothetical protein OsI_26155                          129   2e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   2e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|ADU15553.1|  GLU                                                     129   2e-30   Gossypium hirsutum [American cotton]
ref|XP_010319704.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    124   2e-30   
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   2e-30   
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                  129   2e-30   Citrus sinensis [apfelsine]
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      129   2e-30   Fragaria vesca subsp. vesca
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             129   2e-30   
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     129   2e-30   Glycine soja [wild soybean]
gb|KHN06522.1|  Glucan endo-1,3-beta-glucosidase 13                     123   3e-30   Glycine soja [wild soybean]
emb|CDY56498.1|  BnaAnng14330D                                          128   3e-30   Brassica napus [oilseed rape]
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   3e-30   Solanum tuberosum [potatoes]
ref|XP_010276339.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             128   4e-30   
ref|XP_009628793.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    123   4e-30   Nicotiana tomentosiformis
ref|XP_010276332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   4e-30   Nelumbo nucifera [Indian lotus]
emb|CDY18049.1|  BnaC07g04210D                                          128   4e-30   Brassica napus [oilseed rape]
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    128   4e-30   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             128   4e-30   
ref|XP_006837267.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     128   5e-30   Amborella trichopoda
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               128   5e-30   
gb|ERN00121.1|  hypothetical protein AMTR_s00112p00108890               127   5e-30   Amborella trichopoda
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                127   5e-30   Erythranthe guttata [common monkey flower]
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   5e-30   Glycine max [soybeans]
ref|XP_009784559.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    122   5e-30   Nicotiana sylvestris
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               127   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AFU52644.1|  beta-1,3-glucanase 9                                    122   6e-30   Solanum tuberosum [potatoes]
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               127   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|ACL53837.1|  unknown                                                 125   6e-30   Zea mays [maize]
ref|XP_009402144.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   7e-30   Glycine max [soybeans]
ref|XP_004306417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   7e-30   Fragaria vesca subsp. vesca
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     127   7e-30   Brassica rapa
ref|XP_004135538.1|  PREDICTED: major pollen allergen Ole e 10          122   9e-30   Cucumis sativus [cucumbers]
gb|AIR93909.1|  glucanase                                               127   9e-30   Cicer arietinum [garbanzo]
ref|XP_004503372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   1e-29   Cicer arietinum [garbanzo]
gb|EPS65983.1|  hypothetical protein M569_08793                         127   1e-29   Genlisea aurea
ref|XP_004490818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   1e-29   
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             127   1e-29   Eutrema salsugineum [saltwater cress]
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    127   1e-29   Solanum tuberosum [potatoes]
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      126   1e-29   Sesamum indicum [beniseed]
ref|XP_004490817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   1e-29   Cicer arietinum [garbanzo]
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      127   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007159617.1|  hypothetical protein PHAVU_002G252400g             121   1e-29   Phaseolus vulgaris [French bean]
gb|ACF79018.1|  unknown                                                 126   2e-29   Zea mays [maize]
ref|NP_001136613.1|  uncharacterized protein LOC100216736 precursor     126   2e-29   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256              126   2e-29   
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             126   2e-29   Phaseolus vulgaris [French bean]
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        126   2e-29   
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   2e-29   
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     126   2e-29   Brassica rapa
ref|XP_002876767.1|  hypothetical protein ARALYDRAFT_484077             126   2e-29   
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   2e-29   Cucumis melo [Oriental melon]
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        126   2e-29   
ref|XP_004297451.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      126   2e-29   Fragaria vesca subsp. vesca
ref|NP_565269.1|  glucan endo-1,3-beta-glucosidase 3                    126   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   2e-29   Populus euphratica
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   2e-29   Populus euphratica
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      126   2e-29   Populus euphratica
ref|XP_001752749.1|  predicted protein                                  125   2e-29   
gb|ACF88240.1|  unknown                                                 126   2e-29   Zea mays [maize]
emb|CDY46679.1|  BnaA03g48290D                                          125   2e-29   Brassica napus [oilseed rape]
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   2e-29   Tarenaya hassleriana [spider flower]
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   3e-29   Oryza brachyantha
ref|XP_007041111.1|  Carbohydrate-binding X8 domain superfamily p...    120   3e-29   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513              125   4e-29   
gb|KJB66065.1|  hypothetical protein B456_010G126400                    125   4e-29   Gossypium raimondii
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             125   4e-29   Eutrema salsugineum [saltwater cress]
ref|XP_007041109.1|  Carbohydrate-binding X8 domain superfamily p...    120   4e-29   
gb|KJB66066.1|  hypothetical protein B456_010G126400                    125   4e-29   Gossypium raimondii
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             125   5e-29   
gb|ACR35980.1|  unknown                                                 125   5e-29   Zea mays [maize]
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   5e-29   Eucalyptus grandis [rose gum]
emb|CDP00829.1|  unnamed protein product                                125   5e-29   Coffea canephora [robusta coffee]
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             125   5e-29   Phaseolus vulgaris [French bean]
ref|XP_008444815.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     119   5e-29   Cucumis melo [Oriental melon]
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    124   7e-29   
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   7e-29   Tarenaya hassleriana [spider flower]
gb|KHG21190.1|  hypothetical protein F383_01641                         124   7e-29   Gossypium arboreum [tree cotton]
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg             124   7e-29   Citrus clementina [clementine]
gb|AAD26909.1|  putative beta-1,3-glucanase                             124   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   7e-29   
ref|XP_007041110.1|  Carbohydrate-binding X8 domain superfamily p...    120   7e-29   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   8e-29   Camelina sativa [gold-of-pleasure]
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     124   8e-29   Sesamum indicum [beniseed]
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   8e-29   
ref|XP_011628180.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   8e-29   Amborella trichopoda
ref|XP_002274294.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     119   1e-28   Vitis vinifera
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-28   Glycine max [soybeans]
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-28   Camelina sativa [gold-of-pleasure]
gb|AAK85402.2|  beta-1,3-glucanase                                      124   1e-28   Camellia sinensis [black tea]
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g             124   1e-28   Phaseolus vulgaris [French bean]
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      124   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_002312452.2|  glucan endo-1 family protein                       124   1e-28   
gb|KJB47941.1|  hypothetical protein B456_008G047800                    119   1e-28   Gossypium raimondii
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-28   Camelina sativa [gold-of-pleasure]
gb|KJB10704.1|  hypothetical protein B456_001G216900                    122   1e-28   Gossypium raimondii
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     124   1e-28   Populus euphratica
ref|XP_008366987.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-28   
ref|XP_010424935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      124   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010502143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-28   Camelina sativa [gold-of-pleasure]
gb|KJB47942.1|  hypothetical protein B456_008G047800                    118   1e-28   Gossypium raimondii
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      124   1e-28   Cucumis sativus [cucumbers]
ref|XP_010513892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010244529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     118   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_001767901.1|  predicted protein                                  124   1e-28   
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             124   1e-28   Capsella rubella
ref|XP_006828511.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-28   
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        123   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293165.1|  hypothetical protein CARUB_v10019481mg             124   2e-28   Capsella rubella
ref|XP_006584863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   Glycine max [soybeans]
gb|EPS59841.1|  hypothetical protein M569_14964                         123   2e-28   Genlisea aurea
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   Glycine max [soybeans]
gb|EEC82319.1|  hypothetical protein OsI_26597                          124   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2                 123   2e-28   Morus notabilis
ref|XP_006584862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   
ref|XP_002975458.1|  hypothetical protein SELMODRAFT_415534             123   2e-28   Selaginella moellendorffii
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      123   2e-28   Sesamum indicum [beniseed]
gb|KJB15378.1|  hypothetical protein B456_002G174100                    123   2e-28   Gossypium raimondii
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    123   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009362262.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...    117   2e-28   
ref|XP_003532507.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   Glycine max [soybeans]
gb|KJB15376.1|  hypothetical protein B456_002G174100                    123   2e-28   Gossypium raimondii
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        123   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   Citrus sinensis [apfelsine]
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   
ref|NP_001060087.2|  Os07g0577300                                       123   2e-28   
emb|CDP05643.1|  unnamed protein product                                118   2e-28   Coffea canephora [robusta coffee]
gb|KHG18393.1|  hypothetical protein F383_22096                         123   2e-28   Gossypium arboreum [tree cotton]
gb|ACF87545.1|  unknown                                                 123   2e-28   Zea mays [maize]
gb|EAZ38703.1|  hypothetical protein OsJ_23103                          117   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   Populus euphratica
gb|KJB62900.1|  hypothetical protein B456_009G442700                    123   2e-28   Gossypium raimondii
tpg|DAA63295.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    123   2e-28   
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   Populus euphratica
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   Populus euphratica
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-28   Populus euphratica
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                123   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_007225735.1|  hypothetical protein PRUPE_ppa005356mg             123   3e-28   
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   3e-28   
ref|XP_010527795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      123   3e-28   
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    122   3e-28   
ref|XP_004959695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   3e-28   
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   3e-28   
gb|EEE67465.1|  hypothetical protein OsJ_24859                          123   3e-28   
ref|XP_009362261.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...    118   3e-28   
emb|CDY48807.1|  BnaC02g34070D                                          123   3e-28   
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      123   3e-28   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    122   3e-28   
ref|XP_006580439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   3e-28   
gb|KFK39880.1|  hypothetical protein AALP_AA3G300600                    122   3e-28   
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             122   3e-28   
ref|XP_010534498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        122   3e-28   
ref|XP_010937626.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    122   4e-28   
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    122   4e-28   
gb|KJB13749.1|  hypothetical protein B456_002G092600                    122   4e-28   
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g             122   4e-28   
ref|XP_002532062.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    122   4e-28   
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g             122   4e-28   
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            122   4e-28   
gb|KJB23365.1|  hypothetical protein B456_004G094500                    122   4e-28   
ref|XP_001781801.1|  predicted protein                                  122   4e-28   
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              122   4e-28   
emb|CAB36529.1|  putative beta-1, 3-glucanase                           122   4e-28   
ref|XP_006395868.1|  hypothetical protein EUTSA_v10004013mg             122   4e-28   
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              122   4e-28   
gb|KHG05496.1|  hypothetical protein F383_30989                         122   4e-28   
gb|EAZ02781.1|  hypothetical protein OsI_24906                          117   5e-28   
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   5e-28   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   5e-28   
ref|NP_001048260.1|  Os02g0771700                                       122   5e-28   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             122   5e-28   
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   5e-28   
ref|XP_006657446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   5e-28   
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   5e-28   
gb|KJB30775.1|  hypothetical protein B456_005G159100                    122   5e-28   
gb|KJB30776.1|  hypothetical protein B456_005G159100                    122   6e-28   
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                122   6e-28   
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     122   6e-28   
gb|EPS68573.1|  hypothetical protein M569_06194                         121   6e-28   
dbj|BAJ93567.1|  predicted protein                                      122   6e-28   
gb|ERM99158.1|  hypothetical protein AMTR_s00092p00035570               117   6e-28   
gb|KEH28239.1|  glucan endo-1,3-beta-glucosidase-like protein           123   6e-28   
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     122   6e-28   
gb|KEH40581.1|  glucan endo-1,3-beta-glucosidase-like protein           122   6e-28   
ref|XP_011620762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     117   7e-28   
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    122   7e-28   
gb|EYU45799.1|  hypothetical protein MIMGU_mgv1a004953mg                122   7e-28   
gb|KEH40580.1|  glucan endo-1,3-beta-glucosidase-like protein           122   7e-28   
ref|XP_009589694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   7e-28   
dbj|BAD94999.1|  beta-1,3-glucanase - like protein                      115   8e-28   
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        121   8e-28   
ref|NP_001049413.1|  Os03g0221500                                       122   8e-28   
ref|XP_003616282.1|  Glucan endo-1,3-beta-glucosidase                   123   8e-28   
gb|KJB22745.1|  hypothetical protein B456_004G064200                    121   8e-28   
ref|NP_001058896.1|  Os07g0149900                                       115   9e-28   
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     121   9e-28   
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                121   9e-28   
ref|XP_007212537.1|  hypothetical protein PRUPE_ppa019395mg             115   9e-28   
ref|NP_001149308.1|  glucan endo-1,3-beta-glucosidase 4 precursor       121   9e-28   
ref|NP_001152289.1|  glucan endo-1,3-beta-glucosidase 3 precursor       122   9e-28   
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        121   9e-28   
gb|ACN39797.1|  unknown                                                 121   1e-27   
ref|XP_009129217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      121   1e-27   
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         121   1e-27   
ref|XP_010100650.1|  Glucan endo-1,3-beta-glucosidase 3                 121   1e-27   
ref|XP_001784285.1|  predicted protein                                  120   1e-27   
gb|KHG14816.1|  hypothetical protein F383_17797                         121   1e-27   
ref|XP_012080639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     121   1e-27   
ref|XP_008225549.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     116   1e-27   
ref|XP_008372207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   1e-27   
ref|XP_008372208.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   1e-27   
ref|XP_012086410.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      121   1e-27   
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     120   1e-27   
ref|XP_004955451.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   1e-27   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             120   1e-27   
ref|XP_011096658.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     116   1e-27   
ref|XP_010681924.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   1e-27   
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   1e-27   
emb|CDX92794.1|  BnaC07g40520D                                          120   2e-27   
gb|ABR16205.1|  unknown                                                 120   2e-27   
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             120   2e-27   
ref|XP_012075667.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        115   2e-27   
dbj|BAC83956.1|  putative beta-1,3-glucanase                            121   2e-27   
ref|XP_008806478.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    121   2e-27   
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     120   2e-27   
ref|XP_002460914.1|  hypothetical protein SORBIDRAFT_02g037380          120   2e-27   
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    122   2e-27   
ref|XP_009381292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   2e-27   
ref|XP_009406533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-27   
ref|XP_010670126.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-27   
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-27   
ref|XP_008802448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-27   
gb|EAZ24771.1|  hypothetical protein OsJ_08544                          120   2e-27   
ref|XP_009116237.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    120   2e-27   
tpg|DAA62863.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    122   2e-27   
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             119   2e-27   
ref|XP_007160409.1|  hypothetical protein PHAVU_002G319500g             120   2e-27   
ref|XP_003524953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-27   
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-27   
ref|XP_012072282.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      120   2e-27   
emb|CDY40218.1|  BnaA09g35000D                                          120   2e-27   
ref|XP_010934539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      120   3e-27   
ref|XP_003531243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   3e-27   
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 120   3e-27   
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     120   3e-27   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   3e-27   
ref|XP_010929505.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   3e-27   
ref|XP_001761806.1|  predicted protein                                  120   3e-27   
emb|CDP14397.1|  unnamed protein product                                120   3e-27   
gb|KHG17836.1|  hypothetical protein F383_07126                         120   3e-27   
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   3e-27   
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    123   3e-27   
emb|CBI30973.3|  unnamed protein product                                122   3e-27   
ref|XP_010916186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   3e-27   
ref|XP_008383434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   3e-27   
ref|XP_010916187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   3e-27   
ref|XP_011023010.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   3e-27   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     119   3e-27   
emb|CDY67322.1|  BnaA03g57600D                                          116   4e-27   
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             119   4e-27   
ref|XP_006289337.1|  hypothetical protein CARUB_v10002833mg             114   4e-27   
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      120   4e-27   
ref|XP_009377467.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...    115   4e-27   
ref|XP_008789151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   4e-27   
emb|CDY08310.1|  BnaA05g13090D                                          119   4e-27   
ref|XP_008789143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   4e-27   
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   4e-27   
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    119   4e-27   
ref|XP_006396600.1|  hypothetical protein EUTSA_v10029156mg             114   4e-27   
ref|XP_002461458.1|  hypothetical protein SORBIDRAFT_02g002990          114   5e-27   
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   5e-27   
ref|XP_009402145.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    114   5e-27   
ref|XP_010929487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   5e-27   
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      119   5e-27   
emb|CDP13790.1|  unnamed protein product                                120   5e-27   
ref|XP_011023011.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    114   5e-27   
emb|CDY06601.1|  BnaC02g13250D                                          119   5e-27   
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   5e-27   
ref|XP_010267790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   5e-27   
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            119   5e-27   
ref|XP_003563040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   5e-27   
gb|KJB10512.1|  hypothetical protein B456_001G204900                    120   6e-27   
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-27   
gb|EPS58986.1|  hypothetical protein M569_15824                         119   6e-27   
gb|EMS56219.1|  Glucan endo-1,3-beta-glucosidase                        119   6e-27   
ref|XP_004498268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-27   
sp|P52409.1|E13B_WHEAT  RecName: Full=Glucan endo-1,3-beta-glucos...    119   6e-27   
ref|XP_003577202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   6e-27   
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-27   
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   119   6e-27   
ref|XP_010027320.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      115   6e-27   
gb|ERN17398.1|  hypothetical protein AMTR_s00037p00209440               119   6e-27   
emb|CDY31214.1|  BnaC08g15090D                                          119   6e-27   
ref|XP_004503127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-27   
ref|XP_006448957.1|  hypothetical protein CICLE_v10018075mg             112   6e-27   
ref|XP_004958122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   7e-27   
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    119   7e-27   
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   7e-27   
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      119   7e-27   
ref|XP_012070897.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   7e-27   
ref|NP_001144702.1|  uncharacterized protein LOC100277738               114   7e-27   
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    118   7e-27   
ref|XP_009417707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   7e-27   
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             119   7e-27   
gb|KHG06295.1|  hypothetical protein F383_32557                         119   7e-27   
ref|XP_006658732.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   7e-27   
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         118   7e-27   
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      119   8e-27   
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   8e-27   
ref|XP_006467418.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   8e-27   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   8e-27   
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   8e-27   
gb|EAZ04201.1|  hypothetical protein OsI_26344                          119   8e-27   
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    118   8e-27   
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    118   8e-27   
emb|CDP16794.1|  unnamed protein product                                119   9e-27   
emb|CBI26850.3|  unnamed protein product                                119   9e-27   
emb|CDY19908.1|  BnaC09g31740D                                          118   9e-27   
gb|KDO78272.1|  hypothetical protein CISIN_1g010394mg                   119   9e-27   
ref|XP_011627616.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      119   9e-27   
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   9e-27   
ref|XP_010422431.1|  PREDICTED: major pollen allergen Ole e 10-li...    113   9e-27   
ref|XP_010687021.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     114   9e-27   
dbj|BAJ87688.1|  predicted protein                                      118   9e-27   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     118   9e-27   
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   9e-27   
gb|KJB10702.1|  hypothetical protein B456_001G216900                    118   9e-27   
ref|XP_001777261.1|  predicted protein                                  118   1e-26   
gb|KJB15377.1|  hypothetical protein B456_002G174100                    118   1e-26   
ref|XP_003561463.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    113   1e-26   
ref|XP_010236492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      118   1e-26   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             118   1e-26   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-26   
ref|XP_006355069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-26   
ref|XP_006380364.1|  hypothetical protein POPTR_0007s03690g             113   1e-26   
emb|CDY20780.1|  BnaA02g09200D                                          118   1e-26   
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g             118   1e-26   
gb|KHG27056.1|  hypothetical protein F383_08405                         118   1e-26   
ref|XP_006649652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-26   
ref|XP_010431286.1|  PREDICTED: major pollen allergen Ole e 10-li...    113   1e-26   
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             118   1e-26   
ref|NP_192452.2|  carbohydrate-binding X8 domain-containing protein     112   1e-26   
ref|XP_009792882.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   1e-26   
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-26   
ref|XP_010431291.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   1e-26   
gb|KHN16561.1|  Glucan endo-1,3-beta-glucosidase 3                      117   1e-26   
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        117   1e-26   
emb|CDY02936.1|  BnaC04g25500D                                          117   1e-26   
ref|NP_001131285.1|  putative O-Glycosyl hydrolase superfamily pr...    118   2e-26   
emb|CDY17308.1|  BnaA10g09420D                                          117   2e-26   
ref|XP_009792881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   2e-26   
ref|XP_004236940.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      118   2e-26   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     117   2e-26   
ref|XP_007032976.1|  Glucan endo-1,3-beta-glucosidase, putative i...    117   2e-26   
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     117   2e-26   
gb|KHN21581.1|  Glucan endo-1,3-beta-glucosidase 3                      117   2e-26   
emb|CDY41234.1|  BnaC08g26240D                                          117   2e-26   
ref|XP_002454630.1|  hypothetical protein SORBIDRAFT_04g034530          117   2e-26   
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    117   2e-26   



>ref|XP_009628676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nicotiana tomentosiformis]
Length=496

 Score =   264 bits (675),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGL SERNWGL FPDQTSVYNLDFTGKGA+DV+T  N TSSNGTWCIASS+AS
Sbjct  315  LFNENRKPGLASERNWGLFFPDQTSVYNLDFTGKGAIDVTTDGNATSSNGTWCIASSSAS  374

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            EADL+NAL+WACGSGNVDCSAIQPSQPCFEPDN  SHAS+AFNSYYQQNGATD+ACSFGG
Sbjct  375  EADLQNALSWACGSGNVDCSAIQPSQPCFEPDNTASHASYAFNSYYQQNGATDIACSFGG  434

Query  530  VGVRTNKNPSYDNCLY  483
            VGVRTNKNPSYDNCLY
Sbjct  435  VGVRTNKNPSYDNCLY  450



>ref|XP_009776400.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nicotiana sylvestris]
Length=496

 Score =   264 bits (675),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGL SERNWGL FPDQTSVYNLDFTGKG VDV+T  N TSSNGTWCIASS+AS
Sbjct  315  LFNENRKPGLASERNWGLFFPDQTSVYNLDFTGKGVVDVNTDGNATSSNGTWCIASSSAS  374

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            EADL+NAL+WACGSGNVDCSAIQPSQPCFEPDN+ SHAS+AFNSYYQQNGATD+ACSFGG
Sbjct  375  EADLQNALSWACGSGNVDCSAIQPSQPCFEPDNIASHASYAFNSYYQQNGATDIACSFGG  434

Query  530  VGVRTNKNPSYDNCLY  483
            VGVRTNKNPSYDNCLY
Sbjct  435  VGVRTNKNPSYDNCLY  450



>ref|XP_004251644.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Solanum lycopersicum]
Length=496

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL FPDQTSVYNLDFTGKG VD + G N T SNGTWCIASS+AS
Sbjct  314  LFNENRKPGLESERNWGLFFPDQTSVYNLDFTGKGVVDTTAGGNNTGSNGTWCIASSSAS  373

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            EA+L+NAL+WACGSGNVDCSAIQPSQPCFEPDNL SHASFAFNSYYQQNGATD+AC+FGG
Sbjct  374  EAELQNALSWACGSGNVDCSAIQPSQPCFEPDNLASHASFAFNSYYQQNGATDIACTFGG  433

Query  530  VGVRTNKNPSYDNCLY  483
            VGVRTNKNPSYDNCLY
Sbjct  434  VGVRTNKNPSYDNCLY  449



>ref|NP_001275363.1| glucan endo-1,3-beta-glucosidase 13-like precursor [Solanum tuberosum]
 gb|AFU52637.1| beta-1,3-glucanase 2 [Solanum tuberosum]
Length=496

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL FPDQTSVYNLDFTGKG VD++ G N T SNGTWCIASS+AS
Sbjct  314  LFNENRKPGLESERNWGLFFPDQTSVYNLDFTGKGVVDMTAGGNNTGSNGTWCIASSSAS  373

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            EA+L+NAL+WACGSGNVDCSAIQPSQPCFEPDN  SHASFAFNSYYQQNGATD+AC+FGG
Sbjct  374  EAELQNALSWACGSGNVDCSAIQPSQPCFEPDNFASHASFAFNSYYQQNGATDIACTFGG  433

Query  530  VGVRTNKNPSYDNCLY  483
            VGVRTNKNPSYDNCLY
Sbjct  434  VGVRTNKNPSYDNCLY  449



>emb|CDP03239.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL FPDQTSVYNLDFTG+G VD++TGAN+TSSN TWC+A+S AS
Sbjct  314  LFNENRKPGLESERNWGLFFPDQTSVYNLDFTGRGTVDITTGANITSSNETWCVAASNAS  373

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +ADL+NAL+WACGSGNVDCSAIQPSQPCFEPDNL+SHAS+AFN YYQQNGATD+ACSFGG
Sbjct  374  DADLQNALDWACGSGNVDCSAIQPSQPCFEPDNLISHASYAFNGYYQQNGATDIACSFGG  433

Query  530  VGVRTNKNPSYDNCLY  483
             G+RTNKNPSYDNC+Y
Sbjct  434  NGLRTNKNPSYDNCIY  449



>ref|XP_002283473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Vitis vinifera]
 emb|CBI27983.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRK GLESERNWGL +PDQTSVYNLD TGKGAV ++T  N+TSSNGTWCIASSTAS
Sbjct  314  LFNENRKSGLESERNWGLFYPDQTSVYNLDMTGKGAVTMTTETNVTSSNGTWCIASSTAS  373

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NAL+WACG GNVDCSAIQPSQPCFEPDN+VSHASFAFNSYYQQNGATD+ACSFGG
Sbjct  374  EMDLQNALDWACGPGNVDCSAIQPSQPCFEPDNVVSHASFAFNSYYQQNGATDIACSFGG  433

Query  530  VGVRTNKNPSYDNCLYM  480
             G++ NKNPSYDNCLYM
Sbjct  434  SGIKVNKNPSYDNCLYM  450



>ref|XP_008795501.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Phoenix dactylifera]
Length=502

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PDQTS+Y LD TG+G VDV+TGAN++SSNGTWC+ASS AS
Sbjct  320  LFNENRKPGLESERNWGLFYPDQTSIYTLDLTGRGNVDVTTGANISSSNGTWCVASSNAS  379

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NALNWACG+GNVDCSAIQPSQPC++PD L+SHASFAFNSYYQQNGATDVACSFGG
Sbjct  380  ELDLQNALNWACGAGNVDCSAIQPSQPCYQPDTLLSHASFAFNSYYQQNGATDVACSFGG  439

Query  530  VGVRTNKNPSYDNCLY  483
             GV+T KNPSYD C+Y
Sbjct  440  TGVKTTKNPSYDKCIY  455



>ref|XP_010249473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 1/137 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PDQTSVY++D TG+GAVD+ T AN+TSSNGTWCIASSTAS
Sbjct  316  LFNENRKPGLESERNWGLFYPDQTSVYSVDLTGRGAVDI-TEANITSSNGTWCIASSTAS  374

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NAL+W CG GNVDCSAIQPSQ C++PD LVSHASFAFNSYYQQNGATDVACSFGG
Sbjct  375  ELDLQNALDWTCGPGNVDCSAIQPSQACYQPDTLVSHASFAFNSYYQQNGATDVACSFGG  434

Query  530  VGVRTNKNPSYDNCLYM  480
             GV+TNKNPSYDNCLYM
Sbjct  435  TGVKTNKNPSYDNCLYM  451



>ref|XP_007012990.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOY30609.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=430

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVYNLDFTGKGAVD++   N T SNGT WCIASS A
Sbjct  239  LFNENRKPGMESERNWGLFYPDQTSVYNLDFTGKGAVDMTNSGNGTKSNGTTWCIASSKA  298

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+DVACSFG
Sbjct  299  SESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGASDVACSFG  358

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYDNC+Y+
Sbjct  359  GNGVKVDKDPSYDNCIYL  376



>ref|XP_010267108.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 1/137 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PDQTSVY+LDF+G+GAVD+ T AN+TSSNGTWCIASSTAS
Sbjct  318  LFNENRKPGLESERNWGLFYPDQTSVYSLDFSGRGAVDI-TQANITSSNGTWCIASSTAS  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NAL+WACG GNVDCSAIQPSQ C++PD L+SHAS+AFNSYYQQ GATDVACSFGG
Sbjct  377  ELDLQNALDWACGPGNVDCSAIQPSQACYQPDTLLSHASYAFNSYYQQTGATDVACSFGG  436

Query  530  VGVRTNKNPSYDNCLYM  480
             GV+TNKNPSYDNCLYM
Sbjct  437  TGVKTNKNPSYDNCLYM  453



>ref|XP_008337610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Malus domestica]
Length=503

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 5/142 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-----WCIA  726
            LFNENRKPGLESERNWGL +PDQTSVYNLDFTGKG+VD++TG N+TSSNGT     WCIA
Sbjct  315  LFNENRKPGLESERNWGLFYPDQTSVYNLDFTGKGSVDMTTGTNVTSSNGTTTTTTWCIA  374

Query  725  SSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVA  546
            SS ASE DL+NAL+WACG GNVDC AIQPSQPCFEPDN V+HASFAFN+YYQQNGATD+A
Sbjct  375  SSKASELDLQNALDWACGPGNVDCRAIQPSQPCFEPDNTVAHASFAFNTYYQQNGATDIA  434

Query  545  CSFGGVGVRTNKNPSYDNCLYM  480
            CSFGG G++ +KNPSYDNC+YM
Sbjct  435  CSFGGTGIKVDKNPSYDNCIYM  456



>ref|XP_011078239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Sesamum 
indicum]
Length=494

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGA-NLTSSNGT-WCIASST  717
            LFNENRKPGLESERNWGL FPDQTSVYNLDFTGKG VD++  A N+T SNGT WCIAS T
Sbjct  314  LFNENRKPGLESERNWGLFFPDQTSVYNLDFTGKGVVDMTMNATNITGSNGTTWCIASPT  373

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            AS+ADL+N L+WAC SGNVDCSAIQPSQPCFEPDNL SHAS+AFNSYYQQNGATD+ACSF
Sbjct  374  ASDADLKNGLDWACSSGNVDCSAIQPSQPCFEPDNLASHASYAFNSYYQQNGATDIACSF  433

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GVRTNKNPSYD+CLY+
Sbjct  434  GGAGVRTNKNPSYDSCLYV  452



>ref|XP_007012989.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY30608.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=505

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVYNLDFTGKGAVD++   N T SNGT WCIASS A
Sbjct  314  LFNENRKPGMESERNWGLFYPDQTSVYNLDFTGKGAVDMTNSGNGTKSNGTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYDNC+Y+
Sbjct  434  GNGVKVDKDPSYDNCIYL  451



>ref|XP_007160277.1| hypothetical protein PHAVU_002G307800g [Phaseolus vulgaris]
 gb|ESW32271.1| hypothetical protein PHAVU_002G307800g [Phaseolus vulgaris]
Length=501

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVY+LDFTG+GAVD++T AN+T SNGT WCIAS+ A
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSVYSLDFTGRGAVDMTTQANITKSNGTTWCIASTKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYDNC+YM
Sbjct  434  GTGVKVDKDPSYDNCIYM  451



>gb|AIR93910.1| glucanase [Cicer arietinum]
Length=454

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVYNLDFTG+GA+D++T AN+T SN T WCIAS+ A
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSVYNLDFTGRGAIDMTTAANVTRSNKTSWCIASTKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE DL+NAL+WACG GNVDC AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SEIDLQNALDWACGPGNVDCRAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYD C+YM
Sbjct  434  GTGVKVDKDPSYDKCIYM  451



>gb|AGV54422.1| glucan endo-1,3-beta-glucosidase 13-like protein [Phaseolus vulgaris]
Length=503

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVY+LDFTG+GAVD++T AN+T SNGT WCIAS+ A
Sbjct  316  LFNENRKPGLESERNWGLFYPDQTSVYSLDFTGRGAVDMTTQANITKSNGTTWCIASTKA  375

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFG
Sbjct  376  SQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFG  435

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYDNC+YM
Sbjct  436  GTGVKVDKDPSYDNCIYM  453



>ref|XP_010914932.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Elaeis guineensis]
Length=527

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PD+TS+Y+LD TG+G VDV TG N+TSSNGTWC+AS+ AS
Sbjct  344  LFNENRKPGLESERNWGLFYPDRTSIYSLDLTGRGNVDVITGGNMTSSNGTWCVASTNAS  403

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NAL+WACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGATDVACSFGG
Sbjct  404  ELDLQNALDWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGATDVACSFGG  463

Query  530  VGVRTNKNPSYDNCLY  483
             GVRT K+PSYDNC+Y
Sbjct  464  TGVRTTKDPSYDNCIY  479



>ref|XP_009352572.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Pyrus x bretschneideri]
Length=502

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 4/141 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT----WCIAS  723
            LFNENRKPGLESERNWGL +PDQTSVYNLDFTGKG+VD++T  N+TSSNGT    WCIAS
Sbjct  315  LFNENRKPGLESERNWGLFYPDQTSVYNLDFTGKGSVDMTTETNVTSSNGTTTTTWCIAS  374

Query  722  STASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVAC  543
            S ASE DL+NAL+WACG GNVDC AIQPSQPCFEPDN V+HASFAFN+YYQQNGATD+AC
Sbjct  375  SKASELDLQNALDWACGPGNVDCRAIQPSQPCFEPDNTVAHASFAFNTYYQQNGATDIAC  434

Query  542  SFGGVGVRTNKNPSYDNCLYM  480
            SFGG G++ +KNPSYDNC+YM
Sbjct  435  SFGGTGIKVDKNPSYDNCIYM  455



>ref|XP_008242470.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Prunus 
mume]
Length=491

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSN-GTWCIASSTA  714
            LFNENRKPGL+SERNWGL +PDQTSVYNLDFTGKG+ DV T AN+TSSN  TWCIASS A
Sbjct  308  LFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKGSADVITQANVTSSNVTTWCIASSKA  367

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE DL+NAL+WACG GNVDC+AIQPSQPCFEPDN V+HASFAFN+YYQQNGATDVACSFG
Sbjct  368  SELDLQNALDWACGPGNVDCTAIQPSQPCFEPDNTVAHASFAFNNYYQQNGATDVACSFG  427

Query  533  GVGVRTNKNPSYDNCLYM  480
            G G++ +KNPSYDNC+YM
Sbjct  428  GTGIKVDKNPSYDNCIYM  445



>ref|XP_008242469.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Prunus 
mume]
Length=497

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSN-GTWCIASSTA  714
            LFNENRKPGL+SERNWGL +PDQTSVYNLDFTGKG+ DV T AN+TSSN  TWCIASS A
Sbjct  314  LFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKGSADVITQANVTSSNVTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE DL+NAL+WACG GNVDC+AIQPSQPCFEPDN V+HASFAFN+YYQQNGATDVACSFG
Sbjct  374  SELDLQNALDWACGPGNVDCTAIQPSQPCFEPDNTVAHASFAFNNYYQQNGATDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G G++ +KNPSYDNC+YM
Sbjct  434  GTGIKVDKNPSYDNCIYM  451



>ref|XP_007204831.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
 gb|EMJ06030.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
Length=497

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSN-GTWCIASSTA  714
            LFNENRKPGL+SERNWGL +PDQTSVYNLDFTGKG+ DV T AN+TSSN  TWCIASS A
Sbjct  314  LFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKGSADVITQANVTSSNVTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE DL+NAL+WACG GNVDC+AIQPSQPCFEPDN V+HASFAFN+YYQQNGATDVACSFG
Sbjct  374  SELDLQNALDWACGPGNVDCTAIQPSQPCFEPDNTVAHASFAFNNYYQQNGATDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G G++ +KNPSYDNC+YM
Sbjct  434  GTGIKVDKNPSYDNCIYM  451



>ref|XP_010049602.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Eucalyptus grandis]
 gb|KCW82303.1| hypothetical protein EUGRSUZ_C03710 [Eucalyptus grandis]
Length=500

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGL+SERNWGL +PD+TSVYNLDFTG+G+VDV TGAN+TSSNGT WCIAS+ A
Sbjct  314  LFNENRKPGLDSERNWGLFYPDETSVYNLDFTGRGSVDVITGANITSSNGTTWCIASANA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE +L+  L+WACGSGNVDCSAIQPSQPC+EPD LVSHASFAFN YYQQNGATDVACSFG
Sbjct  374  SEIELQKGLDWACGSGNVDCSAIQPSQPCYEPDTLVSHASFAFNGYYQQNGATDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G G++ +KNPSYD CLYM
Sbjct  434  GAGLKVDKNPSYDKCLYM  451



>ref|XP_006584807.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Glycine 
max]
Length=498

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVY+LDFTG+GAVD++T AN+T SNGT WCIASS A
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSVYSLDFTGRGAVDMTTEANITKSNGTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYD C+YM
Sbjct  434  GTGVKVDKDPSYDKCIYM  451



>gb|KHN16652.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=498

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVY+LDFTG+GAVD++T AN+T SNGT WCIASS A
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSVYSLDFTGRGAVDMTTEANITKSNGTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYD C+YM
Sbjct  434  GTGVKVDKDPSYDKCIYM  451



>ref|XP_008799775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Phoenix 
dactylifera]
Length=526

 Score =   247 bits (631),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PD+TSVY+LD TG+G VD  TGAN+TSSNGTWC+ASS AS
Sbjct  344  LFNENRKPGLESERNWGLFYPDRTSVYSLDLTGRGNVDGITGANITSSNGTWCVASSNAS  403

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NALNWACGSGNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGATDVACSFGG
Sbjct  404  ELDLQNALNWACGSGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGATDVACSFGG  463

Query  530  VGVRTNKNPSYDNCLY  483
             G+RT K+PSY+NC+Y
Sbjct  464  AGLRTRKDPSYENCIY  479



>gb|AET05176.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=480

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSN-GTWCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVYNLDFTG+GAVD++T AN+T SN  TWCIASS A
Sbjct  282  LFNENRKPGLESERNWGLFYPDQTSVYNLDFTGRGAVDMTTAANVTRSNRTTWCIASSKA  341

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE DL+NAL+WACG GNVDC+A+QPSQPCFEPDNL SHAS+ FNSYYQQNGA+DVACSFG
Sbjct  342  SEIDLQNALDWACGPGNVDCTAVQPSQPCFEPDNLASHASYVFNSYYQQNGASDVACSFG  401

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYDNC+YM
Sbjct  402  GTGVKIDKDPSYDNCIYM  419



>ref|XP_010924450.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Elaeis guineensis]
Length=496

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PDQTS+Y+LD TG+G VDV TGAN+TSSNGTWC+ASS AS
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSIYSLDLTGRGNVDVITGANITSSNGTWCVASSNAS  373

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NAL+WACG GNVDCSAIQPSQPC++PD L+SHAS+AFNSYYQQNGATDVACSFGG
Sbjct  374  ELDLQNALDWACGPGNVDCSAIQPSQPCYQPDTLLSHASYAFNSYYQQNGATDVACSFGG  433

Query  530  VGVRTNKNPSYDNCLY  483
             GV+  K+PSYD C+Y
Sbjct  434  TGVKITKDPSYDKCVY  449



>ref|XP_009394832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   244 bits (623),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PDQTSVY+LD+TG+G VD+ TGAN+TSSNGTWC+ASS AS
Sbjct  318  LFNENRKPGLESERNWGLFYPDQTSVYSLDWTGRGNVDIVTGANITSSNGTWCVASSNAS  377

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +ADL+NALNWACGSGNVDCSAIQPSQPC++PD L SHAS+AFN YYQQNGATDVAC+FGG
Sbjct  378  DADLQNALNWACGSGNVDCSAIQPSQPCYQPDTLASHASYAFNGYYQQNGATDVACNFGG  437

Query  530  VGVRTNKNPSYDNCLY  483
             G++T K+PSYD C+Y
Sbjct  438  TGLKTTKDPSYDACVY  453



>ref|XP_006580483.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Glycine max]
Length=499

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 126/137 (92%), Gaps = 1/137 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVY+LDFTG+GAVD++T AN+T SNGT WCIASS A
Sbjct  314  LFNENRKPGMESERNWGLFYPDQTSVYSLDFTGRGAVDMTTEANITRSNGTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLY  483
            G GV  +K+PSYDNC+Y
Sbjct  434  GTGVTVDKDPSYDNCIY  450



>ref|XP_011009861.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Populus euphratica]
Length=499

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVY+LDF+GKG +DV    +LTS NGT WCIAS+ A
Sbjct  315  LFNENRKPGMESERNWGLFYPDQTSVYSLDFSGKGVLDVPANKSLTSFNGTTWCIASNNA  374

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NAL+WACGSGNVDCSAIQPSQPCFEPD LVSHAS+AFNSYYQQNGA+DVACSFG
Sbjct  375  SQLDLQNALDWACGSGNVDCSAIQPSQPCFEPDTLVSHASYAFNSYYQQNGASDVACSFG  434

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ NK+PSYDNC+YM
Sbjct  435  GTGVKVNKDPSYDNCMYM  452



>ref|XP_004287489.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Fragaria vesca 
subsp. vesca]
Length=498

 Score =   241 bits (615),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 3/139 (2%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT--WCIASST  717
            LFNENRKPGLESERNWGL +PDQTSVYNLDFTGK AVD++T  N+TSSN T  WCIASS 
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSVYNLDFTGKNAVDMTTN-NVTSSNATTTWCIASSK  372

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASEADL+NAL+WACGSGNVDC+ IQPSQPCFEPDN VSHAS+AFN YYQQNGATD+ACSF
Sbjct  373  ASEADLQNALDWACGSGNVDCTPIQPSQPCFEPDNTVSHASYAFNVYYQQNGATDIACSF  432

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG G++ +KNPSYD+CLYM
Sbjct  433  GGSGIKVDKNPSYDSCLYM  451



>gb|KHG04832.1| hypothetical protein F383_29565 [Gossypium arboreum]
Length=512

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSN-GTWCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVYNLDFTGKG VDV+   N T+SN  TWCIASS A
Sbjct  313  LFNENRKPGLESERNWGLFYPDQTSVYNLDFTGKGIVDVTNSGNGTNSNVTTWCIASSKA  372

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SEADL+NAL+WACG GNVDCS IQPSQPCFEPDN +SHASFAFNSYYQQNGATDVACSFG
Sbjct  373  SEADLQNALDWACGPGNVDCSPIQPSQPCFEPDNTLSHASFAFNSYYQQNGATDVACSFG  432

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYDNC+Y+
Sbjct  433  GNGVKVDKDPSYDNCIYV  450



>ref|XP_012076842.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Jatropha 
curcas]
 gb|KDP33779.1| hypothetical protein JCGZ_07350 [Jatropha curcas]
Length=499

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTS+YNLDFTG+G +D+    NLTS N T WCIASS A
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSIYNLDFTGRGVIDIPKNTNLTSLNSTTWCIASSNA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL++AL+WACG GNVDCSAIQPSQPCFEPD L+SHAS+AFNSYYQQNGA+DVACSFG
Sbjct  374  SQLDLQSALDWACGPGNVDCSAIQPSQPCFEPDTLLSHASYAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYDNCLYM
Sbjct  434  GAGVKVDKDPSYDNCLYM  451



>gb|EYU30694.1| hypothetical protein MIMGU_mgv1a005031mg [Erythranthe guttata]
Length=500

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 5/142 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK---GAVDVSTGANLTS--SNGTWCIA  726
            LFNENRKPGLESERNWGL FPDQTSVYNLDFTG+   GAVD + G N T   +NGTWC+A
Sbjct  316  LFNENRKPGLESERNWGLFFPDQTSVYNLDFTGRSGGGAVDTTAGGNFTGGLNNGTWCVA  375

Query  725  SSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVA  546
            S+ ASE+DL N L+WACG GNVDCSAIQPSQPCFEPD+L SHAS+AFNSYYQQNGATD+A
Sbjct  376  SNNASESDLRNGLDWACGPGNVDCSAIQPSQPCFEPDSLASHASYAFNSYYQQNGATDIA  435

Query  545  CSFGGVGVRTNKNPSYDNCLYM  480
            C+FGG G RTNKNPSYDNC+YM
Sbjct  436  CTFGGAGFRTNKNPSYDNCMYM  457



>ref|XP_006451337.1| hypothetical protein CICLE_v10008080mg [Citrus clementina]
 ref|XP_006475345.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Citrus sinensis]
 gb|ESR64577.1| hypothetical protein CICLE_v10008080mg [Citrus clementina]
 gb|KDO55851.1| hypothetical protein CISIN_1g010782mg [Citrus sinensis]
Length=501

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 4/140 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT---WCIASS  720
            LFNENRKPGLESERNWGL +PDQTSVYNLDF+GKG VD+ T +N+TS NGT   WCIAS+
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSVYNLDFSGKGVVDM-TDSNVTSLNGTTTTWCIAST  372

Query  719  TASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACS  540
             ASEADL+NAL+WACG GNVDCSAIQPSQPC+EPD L+SHASFA NSYYQQNGATD+ACS
Sbjct  373  KASEADLQNALDWACGPGNVDCSAIQPSQPCYEPDTLLSHASFAINSYYQQNGATDIACS  432

Query  539  FGGVGVRTNKNPSYDNCLYM  480
            FGG GV+ +KNPSYDNC+YM
Sbjct  433  FGGNGVKVDKNPSYDNCVYM  452



>ref|XP_004969893.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Setaria 
italica]
Length=496

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPDQ+S+Y+LD+TG+G VDV TGAN+TS+NGTWCIAS+ AS
Sbjct  315  LFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDVMTGANITSANGTWCIASANAS  374

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA  VAC FGG
Sbjct  375  ETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANVVACDFGG  434

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD C+Y+
Sbjct  435  AGIRTTKDPSYDTCVYL  451



>ref|XP_006371969.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP49766.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=499

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVY+LDF+GKG +DV    +LTS NGT WCIAS+ A
Sbjct  315  LFNENRKPGMESERNWGLFYPDQTSVYSLDFSGKGVLDVPANKSLTSFNGTTWCIASNNA  374

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NAL+WACGSG+VDCSAIQPSQPCFEPD LVSHAS+AFNSYYQQNGA+DVACSFG
Sbjct  375  SQLDLQNALDWACGSGDVDCSAIQPSQPCFEPDTLVSHASYAFNSYYQQNGASDVACSFG  434

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ NK+PSYDNC+YM
Sbjct  435  GTGVKVNKDPSYDNCMYM  452



>gb|KJB27172.1| hypothetical protein B456_004G282300 [Gossypium raimondii]
Length=504

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PD+TS+YNLDFTGKG +D++   + + +  TWCIASS AS
Sbjct  314  LFNENRKPGLESERNWGLFYPDKTSIYNLDFTGKGVLDMTNSTDGSKNGTTWCIASSKAS  373

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            EADL+NA++WACG GNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+DVACSFGG
Sbjct  374  EADLQNAIDWACGPGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGASDVACSFGG  433

Query  530  VGVRTNKNPSYDNCLYM  480
             GV+ +K+PSYDNC+Y+
Sbjct  434  KGVKVDKDPSYDNCIYL  450



>gb|EAZ13481.1| hypothetical protein OsJ_03397 [Oryza sativa Japonica Group]
Length=474

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPDQ+S+Y+LD+TG+G VD+ TG N+T++NGTWC+AS+ AS
Sbjct  312  LFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDIMTGGNITNANGTWCVASANAS  371

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+N LNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA DVAC FGG
Sbjct  372  ETDLQNGLNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANDVACDFGG  431

Query  530  VGVRTNKNPSYDNCLYM  480
             GVRT K+PSYD C+YM
Sbjct  432  TGVRTTKDPSYDTCVYM  448



>gb|EEC71452.1| hypothetical protein OsI_03677 [Oryza sativa Indica Group]
Length=493

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPDQ+S+Y+LD+TG+G VD+ TG N+T++NGTWC+AS+ AS
Sbjct  312  LFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDIMTGGNITNANGTWCVASANAS  371

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+N LNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA DVAC FGG
Sbjct  372  ETDLQNGLNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANDVACDFGG  431

Query  530  VGVRTNKNPSYDNCLYM  480
             GVRT K+PSYD C+YM
Sbjct  432  TGVRTTKDPSYDTCVYM  448



>ref|NP_001044198.1| Os01g0739700 [Oryza sativa Japonica Group]
 dbj|BAD86947.1| putative elicitor inducible beta-1,3-glucanase NtEIG-E76 [Oryza 
sativa Japonica Group]
 dbj|BAF06112.1| Os01g0739700 [Oryza sativa Japonica Group]
 dbj|BAG88936.1| unnamed protein product [Oryza sativa Japonica Group]
Length=493

 Score =   238 bits (608),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPDQ+S+Y+LD+TG+G VD+ TG N+T++NGTWC+AS+ AS
Sbjct  312  LFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDIMTGGNITNANGTWCVASANAS  371

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+N LNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA DVAC FGG
Sbjct  372  ETDLQNGLNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANDVACDFGG  431

Query  530  VGVRTNKNPSYDNCLYM  480
             GVRT K+PSYD C+YM
Sbjct  432  TGVRTTKDPSYDTCVYM  448



>ref|XP_008672638.1| PREDICTED: uncharacterized protein LOC100278152 isoform X2 [Zea 
mays]
 gb|ACN28065.1| unknown [Zea mays]
 tpg|DAA57721.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
 tpg|DAA57722.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=496

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPD++S+Y+LD+TG+G VDV TGAN+TS+NGTWCIAS+ AS
Sbjct  315  LFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDVMTGANITSANGTWCIASTNAS  374

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA  VAC FGG
Sbjct  375  ETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANVVACDFGG  434

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD C+Y+
Sbjct  435  AGIRTTKDPSYDTCVYL  451



>dbj|BAJ85556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL  PDQ+S+Y++D+TG+G VD+ TG NLTSSNGTWC+AS+  S
Sbjct  315  LFNENRKPGIESERNWGLFSPDQSSIYSVDWTGRGNVDIMTGGNLTSSNGTWCVASTNVS  374

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGATDVAC FGG
Sbjct  375  ETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGATDVACGFGG  434

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD CLYM
Sbjct  435  AGMRTTKDPSYDTCLYM  451



>gb|KHG26459.1| hypothetical protein F383_04538 [Gossypium arboreum]
Length=488

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PD+TS+YNLDFTGKG +D++   + + +  TWCIASS AS
Sbjct  298  LFNENRKPGLESERNWGLFYPDKTSIYNLDFTGKGVLDMTNSTDGSKNGTTWCIASSKAS  357

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            EADL+NA++WACG GNVDCSAIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFGG
Sbjct  358  EADLQNAIDWACGPGNVDCSAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFGG  417

Query  530  VGVRTNKNPSYDNCLYM  480
             GV+ +K+PSYDNC+Y+
Sbjct  418  KGVKVDKDPSYDNCIYL  434



>ref|XP_006644680.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Oryza brachyantha]
Length=493

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPDQ+S+Y+LD+TG+G VD+ TG N+T++NGTWC+AS+ AS
Sbjct  312  LFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDIMTGGNITNANGTWCVASANAS  371

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+N LNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA DVAC FGG
Sbjct  372  ETDLQNGLNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANDVACDFGG  431

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD C+YM
Sbjct  432  TGMRTTKDPSYDTCVYM  448



>ref|XP_002456331.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
 gb|EES01451.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
Length=497

 Score =   236 bits (602),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPD++S+Y+LD+TG+G VDV TGAN+TS+NGTWCIAS+ AS
Sbjct  316  LFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDVMTGANITSANGTWCIASANAS  375

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA  VAC F G
Sbjct  376  ETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANVVACDFSG  435

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD C+Y+
Sbjct  436  AGIRTTKDPSYDTCVYL  452



>ref|XP_008450796.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=501

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGL+SERNWGL +PDQTSVYNLDFTGK  VD++  AN T+SNGT WCIASS A
Sbjct  317  LFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKSVVDMTAQANNTASNGTAWCIASSKA  376

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NAL+WACGSGNVDC+ IQPSQPCFEPD L+SHAS+AFNSY+QQNGATDVAC FG
Sbjct  377  SDMDLQNALDWACGSGNVDCTPIQPSQPCFEPDTLLSHASYAFNSYFQQNGATDVACGFG  436

Query  533  GVGVRTNKNPSYDNCLY  483
            G GVR N++PSYDNCLY
Sbjct  437  GNGVRVNQDPSYDNCLY  453



>ref|XP_010110871.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
 gb|EXC28690.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
Length=1369

 Score =   245 bits (626),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVYNLDFTG+G+VD++TGAN TS NGT WCIAS+ +
Sbjct  816  LFNENRKPGLESERNWGLFYPDQTSVYNLDFTGRGSVDIATGANSTSLNGTTWCIASNKS  875

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
             E DL+NAL+WACGSGNVDC+AIQPSQPCFEPDNL SHAS+AFNS+YQQNG TDVACSFG
Sbjct  876  LEMDLQNALDWACGSGNVDCTAIQPSQPCFEPDNLASHASYAFNSFYQQNGVTDVACSFG  935

Query  533  GVGVRTNKNPSYDNCLYM  480
            G G+R +++PSYD+C+YM
Sbjct  936  GAGIRVDRDPSYDSCIYM  953



>gb|KJB65051.1| hypothetical protein B456_010G078300 [Gossypium raimondii]
Length=506

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSN-GTWCIASSTA  714
            LFNENRKPG ESERNWGL +PDQTSVYNLDFTG G VDV+   N T+SN  TWCIASS A
Sbjct  314  LFNENRKPGPESERNWGLFYPDQTSVYNLDFTGNGIVDVTNSGNGTNSNVTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SEADL+NAL+WACG GNVDCS IQPSQPCFEPDN +SHASFAFNSYYQQNGATDVACSFG
Sbjct  374  SEADLQNALDWACGPGNVDCSPIQPSQPCFEPDNTLSHASFAFNSYYQQNGATDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ +K+PSYDNC+Y+
Sbjct  434  GNGVKVDKDPSYDNCIYV  451



>ref|XP_007012991.1| O-Glycosyl hydrolases family 17 protein isoform 3 [Theobroma 
cacao]
 gb|EOY30610.1| O-Glycosyl hydrolases family 17 protein isoform 3 [Theobroma 
cacao]
Length=460

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVYNLDFTGKGAVD++   N T SNGT WCIASS A
Sbjct  314  LFNENRKPGMESERNWGLFYPDQTSVYNLDFTGKGAVDMTNSGNGTKSNGTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPS  501
            G GV+ +K+PS
Sbjct  434  GNGVKVDKDPS  444



>gb|ACU24280.1| unknown [Glycine max]
Length=321

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVY+LDFTG+GAVD++T AN+T SNGT WCIASS A
Sbjct  180  LFNENRKPGMESERNWGLFYPDQTSVYSLDFTGRGAVDMTTEANITRSNGTTWCIASSKA  239

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFG
Sbjct  240  SQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFG  299

Query  533  GVGVRTNKNPS  501
            G GV  +K+PS
Sbjct  300  GTGVTVDKDPS  310



>ref|XP_007012993.1| O-Glycosyl hydrolases family 17 protein isoform 5 [Theobroma 
cacao]
 gb|EOY30612.1| O-Glycosyl hydrolases family 17 protein isoform 5 [Theobroma 
cacao]
Length=400

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 120/130 (92%), Gaps = 1/130 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVYNLDFTGKGAVD++   N T SNGT WCIASS A
Sbjct  239  LFNENRKPGMESERNWGLFYPDQTSVYNLDFTGKGAVDMTNSGNGTKSNGTTWCIASSKA  298

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+DVACSFG
Sbjct  299  SESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGASDVACSFG  358

Query  533  GVGVRTNKNP  504
            G GV+ +K+P
Sbjct  359  GNGVKVDKDP  368



>ref|XP_002514201.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF48155.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=511

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT--WCIASST  717
            LFNENRKPGLESERNWGL +P  TSVY LDFTG+G VDV    ++T  NGT  WCIAS+ 
Sbjct  314  LFNENRKPGLESERNWGLFYPGGTSVYTLDFTGRGVVDVPKNTSITGFNGTTTWCIASNN  373

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            AS+ DL+NAL+WACGSGNVDCSAIQPSQPCFEPD LVSHASFAFN YYQQNGATDVACSF
Sbjct  374  ASQLDLQNALDWACGSGNVDCSAIQPSQPCFEPDTLVSHASFAFNGYYQQNGATDVACSF  433

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GV+ +K+PSYDNCLYM
Sbjct  434  GGTGVKVDKDPSYDNCLYM  452



>ref|XP_008672637.1| PREDICTED: uncharacterized protein LOC100278152 isoform X1 [Zea 
mays]
Length=653

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPD++S+Y+LD+TG+G VDV TGAN+TS+NGTWCIAS+ AS
Sbjct  472  LFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDVMTGANITSANGTWCIASTNAS  531

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA  VAC FGG
Sbjct  532  ETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANVVACDFGG  591

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD C+Y+
Sbjct  592  AGIRTTKDPSYDTCVYL  608



>ref|XP_003569762.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Brachypodium 
distachyon]
Length=498

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL  PDQ+S+Y+LD++G+G VD+ TG NLT+SNGTWC+AS+  S
Sbjct  317  LFNENRKPGIESERNWGLFSPDQSSIYSLDWSGRGNVDIMTGGNLTNSNGTWCVASTNVS  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGA DVAC FGG
Sbjct  377  ETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGANDVACGFGG  436

Query  530  VGVRTNKNPSYDNCLYM  480
             GVRT K+PSYD C+YM
Sbjct  437  AGVRTTKDPSYDTCVYM  453



>ref|XP_010232285.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Brachypodium 
distachyon]
Length=497

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL  PDQ+S+Y+LD++G+G VD+ TG NLT+SNGTWC+AS+  S
Sbjct  317  LFNENRKPGIESERNWGLFSPDQSSIYSLDWSGRGNVDIMTGGNLTNSNGTWCVASTNVS  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGA DVAC FGG
Sbjct  377  ETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGANDVACGFGG  436

Query  530  VGVRTNKNPSYDNCLYM  480
             GVRT K+PSYD C+YM
Sbjct  437  AGVRTTKDPSYDTCVYM  453



>ref|XP_004135678.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis sativus]
 gb|KGN66191.1| hypothetical protein Csa_1G575070 [Cucumis sativus]
Length=501

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPGL+SERNWGL +PDQTSVYNLDFTGK  VD++  AN T+SNGT WCIAS+ A
Sbjct  317  LFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKSVVDMTAQANSTASNGTAWCIASTKA  376

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NAL+WACGSGNVDC+ IQPSQPCFEPD LVSHAS+AFNSY+QQNGATDVAC FG
Sbjct  377  SDMDLQNALDWACGSGNVDCTPIQPSQPCFEPDTLVSHASYAFNSYFQQNGATDVACGFG  436

Query  533  GVGVRTNKNPSYDNCLY  483
            G GV+ N++PSYD CLY
Sbjct  437  GNGVKVNQDPSYDTCLY  453



>ref|XP_007012992.1| O-Glycosyl hydrolases family 17 protein isoform 4 [Theobroma 
cacao]
 gb|EOY30611.1| O-Glycosyl hydrolases family 17 protein isoform 4 [Theobroma 
cacao]
Length=475

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 120/130 (92%), Gaps = 1/130 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVYNLDFTGKGAVD++   N T SNGT WCIASS A
Sbjct  314  LFNENRKPGMESERNWGLFYPDQTSVYNLDFTGKGAVDMTNSGNGTKSNGTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE+DL+NAL+WACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNP  504
            G GV+ +K+P
Sbjct  434  GNGVKVDKDP  443



>ref|XP_003620800.1| Glucan endo-1,3-beta-glucosidase, partial [Medicago truncatula]
Length=411

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTS--SNGT-WCIASS  720
            LFNENRKPGLESERNWG+ +PD T+VY+LDFTG+G VD++  AN TS  SNGT WCIASS
Sbjct  219  LFNENRKPGLESERNWGIVYPDLTNVYSLDFTGRGPVDMTADANATSPTSNGTKWCIASS  278

Query  719  TASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVAC  543
             A++ DL+NA+NWACG SGNVDC+AIQPSQPCFEPDNLVSHAS+AFNSYYQQNGA+DVAC
Sbjct  279  NATQLDLQNAINWACGTSGNVDCTAIQPSQPCFEPDNLVSHASYAFNSYYQQNGASDVAC  338

Query  542  SFGGVGVRTNKNPSYDNCLYM  480
            SFGG GV  +K+P+YDNC+YM
Sbjct  339  SFGGTGVLVDKDPTYDNCIYM  359



>ref|XP_009394833.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=469

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PDQTSVY+LD+TG+G VD+ TGAN+TSSNGTWC+ASS AS
Sbjct  318  LFNENRKPGLESERNWGLFYPDQTSVYSLDWTGRGNVDIVTGANITSSNGTWCVASSNAS  377

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +ADL+NALNWACGSGNVDCSAIQPSQPC++PD L SHAS+AFN YYQQNGATDVAC+FGG
Sbjct  378  DADLQNALNWACGSGNVDCSAIQPSQPCYQPDTLASHASYAFNGYYQQNGATDVACNFGG  437

Query  530  VGVRTNKNP  504
             G++T K+P
Sbjct  438  TGLKTTKDP  446



>ref|XP_003630700.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=492

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSN-GTWCIASSTA  714
            LFNENRKPGLESERNWGL +PDQTSVYNLDFTG+GAVD++T AN+T SN  TWCIASS A
Sbjct  282  LFNENRKPGLESERNWGLFYPDQTSVYNLDFTGRGAVDMTTAANVTRSNRTTWCIASSKA  341

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE DL+NAL+WACG GNVDC+A+QPSQPCFEPDNL SHAS+ FNSYYQQNGA+DVACSFG
Sbjct  342  SEIDLQNALDWACGPGNVDCTAVQPSQPCFEPDNLASHASYVFNSYYQQNGASDVACSFG  401

Query  533  GVGVRTNKNPS  501
            G GV+ +K+PS
Sbjct  402  GTGVKIDKDPS  412



>gb|KHM99816.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=455

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRKPG+ESERNWGL +PDQTSVY+LDFTG+GAVD++T AN+T SNGT WCIASS A
Sbjct  314  LFNENRKPGMESERNWGLFYPDQTSVYSLDFTGRGAVDMTTEANITRSNGTTWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DL+NA++WACG GNVDC+AIQPSQPCFEPDNL SHASFAFNSYYQQNGA+DVACSFG
Sbjct  374  SQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQNGASDVACSFG  433

Query  533  GVGVRTNKNPS  501
            G GV  +K+PS
Sbjct  434  GTGVTVDKDPS  444



>gb|KEH27229.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=507

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTS--SNGT-WCIASS  720
            LFNENRKPGLESERNWG+ +PD T+VY+LDFTG+G VD++  AN TS  SNGT WCIASS
Sbjct  315  LFNENRKPGLESERNWGIVYPDLTNVYSLDFTGRGPVDMTADANATSPTSNGTKWCIASS  374

Query  719  TASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVAC  543
             A++ DL+NA+NWACG SGNVDC+AIQPSQPCFEPDNLVSHAS+AFNSYYQQNGA+DVAC
Sbjct  375  NATQLDLQNAINWACGTSGNVDCTAIQPSQPCFEPDNLVSHASYAFNSYYQQNGASDVAC  434

Query  542  SFGGVGVRTNKNPSYDNCLYM  480
            SFGG GV  +K+P+YDNC+YM
Sbjct  435  SFGGTGVLVDKDPTYDNCIYM  455



>gb|ABD91577.1| beta-1,3-glucanase [Medicago sativa]
Length=507

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSS--NGT-WCIASS  720
            LFNENRKPGLESERNWG+ +PD T+VY+LDFTG+G VD++  AN TSS  NGT WCIASS
Sbjct  315  LFNENRKPGLESERNWGIVYPDLTNVYSLDFTGRGPVDMTADANATSSTSNGTKWCIASS  374

Query  719  TASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVAC  543
             A++ DL+NA+NWACG SGNVDC+AIQPSQPCFEPDNLVSHAS+AFNSYYQQNGA+DVAC
Sbjct  375  NATQLDLQNAINWACGTSGNVDCTAIQPSQPCFEPDNLVSHASYAFNSYYQQNGASDVAC  434

Query  542  SFGGVGVRTNKNPSYDNCLYM  480
            SFGG GV  +K+P+YDNC+YM
Sbjct  435  SFGGTGVLVDKDPTYDNCIYM  455



>gb|ABD91576.1| beta-1,3-glucanase [Medicago sativa]
Length=507

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSS--NGT-WCIASS  720
            LFNENRKPGLESERNWG+ +PD T+VY+LDFTG+G VD++  AN TSS  NGT WCIASS
Sbjct  315  LFNENRKPGLESERNWGIVYPDLTNVYSLDFTGRGPVDMTADANATSSTSNGTKWCIASS  374

Query  719  TASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVAC  543
             A++ DL+NA+NWACG SGNVDC+AIQPSQPCFEPDNLVSHAS+AFNSYYQQNGA+DVAC
Sbjct  375  NATQLDLQNAINWACGTSGNVDCTAIQPSQPCFEPDNLVSHASYAFNSYYQQNGASDVAC  434

Query  542  SFGGVGVRTNKNPSYDNCLYM  480
            SFGG GV  +K+P+YDNC+YM
Sbjct  435  SFGGTGVLVDKDPTYDNCIYM  455



>ref|XP_004513066.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cicer arietinum]
Length=506

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 4/140 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT---WCIASS  720
            LFNENRKPGLESERNWGL +PDQTSVY+LDFTG+  VD++  AN T SNGT   WCIASS
Sbjct  315  LFNENRKPGLESERNWGLFYPDQTSVYSLDFTGRSPVDMNADANATRSNGTTTTWCIASS  374

Query  719  TASEADLENALNWACG-SGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVAC  543
             A++ DL+NA+NWACG SGNVDC+AIQPSQPCF+PDNLVSHAS+AFNSYYQQNGA+DVAC
Sbjct  375  KATQMDLQNAINWACGTSGNVDCTAIQPSQPCFQPDNLVSHASYAFNSYYQQNGASDVAC  434

Query  542  SFGGVGVRTNKNPSYDNCLY  483
            SFGG GV  +K+P+YD+C+Y
Sbjct  435  SFGGTGVIVDKDPTYDDCIY  454



>ref|NP_001144992.1| uncharacterized protein LOC100278152 precursor [Zea mays]
 gb|ACG44298.1| hypothetical protein [Zea mays]
Length=477

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL FPD++S+Y+LD+TG+G VDV TGAN+TS+NGTWCIAS+ AS
Sbjct  315  LFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDVMTGANITSANGTWCIASTNAS  374

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E DL+NALNWACG GNVDCSAIQPSQPC++PD L SHAS+AFNSYYQQNGA  VAC FGG
Sbjct  375  ETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLTSHASYAFNSYYQQNGANVVACDFGG  434

Query  530  VGVRTNKNPSYDNCLY  483
             G+RT K+PS    L+
Sbjct  435  AGIRTTKDPSKSPILF  450



>emb|CDM84006.1| unnamed protein product [Triticum aestivum]
Length=494

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL  PDQ+S+Y++D+TG+G VD+ TG N   SNGTWC+AS+  S
Sbjct  315  LFNENRKPGIESERNWGLFSPDQSSIYSIDWTGRGNVDIMTGGN--RSNGTWCVASTNVS  372

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGATDVAC FGG
Sbjct  373  ETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGATDVACGFGG  432

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD C+YM
Sbjct  433  AGMRTTKDPSYDTCVYM  449



>gb|EMS49856.1| Glucan endo-1,3-beta-glucosidase 13 [Triticum urartu]
Length=494

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL  PDQ+S+Y++D+TG+G VD+ TG N   SNGTWC+AS+  S
Sbjct  315  LFNENRKPGIESERNWGLFSPDQSSIYSIDWTGRGNVDIMTGGN--RSNGTWCVASTNVS  372

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGATDVAC FGG
Sbjct  373  ETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGATDVACGFGG  432

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD C+YM
Sbjct  433  AGMRTTKDPSYDTCVYM  449



>gb|EMT15518.1| Glucan endo-1,3-beta-glucosidase 13 [Aegilops tauschii]
Length=530

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPG+ESERNWGL  PDQ+S+Y++D+TG+G VD+ TG N   SNGTWC+AS+  S
Sbjct  315  LFNENRKPGIESERNWGLFSPDQSSIYSIDWTGRGNVDIMTGGN--RSNGTWCVASTNVS  372

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L+N LNWACG GNVDCSAIQPSQPC++PD LVSHAS+AFNSYYQQNGATDVAC FGG
Sbjct  373  ETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGATDVACGFGG  432

Query  530  VGVRTNKNPSYDNCLYM  480
             G+RT K+PSYD C+YM
Sbjct  433  AGMRTTKDPSYDTCVYM  449



>gb|KJB27173.1| hypothetical protein B456_004G282300 [Gossypium raimondii]
Length=481

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNENRKPGLESERNWGL +PD+TS+YNLDFTGKG +D++   + + +  TWCIASS AS
Sbjct  314  LFNENRKPGLESERNWGLFYPDKTSIYNLDFTGKGVLDMTNSTDGSKNGTTWCIASSKAS  373

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            EADL+NA++WACG GNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA+DVACSFGG
Sbjct  374  EADLQNAIDWACGPGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGASDVACSFGG  433

Query  530  VGVRTNKNPS  501
             GV+ +K+PS
Sbjct  434  KGVKVDKDPS  443



>gb|KDO55852.1| hypothetical protein CISIN_1g010782mg [Citrus sinensis]
Length=446

 Score =   224 bits (571),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 4/133 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT---WCIASS  720
            LFNENRKPGLESERNWGL +PDQTSVYNLDF+GKG VD+ T +N+TS NGT   WCIAS+
Sbjct  314  LFNENRKPGLESERNWGLFYPDQTSVYNLDFSGKGVVDM-TDSNVTSLNGTTTTWCIAST  372

Query  719  TASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACS  540
             ASEADL+NAL+WACG GNVDCSAIQPSQPC+EPD L+SHASFA NSYYQQNGATD+ACS
Sbjct  373  KASEADLQNALDWACGPGNVDCSAIQPSQPCYEPDTLLSHASFAINSYYQQNGATDIACS  432

Query  539  FGGVGVRTNKNPS  501
            FGG GV+ +KNPS
Sbjct  433  FGGNGVKVDKNPS  445



>gb|EPS73640.1| hypothetical protein M569_01113 [Genlisea aurea]
Length=508

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGAN-LTSSNGT-WCIASST  717
            LFNENRKPGL+SERNWG+ FPDQTSVYNLDFTG+G V     AN  T SNGT WCIA   
Sbjct  314  LFNENRKPGLDSERNWGVFFPDQTSVYNLDFTGRGVVARPPDANNTTISNGTSWCIAVMG  373

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASEADL++ L+WACGSGNVDC+ IQP QPCFEPDNL SHAS+AFNSYYQQNGA++VAC+F
Sbjct  374  ASEADLQHGLDWACGSGNVDCTPIQPKQPCFEPDNLASHASYAFNSYYQQNGASEVACAF  433

Query  536  GGVGVRTNKNPSYDNCLY  483
            GG G RT+KNPSYD+C+Y
Sbjct  434  GGAGFRTSKNPSYDSCIY  451



>ref|XP_010545323.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=501

 Score =   218 bits (555),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT-WCIASSTA  714
            LFNENRK GL+SERNWGL +PDQTSVY+LDFTGK  +  S+ +++T+S+GT WCIASS A
Sbjct  314  LFNENRKSGLDSERNWGLFYPDQTSVYHLDFTGKNNLIPSSNSSVTNSSGTSWCIASSKA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            SE DL +AL+WACG GNVDC+AIQPSQPCFEPD LVSHASF FNSY+QQNGATDVACSFG
Sbjct  374  SEKDLRSALDWACGPGNVDCTAIQPSQPCFEPDTLVSHASFVFNSYFQQNGATDVACSFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G GV+ NK+PSYDNCLY+
Sbjct  434  GAGVKVNKDPSYDNCLYV  451



>ref|XP_010688353.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLT-SSNGTWCIASSTA  714
            LFNENRKPG+ESERNWGL +P  TSVYNLDFTGK   ++++G N T ++  TWCIASS A
Sbjct  314  LFNENRKPGMESERNWGLFYPGGTSVYNLDFTGKSVTEMASGVNGTNTTEPTWCIASSNA  373

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            +E DL NALNWACG GNVDC+ IQPSQPC+EP+  VSHASFAFNSYYQQNGATD+AC FG
Sbjct  374  TEEDLNNALNWACGPGNVDCTPIQPSQPCYEPNTPVSHASFAFNSYYQQNGATDIACGFG  433

Query  533  GVGVRTNKNPSYDNCLYM  480
            G G++  K+PSYD CLY+
Sbjct  434  GAGLKVAKDPSYDKCLYL  451



>ref|XP_010483135.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Camelina sativa]
Length=509

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK--GAVDVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK  G    S+G N   ++ +WCIASS 
Sbjct  319  LFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSRGNSNSWCIASSK  378

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PDNLVSHASF FNSY+QQN ATDVACSF
Sbjct  379  ASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQNRATDVACSF  438

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GV+ NK+PSYD C+Y+
Sbjct  439  GGAGVKVNKDPSYDKCIYI  457



>ref|XP_009120169.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Brassica rapa]
Length=503

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK--GAVDVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK  G    S+G N    + +WCIASS 
Sbjct  313  LFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKNGGFRSNSSGGNSRGRSESWCIASSK  372

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE +L  AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQNG TDVACSF
Sbjct  373  ASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNGGTDVACSF  432

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GGVGV+ NK+PSYD C+Y+
Sbjct  433  GGVGVKVNKDPSYDKCVYI  451



>emb|CDY32869.1| BnaC09g33160D [Brassica napus]
Length=503

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK--GAVDVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK  G    S+G N    + +WCIASS 
Sbjct  313  LFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKNGGFRSNSSGGNSRGRSESWCIASSK  372

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE +L  AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQNG TDVACSF
Sbjct  373  ASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNGGTDVACSF  432

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GGVGV+ NK+PSYD C+Y+
Sbjct  433  GGVGVKVNKDPSYDKCVYI  451



>emb|CDY64970.1| BnaAnng19910D [Brassica napus]
Length=503

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK--GAVDVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK  G    S G N    + +WCIASS 
Sbjct  313  LFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKNGGFRGNSRGGNSRGRSESWCIASSK  372

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE +L  AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQNG TDVACSF
Sbjct  373  ASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNGGTDVACSF  432

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GGVGV+ NK+PSYD C+Y+
Sbjct  433  GGVGVKVNKDPSYDKCVYI  451



>ref|XP_011626761.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Amborella trichopoda]
Length=491

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 7/139 (5%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKG---AVDVSTGANLTSSNGTWCIASS  720
            LFNENRKPGL+SERNWG+ +P QTSVYNLDF+G+     V+VS G      NG+WCIAS 
Sbjct  313  LFNENRKPGLDSERNWGVFYPGQTSVYNLDFSGREGGLVVNVSAGGG----NGSWCIASP  368

Query  719  TASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACS  540
             ASE DL+NAL+WACGSGNVDCSAIQPSQ CF+PD L SHAS+AFNSYYQQNGA+ +AC 
Sbjct  369  NASERDLKNALDWACGSGNVDCSAIQPSQACFQPDTLASHASYAFNSYYQQNGASTIACD  428

Query  539  FGGVGVRTNKNPSYDNCLY  483
            FGG G+ T KNPSYDNCLY
Sbjct  429  FGGTGMITTKNPSYDNCLY  447



>ref|XP_010446151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Camelina 
sativa]
Length=473

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK--GAVDVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK  G    S+G N + ++ +WCIASS 
Sbjct  319  LFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGNSNSWCIASSK  378

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PDNLVSHASF FNSY+QQN ATDVACSF
Sbjct  379  ASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQNRATDVACSF  438

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GV+ NK+PSYD C+Y+
Sbjct  439  GGAGVKVNKDPSYDKCIYI  457



>ref|XP_010476823.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Camelina 
sativa]
Length=503

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK--GAVDVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK  G    S+G N + ++ +WCIASS 
Sbjct  319  LFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGNSNSWCIASSK  378

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PDNLVSHASF FNSY+QQN ATDVACSF
Sbjct  379  ASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQNRATDVACSF  438

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GV+ NK+PSYD C+Y+
Sbjct  439  GGAGVKVNKDPSYDKCIYI  457



>gb|ERN15184.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
Length=548

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 7/139 (5%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKG---AVDVSTGANLTSSNGTWCIASS  720
            LFNENRKPGL+SERNWG+ +P QTSVYNLDF+G+     V+VS G      NG+WCIAS 
Sbjct  303  LFNENRKPGLDSERNWGVFYPGQTSVYNLDFSGREGGLVVNVSAGGG----NGSWCIASP  358

Query  719  TASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACS  540
             ASE DL+NAL+WACGSGNVDCSAIQPSQ CF+PD L SHAS+AFNSYYQQNGA+ +AC 
Sbjct  359  NASERDLKNALDWACGSGNVDCSAIQPSQACFQPDTLASHASYAFNSYYQQNGASTIACD  418

Query  539  FGGVGVRTNKNPSYDNCLY  483
            FGG G+ T KNPSYDNCLY
Sbjct  419  FGGTGMITTKNPSYDNCLY  437



>ref|XP_006280336.1| hypothetical protein CARUB_v10026261mg [Capsella rubella]
 gb|EOA13234.1| hypothetical protein CARUB_v10026261mg [Capsella rubella]
Length=508

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAV--DVSTGANLTSSNGTWCIASST  717
            LFNENRK GLESERNWGL +PDQTSVY LDFTGK       S+G N + ++ +WCIASS 
Sbjct  318  LFNENRKTGLESERNWGLFYPDQTSVYQLDFTGKSNAFHSNSSGTNSSGNSNSWCIASSK  377

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQN ATDVACSF
Sbjct  378  ASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRATDVACSF  437

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GV+ NK+PSYD C+Y+
Sbjct  438  GGAGVKVNKDPSYDKCIYI  456



>ref|XP_002864470.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40729.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK--GAVDVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK  G    S+G N + S+ +WCIASS 
Sbjct  316  LFNENRKAGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGSSNSWCIASSK  375

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQN ATDVACSF
Sbjct  376  ASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRATDVACSF  435

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GV+ NK+PSYD C+Y+
Sbjct  436  GGAGVKVNKDPSYDKCIYI  454



>ref|NP_200470.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|Q9FJU9.1|E1313_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 13; AltName: Full=(1->3)-beta-glucan 
endohydrolase 13; Short=(1->3)-beta-glucanase 
13; AltName: Full=Beta-1,3-endoglucanase 13; Short=Beta-1,3-glucanase 
13; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09876.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAL91612.1| AT5g56590/MIK19_3 [Arabidopsis thaliana]
 gb|AAM91467.1| AT5g56590/MIK19_3 [Arabidopsis thaliana]
 gb|AED96784.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=506

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGK--GAVDVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK  G    S+G N + S+ +WCIASS 
Sbjct  316  LFNENRKAGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGSSNSWCIASSK  375

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+QQN ATDVACSF
Sbjct  376  ASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRATDVACSF  435

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GV+ NK+PSYD C+Y+
Sbjct  436  GGAGVKVNKDPSYDKCIYI  454



>ref|XP_006401304.1| hypothetical protein EUTSA_v10013309mg [Eutrema salsugineum]
 gb|ESQ42757.1| hypothetical protein EUTSA_v10013309mg [Eutrema salsugineum]
Length=506

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAV--DVSTGANLTSSNGTWCIASST  717
            LFNENRK GL+SERNWGL +PDQTSVY LDFTGK +V    S+G N + S  +WCIASS 
Sbjct  316  LFNENRKSGLDSERNWGLFYPDQTSVYQLDFTGKNSVLRSNSSGTNSSGSGNSWCIASSK  375

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            ASE DL+ AL+WACG GNVDC+AIQPSQPCF+PD LVSHASF FNSY+Q N ATDVACSF
Sbjct  376  ASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQLNRATDVACSF  435

Query  536  GGVGVRTNKNPSYDNCLYM  480
            GG GV+ NK+PSYD C+Y+
Sbjct  436  GGAGVKVNKDPSYDKCIYI  454



>ref|XP_010541008.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=535

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 114/158 (72%), Gaps = 21/158 (13%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT---------  738
            LFNENRKPG+ESERNWGL +P+ +S+Y LDFTGK    +    N +SS  T         
Sbjct  316  LFNENRKPGIESERNWGLYYPNGSSIYKLDFTGKDTTAIVPPTNSSSSGPTNPTPPGGGI  375

Query  737  ------------WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHAS  594
                        WCIASS ASE DL++ L+WACG GNVDCSAIQ SQPCFEPD ++SHAS
Sbjct  376  GTNITTIGSAKRWCIASSQASETDLQSGLDWACGPGNVDCSAIQESQPCFEPDTVLSHAS  435

Query  593  FAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            +AFN+Y+QQNGATD+AC+F G+GV  +++PSYDNCLYM
Sbjct  436  YAFNTYFQQNGATDIACNFSGIGVLIDRDPSYDNCLYM  473



>emb|CDY14214.1| BnaA08g13450D [Brassica napus]
Length=513

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVD-VSTGANLTSSNGTWCIASSTA  714
            LFNENRKPG+ESERNWG+ + + TSVY LDFTG+  V    + +N T+    WC+ASS A
Sbjct  315  LFNENRKPGMESERNWGMFYANGTSVYALDFTGESTVPGPVSPSNSTTGAKKWCVASSQA  374

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S  +L++AL+WACG GNVDCSA+QP+Q CFEPD ++SHAS+AFN+YYQQ+G + + CSFG
Sbjct  375  SVTELQSALDWACGPGNVDCSAVQPNQLCFEPDTVLSHASYAFNTYYQQSGGSSLDCSFG  434

Query  533  GVGVRTNKNPSYDNCLYM  480
            GV V  +K+PSY NCLYM
Sbjct  435  GVSVEVDKDPSYGNCLYM  452



>emb|CDY62033.1| BnaC03g77660D [Brassica napus]
Length=533

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 21/158 (13%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAV-------DVSTG--------ANL  756
            LFNENRKPG+ESERNWG+ + + TSVY LDFTG+ AV       + +TG        +N 
Sbjct  315  LFNENRKPGMESERNWGMFYANGTSVYALDFTGESAVPGPVSPTNTTTGVSPNPGDKSNS  374

Query  755  TSSNG------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHAS  594
            T + G       WC+ASS AS  +L++AL+WACG GNVDCSA+QP+QPCFEPD ++SHAS
Sbjct  375  TVTIGGGGGAKKWCVASSRASVTELQSALDWACGPGNVDCSAVQPNQPCFEPDTVLSHAS  434

Query  593  FAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            +AFN+YYQQ+G + + CSFGGV V  +K+PSY NCLYM
Sbjct  435  YAFNTYYQQSGGSSLDCSFGGVSVEVDKDPSYGNCLYM  472



>ref|XP_009109043.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Brassica 
rapa]
Length=534

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 22/159 (14%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAV-------DVSTGANLTSSN----  744
            LFNENRKPG+ESERNWG+ + + TSVY LDFTG+ AV       + +TG + +  +    
Sbjct  315  LFNENRKPGMESERNWGMFYANGTSVYALDFTGESAVPGPVSPSNSTTGVSPSPGDNGNS  374

Query  743  -----------GTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHA  597
                         WC+ASS AS  +L++AL+WACG GNVDCSA+QP+QPCFEPD ++SHA
Sbjct  375  TVTIGGGGGGAKKWCVASSQASVTELQSALDWACGPGNVDCSAVQPNQPCFEPDTVLSHA  434

Query  596  SFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            S+AFN+YYQQ+G + + CSFGGV V  +K+PSY NCLYM
Sbjct  435  SYAFNTYYQQSGGSSLDCSFGGVSVEVDKDPSYGNCLYM  473



>emb|CDY06818.1| BnaC01g09170D [Brassica napus]
Length=502

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 108/158 (68%), Gaps = 21/158 (13%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNG----------  741
            LFNENRKPG+ESERNWG+ + + TSVY LDFTG+  V VS   +  +S G          
Sbjct  285  LFNENRKPGIESERNWGMFYANGTSVYALDFTGESTVPVSPSNSSATSPGPSSSPGNSTV  344

Query  740  -----------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHAS  594
                        WC+AS+ AS  +L+ AL+W CG G+VDCSA+QP+QPCFEPD ++SHAS
Sbjct  345  IIGGGGGGGTRKWCVASTQASVTELQTALDWTCGPGSVDCSAVQPNQPCFEPDTVLSHAS  404

Query  593  FAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            +AFN+YYQQ+GA    CSFGGV V  +K+PSY NCLYM
Sbjct  405  YAFNTYYQQSGANSSDCSFGGVSVEVDKDPSYGNCLYM  442



>ref|XP_006412850.1| hypothetical protein EUTSA_v10024870mg [Eutrema salsugineum]
 gb|ESQ54303.1| hypothetical protein EUTSA_v10024870mg [Eutrema salsugineum]
Length=539

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 108/165 (65%), Gaps = 28/165 (17%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGA------------------------  783
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+ +                        
Sbjct  315  LFNENRKPGIESERNWGMFYANGTNVYALDFTGESSATVSPTNSTTGTTSPSPSSSPGNN  374

Query  782  ----VDVSTGANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPD  615
                V +  G         WCIASS AS  DL++AL+WACG GNVDCSA+QP+QPCFEPD
Sbjct  375  GNSTVIIGGGGGGGGGTKKWCIASSQASVTDLQSALDWACGPGNVDCSAVQPNQPCFEPD  434

Query  614  NLVSHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
             + SHAS+AFN+YYQQ+GA+ + CSFGGV V  +K+PSY NCLYM
Sbjct  435  TVQSHASYAFNTYYQQSGASSLDCSFGGVSVEVDKDPSYGNCLYM  479



>gb|KFK29497.1| hypothetical protein AALP_AA7G142000 [Arabis alpina]
Length=535

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 106/161 (66%), Gaps = 24/161 (15%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVS--------------------  771
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+    VS                    
Sbjct  315  LFNENRKPGIESERNWGMFYANGTTVYALDFTGESTTLVSPTNSTTGTSPSPSSSPGNNG  374

Query  770  ----TGANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVS  603
                           WCIAS+ AS  +L+ AL+WACG GNVDCSA+QP+QPCF+PD ++S
Sbjct  375  NSTVIIGGGGGGTKKWCIASTQASVTELQTALDWACGPGNVDCSAVQPNQPCFDPDTVLS  434

Query  602  HASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            HAS+AFN+YYQQ+GA+ + CSFGGV V  +K+PSY NCLYM
Sbjct  435  HASYAFNTYYQQSGASSLDCSFGGVSVEVDKDPSYGNCLYM  475



>emb|CAB79694.1| beta-1, 3-glucanase-like protein [Arabidopsis thaliana]
Length=512

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 109/162 (67%), Gaps = 25/162 (15%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVS------------TGANLTSS  747
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+    VS            + + + + 
Sbjct  293  LFNENRKPGIESERNWGMFYANGTNVYALDFTGENTTPVSPTNSTTGTSPSPSSSPIING  352

Query  746  NGT-------------WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLV  606
            N T             WCIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++
Sbjct  353  NSTVTIGGGGGGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVL  412

Query  605  SHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            SHAS+AFN+YYQQ+GA+ + CSF G  V  +K+PSY NCLYM
Sbjct  413  SHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLYM  454



>ref|NP_849556.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
 sp|Q8VYE5.1|E1312_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 12; AltName: Full=(1->3)-beta-glucan 
endohydrolase 12; Short=(1->3)-beta-glucanase 
12; AltName: Full=Beta-1,3-endoglucanase 12; Short=Beta-1,3-glucanase 
12; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL59955.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM20105.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEE85622.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
Length=534

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 109/162 (67%), Gaps = 25/162 (15%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVS------------TGANLTSS  747
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+    VS            + + + + 
Sbjct  315  LFNENRKPGIESERNWGMFYANGTNVYALDFTGENTTPVSPTNSTTGTSPSPSSSPIING  374

Query  746  NGT-------------WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLV  606
            N T             WCIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++
Sbjct  375  NSTVTIGGGGGGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVL  434

Query  605  SHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            SHAS+AFN+YYQQ+GA+ + CSF G  V  +K+PSY NCLYM
Sbjct  435  SHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLYM  476



>emb|CDY68826.1| BnaA01g34890D [Brassica napus]
Length=424

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 108/156 (69%), Gaps = 19/156 (12%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGA-------------NLTS  750
            LFNENRKPG+ESERNWG+ + + TSVY LDFTG+ +V VS                N T 
Sbjct  209  LFNENRKPGIESERNWGMFYANGTSVYALDFTGESSVPVSPSNSSTTSPGPSSSPGNSTV  268

Query  749  SNG------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFA  588
              G       WC+ASS AS  +L+ AL+WACG G+VDCSA+QP QPCFEPD ++SHAS+A
Sbjct  269  IIGGGGGARKWCVASSQASVTELQTALDWACGPGSVDCSAVQPDQPCFEPDTVLSHASYA  328

Query  587  FNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            FN+YYQQ+GA    CSFGGV V  +K+PSY NCLYM
Sbjct  329  FNTYYQQSGANSSDCSFGGVSVEVDKDPSYGNCLYM  364



>ref|XP_010447863.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=538

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 111/166 (67%), Gaps = 29/166 (17%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVS-----TGAN-------LTSS  747
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+ +  VS     TG +       + + 
Sbjct  315  LFNENRKPGIESERNWGMFYANGTNVYALDFTGENSTPVSPTNATTGTSPSPSSSPINNG  374

Query  746  NGT-----------------WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEP  618
            N T                 WCIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEP
Sbjct  375  NSTVIIGGGGGGVVVGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEP  434

Query  617  DNLVSHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            D ++SHAS+AFN+YYQQ+GA+ + CSF G  V  +K+PSY NCLYM
Sbjct  435  DTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLYM  480



>ref|XP_010433104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=541

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 110/168 (65%), Gaps = 32/168 (19%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTS-----------SN  744
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+    VS   N+T+           SN
Sbjct  315  LFNENRKPGIESERNWGMFYANGTNVYALDFTGESTTPVSP-TNVTTGTSPSPSSSPISN  373

Query  743  G--------------------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCF  624
            G                     WCIASS AS  +L+ AL+WACG GNVDCSA+QP QPCF
Sbjct  374  GNSTVIIGGGGGGVVGGGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCF  433

Query  623  EPDNLVSHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            EPD ++SHAS+AFN+YYQQ+GA+ + CSF G  V  +K+PSY NCLYM
Sbjct  434  EPDTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLYM  481



>ref|XP_006285688.1| hypothetical protein CARUB_v10007158mg [Capsella rubella]
 gb|EOA18586.1| hypothetical protein CARUB_v10007158mg [Capsella rubella]
Length=538

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 108/164 (66%), Gaps = 27/164 (16%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTG------------ANLTSS  747
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+    VS              + + + 
Sbjct  315  LFNENRKPGIESERNWGMFYANGTNVYALDFTGENTTPVSPSNSTTGTSPSPSSSPINNG  374

Query  746  NGT---------------WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDN  612
            N T               WCIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD 
Sbjct  375  NSTVIIGGGGVGGGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDT  434

Query  611  LVSHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            ++SHAS+AFN+YYQQ+GA+ + CSF G  V  +K+PSY NCLYM
Sbjct  435  VLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLYM  478



>ref|XP_010438307.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Camelina sativa]
Length=540

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 109/167 (65%), Gaps = 31/167 (19%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTS-----------SN  744
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+    VS   N+T+            N
Sbjct  315  LFNENRKPGIESERNWGMFYANGTNVYALDFTGENTTPVSP-TNVTTGTSPSPSSSPVDN  373

Query  743  G-------------------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFE  621
            G                    WCIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFE
Sbjct  374  GNSTVIIGGGGGVVGGGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFE  433

Query  620  PDNLVSHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            PD ++SHAS+AFN+YYQQ+GA+ + CSF G  V  +K+PSY NCLYM
Sbjct  434  PDTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLYM  480



>ref|XP_009128829.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=532

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 111/157 (71%), Gaps = 20/157 (13%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSS--------NGT-  738
            LFNENRKPG+ESERNWG+ + + TSVY LDFTG+ +V VS   + T+S        N T 
Sbjct  316  LFNENRKPGIESERNWGMFYANGTSVYALDFTGESSVPVSPSNSSTTSPGPSSSPGNSTV  375

Query  737  -----------WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASF  591
                       WC+ASS AS  +L+ AL+WACG G+VDCSA+QP QPCFEPD ++SHAS+
Sbjct  376  IIGGGGGGARKWCVASSQASVTELQTALDWACGPGSVDCSAVQPDQPCFEPDTVLSHASY  435

Query  590  AFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            AFN+YYQQ+GA    CSFGGV V  +K+PSY NCLYM
Sbjct  436  AFNTYYQQSGANSSDCSFGGVSVEVDKDPSYGNCLYM  472



>ref|XP_002867412.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43671.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=536

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 104/163 (64%), Gaps = 26/163 (16%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVS--------------------  771
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+    VS                    
Sbjct  315  LFNENRKPGIESERNWGMFYANGTNVYALDFTGENTTPVSPTNSTMGTSPSPSSSPISGN  374

Query  770  ------TGANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNL  609
                   G      +  WCIASS A   +L+ AL+WACG GNVDCSA+QP QPCFEPD +
Sbjct  375  STVIIGGGGGGGGGSKKWCIASSQAPVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTV  434

Query  608  VSHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            +SHAS+AFN+YYQQ+GA+ + CSF G  V  +K+PSY NCLYM
Sbjct  435  LSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLYM  477



>gb|KJB54309.1| hypothetical protein B456_009G028300 [Gossypium raimondii]
Length=477

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 99/136 (73%), Gaps = 12/136 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNEN K G E ERN+GL  P+  SVYNL+F GKG            +  +WCIASS AS
Sbjct  353  LFNENLKQGPEIERNFGLFDPEMRSVYNLNFPGKG------------TGKSWCIASSQAS  400

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
             + L+NAL+WACG G  DCSAIQP Q CF+PD LVSHASFAFN+YYQ+NGATD ACSFGG
Sbjct  401  NSALQNALDWACGQGKADCSAIQPGQRCFQPDTLVSHASFAFNNYYQKNGATDDACSFGG  460

Query  530  VGVRTNKNPSYDNCLY  483
             G++ + +PSY NC+Y
Sbjct  461  TGIKVSTDPSYGNCIY  476



>gb|KJB54307.1| hypothetical protein B456_009G028200 [Gossypium raimondii]
Length=542

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 97/136 (71%), Gaps = 12/136 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNEN K G E+ERN+GL +PD TSVYNL F GKG            +  +WC+AS  AS
Sbjct  322  LFNENLKQGPETERNFGLFYPDMTSVYNLVFPGKG------------TGRSWCVASRQAS  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
             + L+NAL+WACG G  DCSA+QP Q CFEP+NLVSHASFAFN+YYQ+NG TD AC FGG
Sbjct  370  NSALQNALDWACGPGKADCSALQPDQQCFEPNNLVSHASFAFNNYYQKNGLTDQACRFGG  429

Query  530  VGVRTNKNPSYDNCLY  483
             G+    +PSY NC+Y
Sbjct  430  TGIVVYNDPSYGNCIY  445


 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A+S AS ++L+NAL+WACG G  DCS IQP+Q CF+PD L++HASFAFN+YY++NG
Sbjct  456  TWCVATSQASRSNLQNALDWACGPGKADCSEIQPNQRCFQPDTLLAHASFAFNNYYRKNG  515

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
            ATD +CSF G  ++ +++PSY NC+Y
Sbjct  516  ATDASCSFRGNAIKVDRDPSYGNCIY  541



>gb|KHG29271.1| hypothetical protein F383_14120 [Gossypium arboreum]
Length=545

 Score =   167 bits (424),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 98/136 (72%), Gaps = 12/136 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNEN K G E ERN+GL +PD  SVYNL F GKG     TG        +WC+ASS AS
Sbjct  301  LFNENLKQGPEIERNFGLFYPDMRSVYNLVFPGKG-----TGR-------SWCVASSQAS  348

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
             + L+NAL+WACG G  DCSA+QP Q CFEP+NLVSHASFAFN+YYQ+NG TD ACSFGG
Sbjct  349  NSALQNALDWACGPGKADCSALQPDQQCFEPNNLVSHASFAFNNYYQKNGLTDQACSFGG  408

Query  530  VGVRTNKNPSYDNCLY  483
             G+    +PSY +C+Y
Sbjct  409  TGIVVYNDPSYGSCIY  424


 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+ASS AS ++L+NAL+WACG G  DCS IQP+Q CF+PD L++HASFAFN+YYQ+NG
Sbjct  435  TWCVASSQASRSNLQNALDWACGPGKADCSEIQPNQKCFQPDTLLAHASFAFNNYYQKNG  494

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLYM  480
            ATD +CSF G  ++ +++PS  N L M
Sbjct  495  ATDASCSFRGNAIKVDQDPS--NSLAM  519



>ref|NP_567828.3| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
 gb|AAM65893.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AEE85621.1| glucan endo-1,3-beta-glucosidase 12 [Arabidopsis thaliana]
Length=488

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 103/155 (66%), Gaps = 25/155 (16%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVS------------TGANLTSS  747
            LFNENRKPG+ESERNWG+ + + T+VY LDFTG+    VS            + + + + 
Sbjct  315  LFNENRKPGIESERNWGMFYANGTNVYALDFTGENTTPVSPTNSTTGTSPSPSSSPIING  374

Query  746  NGT-------------WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLV  606
            N T             WCIASS AS  +L+ AL+WACG GNVDCSA+QP QPCFEPD ++
Sbjct  375  NSTVTIGGGGGGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVL  434

Query  605  SHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPS  501
            SHAS+AFN+YYQQ+GA+ + CSF G  V  +K+PS
Sbjct  435  SHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPS  469



>gb|KJB54308.1| hypothetical protein B456_009G028300 [Gossypium raimondii]
Length=489

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 93/129 (72%), Gaps = 12/129 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNEN K G E ERN+GL  P+  SVYNL+F GKG            +  +WCIASS AS
Sbjct  353  LFNENLKQGPEIERNFGLFDPEMRSVYNLNFPGKG------------TGKSWCIASSQAS  400

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
             + L+NAL+WACG G  DCSAIQP Q CF+PD LVSHASFAFN+YYQ+NGATD ACSFGG
Sbjct  401  NSALQNALDWACGQGKADCSAIQPGQRCFQPDTLVSHASFAFNNYYQKNGATDDACSFGG  460

Query  530  VGVRTNKNP  504
             G++ + +P
Sbjct  461  TGIKVSTDP  469



>ref|XP_006488904.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006488905.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006488906.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Citrus sinensis]
 gb|KDO63056.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
 gb|KDO63057.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
Length=493

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 92/136 (68%), Gaps = 7/136 (5%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+++PG  SE+NWG+ F + TSVY L+F+G G +       + +S+G +C+A   A 
Sbjct  317  LFNEDKRPGPISEKNWGVFFTNGTSVYPLNFSGSGQI-------IGNSSGVFCVAKDDAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+N LNWACG G+ +CSAIQP QPC+ P+N+ SHAS+A+N YYQ+  +    C+F G
Sbjct  370  SDKLQNGLNWACGQGHANCSAIQPGQPCYLPNNIKSHASYAYNDYYQKMRSVGGTCNFDG  429

Query  530  VGVRTNKNPSYDNCLY  483
              + T K+PSY +C Y
Sbjct  430  TAMTTTKDPSYGSCTY  445



>ref|XP_006445640.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 ref|XP_006445641.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58880.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58881.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
Length=493

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 92/136 (68%), Gaps = 7/136 (5%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+++PG  SE+NWG+ F + TSVY L+F+G G +       + +S+G +C+A   A 
Sbjct  317  LFNEDKRPGPISEKNWGVFFTNGTSVYPLNFSGSGQI-------IGNSSGVFCVAKDDAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+N LNWACG G+ +CSAIQP QPC+ P+N+ SHAS+A+N YYQ+  +    C+F G
Sbjct  370  SDKLQNGLNWACGQGHANCSAIQPGQPCYLPNNIKSHASYAYNDYYQKMRSVGGTCNFDG  429

Query  530  VGVRTNKNPSYDNCLY  483
              + T K+PSY +C Y
Sbjct  430  TAMTTTKDPSYGSCTY  445



>ref|XP_008452393.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
melo]
Length=500

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+ +PGL SE+NWGL +P    VY L  +  GAV  +      ++N T+C+A   A 
Sbjct  314  LFNEDLRPGLVSEKNWGLFYPTGVPVYTLHLSSAGAVLAND-----TTNQTFCVAKDGAD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+  L+WACG G VDCS +   QPC++PDN+++HA++AFN+YYQ+ G +   C F G
Sbjct  369  RKLLQAGLDWACGPGRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKSPGTCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V + T  NPS+ +C++
Sbjct  429  VAIITTTNPSHSSCIF  444



>ref|XP_008452394.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Cucumis 
melo]
Length=467

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+ +PGL SE+NWGL +P    VY L  +  GAV  +      ++N T+C+A   A 
Sbjct  281  LFNEDLRPGLVSEKNWGLFYPTGVPVYTLHLSSAGAVLAND-----TTNQTFCVAKDGAD  335

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+  L+WACG G VDCS +   QPC++PDN+++HA++AFN+YYQ+ G +   C F G
Sbjct  336  RKLLQAGLDWACGPGRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKSPGTCDFKG  395

Query  530  VGVRTNKNPSYDNCLY  483
            V + T  NPS+ +C++
Sbjct  396  VAIITTTNPSHSSCIF  411



>ref|XP_004142367.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
sativus]
 gb|KGN52361.1| hypothetical protein Csa_5G628660 [Cucumis sativus]
Length=500

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PGL SE+NWGL +P    VY L  +  GAV     AN T+ N T+C+A   A 
Sbjct  314  LYNEDLRPGLVSEKNWGLFYPTGMPVYTLHLSSAGAV----LANDTT-NQTFCVAKDGAD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+  L+WACG G VDCS +   QPC++PDN+++HA++AFN+YYQ+ G +   C F G
Sbjct  369  RKLLQAGLDWACGPGRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKSSGTCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V + T  NPS+ +C++
Sbjct  429  VAIITTTNPSHSSCIF  444



>ref|XP_011655956.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Cucumis 
sativus]
Length=467

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PGL SE+NWGL +P    VY L  +  GAV     AN T+ N T+C+A   A 
Sbjct  281  LYNEDLRPGLVSEKNWGLFYPTGMPVYTLHLSSAGAV----LANDTT-NQTFCVAKDGAD  335

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+  L+WACG G VDCS +   QPC++PDN+++HA++AFN+YYQ+ G +   C F G
Sbjct  336  RKLLQAGLDWACGPGRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKSSGTCDFKG  395

Query  530  VGVRTNKNPSYDNCLY  483
            V + T  NPS+ +C++
Sbjct  396  VAIITTTNPSHSSCIF  411



>ref|XP_002969476.1| hypothetical protein SELMODRAFT_231287 [Selaginella moellendorffii]
 gb|EFJ29564.1| hypothetical protein SELMODRAFT_231287 [Selaginella moellendorffii]
Length=478

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAV-DVSTGANLTSSNGTWCIASSTA  714
            L++E+RK G +  R WGL   +QT VY LD +G   + D STG    S   TWC+A S A
Sbjct  298  LYSEDRKSGGDGGRLWGLFHANQTPVYKLDVSGVTMLRDSSTGNG--SIAKTWCVARSGA  355

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ADLE+ALNWACG GN DCSAIQ    C+ PD++ SHAS+AFNSY+Q+N   +  C F 
Sbjct  356  SDADLESALNWACGIGNADCSAIQQGGACYSPDSVASHASYAFNSYFQRNVQGNGTCDFN  415

Query  533  GVGVRTNKNPSYDNCLY  483
            G    T+ +PSY++C+Y
Sbjct  416  GCATLTSTDPSYNSCIY  432



>ref|XP_002967282.1| hypothetical protein SELMODRAFT_87871 [Selaginella moellendorffii]
 gb|EFJ31881.1| hypothetical protein SELMODRAFT_87871 [Selaginella moellendorffii]
Length=449

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 4/130 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            +FNE+R+ G  SE+N+G+ +PDQT VY+LD TG+     S GA   +S  TWC+A    S
Sbjct  301  IFNEDRRQGATSEKNYGIYYPDQTPVYSLDVTGRD----SGGAGSNTSVRTWCVAKQGVS  356

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL++ACG G+ DCS+IQP Q CF PD++ SHASFAFNSYY +N      C F G
Sbjct  357  DNSLQAALDYACGQGSADCSSIQPGQACFFPDSVFSHASFAFNSYYLKNKMAAGTCDFAG  416

Query  530  VGVRTNKNPS  501
            V   T  +PS
Sbjct  417  VATVTTNDPS  426



>ref|XP_002960438.1| hypothetical protein SELMODRAFT_75479 [Selaginella moellendorffii]
 gb|EFJ37977.1| hypothetical protein SELMODRAFT_75479 [Selaginella moellendorffii]
Length=449

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 4/130 (3%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            +FNE+R+ G  SE+N+G+ +PDQT VY+LD TG+     S GA   +S  TWC+A    S
Sbjct  301  IFNEDRRQGATSEKNYGIYYPDQTPVYSLDVTGRD----SGGAGSNTSVRTWCVAKQGVS  356

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL++ACG G+ DCS+IQP Q CF PD++ SHASFAFNSYY +N      C F G
Sbjct  357  DNSLQAALDYACGQGSADCSSIQPGQACFFPDSVFSHASFAFNSYYLKNKMAAGTCDFAG  416

Query  530  VGVRTNKNPS  501
            V   T  +PS
Sbjct  417  VATVTTNDPS  426



>gb|KHN38251.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=381

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 86/141 (61%), Gaps = 5/141 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDF----TGKGAVDVSTGANLTSSNG-TWCIA  726
            LFNEN+K G  SERN+GL +P +  VY++       GK  V VS   + T+S G TWC+A
Sbjct  237  LFNENQKTGPTSERNYGLFYPTEKKVYDIPLPPSGVGKSQVPVSGEVSTTTSKGQTWCVA  296

Query  725  SSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVA  546
            S  +SE  L+NALN+ACG G  DC+ IQP   C+ P+ L +HAS+AFNSYYQ+       
Sbjct  297  SGGSSEKKLQNALNYACGEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQKKARASGT  356

Query  545  CSFGGVGVRTNKNPSYDNCLY  483
            C FGG      + P Y NC +
Sbjct  357  CDFGGTAYVVTQPPKYGNCEF  377



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 84/142 (59%), Gaps = 8/142 (6%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT--------GKGAVDVSTGANLTSSNGTW  735
            LFNEN+K G  SERN+GL +P Q  VY++  T        GK  V VS     +S   TW
Sbjct  314  LFNENQKTGPTSERNYGLFYPSQKKVYDIQLTAEAPPSGVGKSQVPVSGDVTTSSKGQTW  373

Query  734  CIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGAT  555
            C+A+  +SE  L+NALN+ACG G  DC+ IQP   C++P+ L +HAS+AFNSYYQ+    
Sbjct  374  CVANGGSSEKKLQNALNYACGEGGADCTPIQPGATCYDPNTLEAHASYAFNSYYQKMARA  433

Query  554  DVACSFGGVGVRTNKNPSYDNC  489
               C FGG      + P Y NC
Sbjct  434  SGTCYFGGTAYVVTQPPKYGNC  455



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 86/147 (59%), Gaps = 13/147 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT------------GKGAVDVSTGANLTSS  747
            LFNEN+K G  SERN+GL +P +  VY++  T            GK  V VS   + T+S
Sbjct  320  LFNENQKTGPTSERNYGLFYPTEKKVYDIPLTAEEIKEAPPSGVGKSQVPVSGEVSTTTS  379

Query  746  NG-TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQ  570
             G TWC+AS  +SE  L+NALN+ACG G  DC+ IQP   C+ P+ L +HAS+AFNSYYQ
Sbjct  380  KGQTWCVASGGSSEKKLQNALNYACGEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQ  439

Query  569  QNGATDVACSFGGVGVRTNKNPSYDNC  489
            +       C FGG      + P Y NC
Sbjct  440  KKARASGTCDFGGTAYVVTQPPKYGNC  466



>ref|XP_010905435.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13 [Elaeis guineensis]
Length=173

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A    S+ DL+NAL+WACG G  DCSA+QP  PC++PD L+SHAS+AFNSYYQQNG
Sbjct  53   TWCVAQPGVSQEDLQNALDWACGLGAADCSAVQPDGPCYQPDTLLSHASYAFNSYYQQNG  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLYM  480
             +D+AC+FGG    T +NPSY +C+Y+
Sbjct  113  NSDIACNFGGTAAITTRNPSYGSCVYL  139



>ref|XP_008784817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Phoenix 
dactylifera]
Length=172

 Score =   127 bits (319),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A    S+ DL+NAL+WACG G  DCSA+QP  PC++PD L+SHAS+AFNSYYQQNG
Sbjct  53   TWCVARPGVSQEDLQNALDWACGLGAADCSAVQPDGPCYQPDTLLSHASYAFNSYYQQNG  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLYM  480
             +D+AC+FGG    T+ NPSY++C+Y+
Sbjct  113  NSDIACNFGGTATITSSNPSYESCVYL  139



>ref|XP_008784816.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Phoenix 
dactylifera]
Length=173

 Score =   127 bits (319),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A    S+ DL+NAL+WACG G  DCSA+QP  PC++PD L+SHAS+AFNSYYQQNG
Sbjct  53   TWCVARPGVSQEDLQNALDWACGLGAADCSAVQPDGPCYQPDTLLSHASYAFNSYYQQNG  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLYM  480
             +D+AC+FGG    T+ NPSY++C+Y+
Sbjct  113  NSDIACNFGGTATITSSNPSYESCVYL  139



>ref|XP_002961242.1| hypothetical protein SELMODRAFT_402967 [Selaginella moellendorffii]
 gb|EFJ38781.1| hypothetical protein SELMODRAFT_402967 [Selaginella moellendorffii]
Length=489

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAV-DVSTGANLTSSNGTWCIASSTA  714
            L++E+RK G +  R WGL   +QT VY LD +G   + D STG    S    WC+A S A
Sbjct  308  LYSEDRKSGGDGGRLWGLFHANQTPVYKLDVSGVTMLRDSSTGNG--SIAKMWCVARSGA  365

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            S+ DLE+ALNWACG GN DCSAIQ    C+ PD++ SHAS+AFNSY+Q+N   +  C F 
Sbjct  366  SDKDLESALNWACGIGNADCSAIQQGGACYSPDSVASHASYAFNSYFQRNVQGNGTCDFN  425

Query  533  GVGVRTNKNPSYDNCLY  483
            G    T+ +PSY++C+Y
Sbjct  426  GCATLTSTDPSYNSCIY  442



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 87/138 (63%), Gaps = 10/138 (7%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT--WCIASST  717
            L++E+++ G  SE+NWG+ FP+ TSVY L  +G        GAN  S NG+  +C+A + 
Sbjct  317  LYSEDKRAGPVSEKNWGILFPNGTSVYPLSLSG--------GANSASPNGSSLFCVAKAD  368

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            A +  L + LNWACG G  +C+AIQP  PC+ PDN+ SHASFA+N YYQ+  +    C F
Sbjct  369  AEDDKLVDGLNWACGQGQANCAAIQPGHPCYLPDNIKSHASFAYNDYYQKMKSAGGTCDF  428

Query  536  GGVGVRTNKNPSYDNCLY  483
             G  + T ++PSY  C Y
Sbjct  429  SGTAITTTRDPSYKTCAY  446



>gb|EPS73917.1| hypothetical protein M569_00835, partial [Genlisea aurea]
Length=445

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 86/146 (59%), Gaps = 12/146 (8%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKG------------AVDVSTGANLTSS  747
            LFNEN+KPG  SERN+GL +PD+T VY++ FT +G            A+D       T S
Sbjct  296  LFNENKKPGPTSERNFGLFYPDETRVYDVPFTAEGLKNVNNNNNNPPAMDHGEQRISTGS  355

Query  746  NGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQ  567
              +WC+A++ A    L+  L++ACG G  DC +IQP   CF+P+ + +HASFAFNSY+Q+
Sbjct  356  GPSWCVANAAAGRKKLQAGLDYACGEGGADCRSIQPGSTCFDPNTVEAHASFAFNSYFQK  415

Query  566  NGATDVACSFGGVGVRTNKNPSYDNC  489
            NG     C FGG      + P Y  C
Sbjct  416  NGRRIGTCYFGGAAYVVTQQPKYGAC  441



>ref|XP_006579395.1| PREDICTED: uncharacterized protein LOC100778330 isoform X1 [Glycine 
max]
Length=175

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ADL+NAL+WACG G  DC+AIQ   PCFEPD LVSHASFAFNSYYQ NG
Sbjct  53   TWCVALAGVSQADLQNALDWACGLGMADCTAIQHGGPCFEPDTLVSHASFAFNSYYQING  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  C+Y
Sbjct  113  NSDIACNFGGTAALTKHNPSYGKCVY  138



>ref|XP_003531315.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Glycine 
max]
 gb|KHN28999.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=175

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ADL+NAL+WACG G  DC+AIQ   PCFEPD LVSHASFAFNSYYQ NG
Sbjct  53   TWCVALAGVSQADLQNALDWACGLGMADCTAIQHGGPCFEPDTLVSHASFAFNSYYQING  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  C+Y
Sbjct  113  NSDIACNFGGTAALTKHNPSYGKCVY  138



>ref|XP_007215258.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
 ref|XP_008227924.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Prunus mume]
 gb|EMJ16457.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
Length=504

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   + T +Y L  TG GAV      +  ++N T+CI    A 
Sbjct  322  LYNEDMKPGPISEKNWGLFDANGTPIYILRLTGSGAV-----LSNDTTNQTFCITKDGAD  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   +PC+EPDN+++HA++AF++YY + G T  AC F G
Sbjct  377  PKMLQAALDWACGPGKVDCSALLQGEPCYEPDNVIAHATYAFDTYYHKMGKTPAACDFNG  436

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  437  VAAITTTDPSHGSCIF  452



>gb|KEH20727.1| carbohydrate-binding X8 domain protein [Medicago truncatula]
Length=158

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ADL+NAL+WACG G  DC AIQ   PC++PD L+SHASFAFNSYYQ NG
Sbjct  36   TWCVAQAGVSQADLQNALDWACGLGMADCKAIQKGGPCYDPDTLLSHASFAFNSYYQTNG  95

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T +NPSY NC+Y
Sbjct  96   NSDIACNFGGTASLTKQNPSYGNCVY  121



>ref|XP_004243515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Solanum lycopersicum]
Length=468

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 86/147 (59%), Gaps = 13/147 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGA---VD----------VSTGANLTS  750
            LFNEN+KPG  SERN+GL +P++  VYN+  T +G    VD             G  +  
Sbjct  316  LFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPSAGEQRTQKGGKVNV  375

Query  749  SNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQ  570
            S  TWC+AS  A +  L+ AL++ACG G  DC +IQP   C+ P+ L +HASFAFNSYYQ
Sbjct  376  SGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSYYQ  435

Query  569  QNGATDVACSFGGVGVRTNKNPSYDNC  489
            + G    +C FGG     ++ P Y +C
Sbjct  436  KKGRAMGSCYFGGAAFIVHQQPKYGHC  462



>ref|NP_001242238.1| uncharacterized protein LOC100778330 precursor [Glycine max]
 gb|ACU17215.1| unknown [Glycine max]
Length=175

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+  +  S+ADL+NAL+WACG G  DC+AIQ   PCFEPD LVSHASFAFNSYYQ NG
Sbjct  53   TWCVVLAGVSQADLQNALDWACGLGMADCTAIQHGGPCFEPDTLVSHASFAFNSYYQING  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  C+Y
Sbjct  113  NSDIACNFGGTAALTKHNPSYGKCVY  138



>ref|XP_006657748.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Oryza brachyantha]
Length=534

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+ +PG  SE NWGL   + T VY L  +G G V  +      +++ T+CIAS  A 
Sbjct  340  LFNEDLRPGPVSEANWGLFHGNGTPVYLLHVSGTGGVLAND-----TTDRTFCIASDDAD  394

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  ++ A++WACG G  DC+AIQP Q C+EP+++ SHAS+AF+SYYQ  G    +C F G
Sbjct  395  EKAVQAAMDWACGPGRTDCTAIQPGQGCYEPNDVRSHASYAFDSYYQLQGKAAGSCYFQG  454

Query  530  VGVRTNKNPSYDNCLY  483
            VG+ T  +PS+D+C++
Sbjct  455  VGMVTTTDPSHDSCIF  470



>ref|XP_006448191.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
 ref|XP_006469226.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Citrus sinensis]
 gb|ESR61431.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
Length=499

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   +   VY L  TG G V  +      ++N T+C+A   A 
Sbjct  315  LYNEDLRPGSVSEKNWGLFNANGVPVYTLHLTGAGTVLAND-----TTNQTFCVAKDGAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   QPC+EPDN++SH+++AFN+YYQQ       C F G
Sbjct  370  KKMLQAALDWACGPGKVDCSALLQGQPCYEPDNVISHSTYAFNAYYQQMAKAPGTCDFKG  429

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  430  VATITTTDPSHGSCIF  445



>emb|CDP01635.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 88/137 (64%), Gaps = 5/137 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   +   +Y L  TG G+V  +      ++N T+C A  +A 
Sbjct  314  LYNEDTRPGPLSEKNWGLFDGNGVPIYILRLTGSGSVLAND-----TTNQTYCAAKDSAD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS +   QPC+EPD + +HA++AF++YYQ+NG   +AC F G
Sbjct  369  SKMLQAALDWACGPGKVDCSPLLQGQPCYEPDTVSAHATYAFDAYYQKNGKAPLACDFNG  428

Query  530  VGVRTNKNPSYDNCLYM  480
            V   T  NPS+ +CL++
Sbjct  429  VAAITTTNPSHGSCLFL  445



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 85/148 (57%), Gaps = 14/148 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGA--------------VDVSTGANLT  753
            LFNEN+KPG  SERN+GL +P++  VYN+  T + A              V V+   +  
Sbjct  316  LFNENQKPGPTSERNYGLFYPNEQKVYNIPLTKEEAKTGESTPVNSNTSQVPVAGEVSKA  375

Query  752  SSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYY  573
                TWC+A+  A E  L+ AL++ACG G  DCS IQP   C+ P+ L +HAS+AFNSYY
Sbjct  376  KVGQTWCVANGKADEKKLQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNSYY  435

Query  572  QQNGATDVACSFGGVGVRTNKNPSYDNC  489
            Q+N      C FGG     ++ P+Y NC
Sbjct  436  QKNTRATGTCEFGGAAYVVSQRPTYGNC  463



>ref|XP_003630021.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|ACJ85566.1| unknown [Medicago truncatula]
 gb|AET04497.1| carbohydrate-binding X8 domain protein [Medicago truncatula]
 gb|AFK43114.1| unknown [Medicago truncatula]
Length=178

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ADL+NAL+WACG G  DC AIQ   PC++PD L+SHASFAFNSYYQ NG
Sbjct  56   TWCVAQAGVSQADLQNALDWACGLGMADCKAIQKGGPCYDPDTLLSHASFAFNSYYQTNG  115

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T +NPSY NC+Y
Sbjct  116  NSDIACNFGGTASLTKQNPSYGNCVY  141



>ref|XP_004504153.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Cicer arietinum]
 ref|XP_004504154.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X2 
[Cicer arietinum]
Length=176

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ADL+NAL+WACG G+ DC AIQ   PCFEPD LVSHASFAFNSYYQ NG
Sbjct  54   TWCVALAGVSQADLQNALDWACGLGSADCKAIQKDGPCFEPDTLVSHASFAFNSYYQTNG  113

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  +PSY  C Y
Sbjct  114  NSDIACNFGGTATLTKTDPSYGKCAY  139



>dbj|BAF01977.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=314

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 81/137 (59%), Gaps = 3/137 (2%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDV---STGANLTSSNGTWCIASS  720
            LFNEN+KPG  SERN+GL +P++  VYN+ FT K    V        +T    TWC+++ 
Sbjct  172  LFNENQKPGPTSERNYGLFYPNEGKVYNVPFTKKSTTPVNGNRGKVPVTHEGHTWCVSNG  231

Query  719  TASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACS  540
              ++  L+ AL++ACG G  DC  IQP   C+ P++L +HAS+AFNSYYQ+N      C 
Sbjct  232  EVAKEKLQEALDYACGEGGADCRPIQPGATCYHPESLEAHASYAFNSYYQKNSRRVGTCF  291

Query  539  FGGVGVRTNKNPSYDNC  489
            FGG      + P Y  C
Sbjct  292  FGGAAHVVTQPPRYGKC  308



>ref|NP_001059752.1| Os07g0510200 [Oryza sativa Japonica Group]
 dbj|BAC83955.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF21666.1| Os07g0510200 [Oryza sativa Japonica Group]
 dbj|BAG88935.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94977.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67248.1| hypothetical protein OsJ_24399 [Oryza sativa Japonica Group]
Length=540

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+ +PG  SE NWGL   + T VY L  +G G    +      +++ T+CIAS  A 
Sbjct  346  LFNEDLRPGPVSEANWGLFHGNGTPVYLLHVSGAGGFLAND-----TTDRTFCIASDDAD  400

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  ++ A++WACG G  DC+AIQP Q C+EP+++ SHASFAF+SYYQ  G    +C F G
Sbjct  401  EKAVQAAMDWACGPGRTDCTAIQPGQGCYEPNDVRSHASFAFDSYYQSQGKAAGSCYFQG  460

Query  530  VGVRTNKNPSYDNCLY  483
            VG+ T  +PS+D+C++
Sbjct  461  VGMVTTTDPSHDSCIF  476



>gb|EEC82125.1| hypothetical protein OsI_26155 [Oryza sativa Indica Group]
Length=538

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+ +PG  SE NWGL   + T VY L  +G G    +      +++ T+CIAS  A 
Sbjct  344  LFNEDLRPGPVSEANWGLFHGNGTPVYLLHVSGAGGFLAND-----TTDRTFCIASDDAD  398

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  ++ A++WACG G  DC+AIQP Q C+EP+++ SHASFAF+SYYQ  G    +C F G
Sbjct  399  EKAVQAAMDWACGPGRTDCTAIQPGQGCYEPNDVRSHASFAFDSYYQSQGKAAGSCYFQG  458

Query  530  VGVRTNKNPSYDNCLY  483
            VG+ T  +PS+D+C++
Sbjct  459  VGMVTTTDPSHDSCIF  474



>ref|XP_010675772.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT----GKGAVDVSTGAN-----LTSSNGT  738
            LFNEN+KPG  SERN+GL +P++  VYN+  T    G  AV  ++  N     +  +  T
Sbjct  315  LFNENQKPGPTSERNYGLFYPNEQKVYNVPLTAAQIGDAAVAPASANNGSKVVVPPTGQT  374

Query  737  WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA  558
            WC+A+  A E  L++ LNWACG G  DC  IQP   C+ P  LV+HAS+AFNSYYQ    
Sbjct  375  WCVANEQAGEEKLQDGLNWACGEGKADCRPIQPGATCYNPGTLVAHASYAFNSYYQMKAR  434

Query  557  TDVACSFGGVGVRTNKNPSYDNCLY  483
            +   C FGG      ++P + +C +
Sbjct  435  STGTCDFGGAAHVVTQSPQFGSCKF  459



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 85/148 (57%), Gaps = 14/148 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGA--------------VDVSTGANLT  753
            LFNEN+KPG  SERN+GL +P++  VYN+  T + A              V V+   +  
Sbjct  316  LFNENKKPGPTSERNYGLFYPNEQKVYNIPLTKEEAKTGQSTPVNSNTSQVPVAGEVSKA  375

Query  752  SSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYY  573
                TWC+A+  A E  L+ AL++ACG G  DCS IQP   C+ P+ L +HAS+AFNSYY
Sbjct  376  KVGQTWCVANGKADEKKLQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNSYY  435

Query  572  QQNGATDVACSFGGVGVRTNKNPSYDNC  489
            Q+N      C FGG     ++ P+Y +C
Sbjct  436  QKNTRVTGTCEFGGAAYVVSQRPTYGSC  463



>ref|XP_010319704.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13 [Solanum lycopersicum]
Length=181

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A + A + DL+NAL+WACG G  DC  IQ   PCFEP+ L+SHASFAFN+YYQQNG
Sbjct  23   TWCVARAGARQFDLQNALDWACGLGMADCRPIQAGGPCFEPNTLLSHASFAFNTYYQQNG  82

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLYM  480
             +D+AC+FGG  + T  NPS++ C+Y+
Sbjct  83   NSDIACNFGGTAILTKTNPSHEKCIYV  109



>ref|XP_008361481.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Malus domestica]
Length=504

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   + T +Y L  TG GAV  +      ++N T+C     A 
Sbjct  322  LYNEDTKPGPVSEKNWGLFDANGTPIYILRLTGSGAVLAND-----TTNQTFCTMKDGAD  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   QPC+EPD++ +HA++AF++YY Q G T  +C F G
Sbjct  377  PKMLQAALDWACGPGKVDCSALLQGQPCYEPDDVAAHATYAFDTYYHQMGMTSASCDFNG  436

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  437  VATITTTDPSHGSCIF  452



>gb|KDO64566.1| hypothetical protein CISIN_1g0108331mg, partial [Citrus sinensis]
Length=478

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   +   VY L  TG G V  +      ++N T+C+A   A 
Sbjct  294  LYNEDLRPGSVSEKNWGLFNANGVPVYTLHLTGAGTVLAND-----TTNQTFCVAKDGAD  348

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   QPC+EPDN++SH+ +AFN+YYQQ       C F G
Sbjct  349  KKMLQAALDWACGPGKVDCSALLQGQPCYEPDNVISHSMYAFNAYYQQMAKAPGTCDFKG  408

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  409  VATITTTDPSHGSCIF  424



>ref|XP_004288596.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   + T +Y L  TG GAV     AN T+ N T+C A     
Sbjct  323  LYNEDTKPGPVSEKNWGLFDANGTPIYILRLTGSGAV----LANDTT-NQTFCTAKDGTD  377

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS +   +PC+EPDN++SHA++AF++YY Q G T  +C F G
Sbjct  378  TKMLQAALDWACGPGKVDCSPLLQGEPCYEPDNVISHATYAFDTYYHQMGKTSASCDFNG  437

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  438  VAAITTTDPSHGSCVF  453



>ref|XP_002976593.1| hypothetical protein SELMODRAFT_443280 [Selaginella moellendorffii]
 gb|EFJ22262.1| hypothetical protein SELMODRAFT_443280 [Selaginella moellendorffii]
Length=477

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 84/140 (60%), Gaps = 13/140 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT----WCIAS  723
            LFNE+ + G  SE+N+GL +PDQT VY +D TG         A+L S NGT    WCIA 
Sbjct  307  LFNEDMRQGATSEKNYGLFYPDQTPVYTVDLTG---------ASLASGNGTRVPSWCIAK  357

Query  722  STASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVAC  543
               S + L+ AL++ACG G  DCS +QP Q C+ PD ++ HAS+AFN YYQ+      +C
Sbjct  358  EGMSTSSLQAALDYACGQGRADCSQLQPGQQCYFPDTVLDHASYAFNKYYQKAMMAPESC  417

Query  542  SFGGVGVRTNKNPSYDNCLY  483
             F GV   T  +PS+  C +
Sbjct  418  DFAGVATVTFTDPSHGQCRF  437



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 82/139 (59%), Gaps = 5/139 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNL-----DFTGKGAVDVSTGANLTSSNGTWCIA  726
            LFNEN+K G  SERN+GL +P +  VY+         GK  V VS     +S   TWC+A
Sbjct  314  LFNENQKTGPTSERNYGLFYPTEKKVYDTAEAPPSGVGKSQVPVSGDVTTSSKGQTWCVA  373

Query  725  SSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVA  546
            +  +SE  L+NALN+ACG G  DC+ IQP   C++P+ L +HAS+AFNSYYQ+       
Sbjct  374  NGGSSEKKLQNALNYACGEGGADCTPIQPGATCYDPNTLEAHASYAFNSYYQKMARASGT  433

Query  545  CSFGGVGVRTNKNPSYDNC  489
            C FGG      + P Y NC
Sbjct  434  CYFGGTAYVVTQPPKYGNC  452



>gb|KHN06522.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=175

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ADL+NAL+WACG G  DC+AIQ    CFEPD LVSHASFAFNSYYQ NG
Sbjct  53   TWCVALAGVSQADLQNALDWACGLGMADCTAIQQGGRCFEPDTLVSHASFAFNSYYQING  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  C+Y
Sbjct  113  NSDIACNFGGTAALTKHNPSYGKCVY  138



>emb|CDY56498.1| BnaAnng14330D [Brassica napus]
Length=442

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 81/134 (60%), Gaps = 11/134 (8%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G         LT S  TWC+A+  A 
Sbjct  314  LFNENKKFGATSERNYGLFFPDEKKVYDIPFTQEG---------LTGS--TWCVANGDAG  362

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+  L++ACG G  DC  IQ   PC+ PD L +HASFAFNSYYQ+ G    +C FGG
Sbjct  363  KDRLQGGLDYACGDGGADCRPIQRGAPCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGG  422

Query  530  VGVRTNKNPSYDNC  489
                 ++ P Y  C
Sbjct  423  AAYVVSQPPKYGRC  436



>ref|XP_006357966.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Solanum tuberosum]
Length=468

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 85/147 (58%), Gaps = 13/147 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGA---VD----------VSTGANLTS  750
            LFNEN+KPG  SERN+GL +P++  VYN+  T +G    VD             G  +  
Sbjct  316  LFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPVAGDQRTQKGGKVNV  375

Query  749  SNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQ  570
            S  TWC+AS  A +  L+ AL++ACG G  DC +IQP   C+ P+ L +HASFAFNSYYQ
Sbjct  376  SGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSYYQ  435

Query  569  QNGATDVACSFGGVGVRTNKNPSYDNC  489
            +      +C FGG     ++ P Y +C
Sbjct  436  KKSRAMGSCYFGGAAFIVHQQPKYGHC  462



>ref|XP_010276339.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Nelumbo 
nucifera]
Length=453

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 5/137 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+++PG  SE+NWGL F + TSVY L F   G  D   G   +S  G +C+A   A 
Sbjct  318  LFNEDKRPGSISEKNWGLFFTNGTSVYPLSF---GTSDRVVGN--SSGVGVFCVAKPDAD  372

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
             + L++ LNWACG G  +CSAIQ  QPC+EP+NL SHAS+A+N Y+ +  +    C FG 
Sbjct  373  SSLLQSGLNWACGEGQANCSAIQEGQPCYEPNNLQSHASYAYNDYFHKMQSAGATCDFGR  432

Query  530  VGVRTNKNPSYDNCLYM  480
              + T  +PS+ +C++M
Sbjct  433  TAITTTVDPSHSSCVFM  449



>ref|XP_002973118.1| hypothetical protein SELMODRAFT_442025 [Selaginella moellendorffii]
 gb|EFJ25492.1| hypothetical protein SELMODRAFT_442025 [Selaginella moellendorffii]
Length=477

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 84/140 (60%), Gaps = 13/140 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT----WCIAS  723
            LFNE+ + G  SE+N+GL +PDQT VY +D TG         A+L S NGT    WCIA 
Sbjct  307  LFNEDMRQGATSEKNYGLFYPDQTPVYTVDLTG---------ASLASGNGTRVPSWCIAK  357

Query  722  STASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVAC  543
               S + L+ AL++ACG G  DCS +QP Q C+ PD ++ HAS+AFN YYQ+      +C
Sbjct  358  EGMSTSSLQAALDYACGQGRADCSQLQPGQQCYFPDTVLDHASYAFNKYYQKAMMAPGSC  417

Query  542  SFGGVGVRTNKNPSYDNCLY  483
             F GV   T  +PS+  C +
Sbjct  418  DFAGVATVTFTDPSHGQCRF  437



>ref|XP_009628793.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13 [Nicotiana tomentosiformis]
Length=191

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A + A + DL+NAL+WACG G  DC  IQ   PCFEPD L+SHASFAFN YYQQNG
Sbjct  48   TWCVARAGALQFDLQNALDWACGLGMADCRPIQAGGPCFEPDTLLSHASFAFNHYYQQNG  107

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG  + T  NPS++ C+Y
Sbjct  108  NSDIACNFGGTAILTKTNPSHEKCIY  133



>ref|XP_010276332.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276334.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276336.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276337.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276338.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
Length=496

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 5/137 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+++PG  SE+NWGL F + TSVY L F   G  D   G   +S  G +C+A   A 
Sbjct  318  LFNEDKRPGSISEKNWGLFFTNGTSVYPLSF---GTSDRVVGN--SSGVGVFCVAKPDAD  372

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
             + L++ LNWACG G  +CSAIQ  QPC+EP+NL SHAS+A+N Y+ +  +    C FG 
Sbjct  373  SSLLQSGLNWACGEGQANCSAIQEGQPCYEPNNLQSHASYAYNDYFHKMQSAGATCDFGR  432

Query  530  VGVRTNKNPSYDNCLYM  480
              + T  +PS+ +C++M
Sbjct  433  TAITTTVDPSHSSCVFM  449



>emb|CDY18049.1| BnaC07g04210D [Brassica napus]
Length=442

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 80/134 (60%), Gaps = 11/134 (8%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G         LT S  TWC+A+  A 
Sbjct  314  LFNENKKFGPTSERNYGLFFPDEKKVYDIPFTQEG---------LTGS--TWCVANGDAG  362

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+  L++ACG G  DC  IQ   PC+ PD L +HASFAFNSYYQ+ G    +C FGG
Sbjct  363  KDRLQGGLDYACGDGGADCRPIQRGAPCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGG  422

Query  530  VGVRTNKNPSYDNC  489
                  + P Y  C
Sbjct  423  AAYVVTQPPKYGRC  436



>ref|XP_002527772.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF34582.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=533

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL + +   VY L  TG G V  +      ++N T+C+A   A 
Sbjct  314  LYNEDLRPGPASEKNWGLFYANGVPVYILHLTGAGTVLAND-----TTNQTFCVAKEGAD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   QPC+EPDN+V+H+++AFN+Y+Q+   +   C F G
Sbjct  369  PKMLQAALDWACGPGKVDCSAMLQGQPCYEPDNVVAHSTYAFNAYFQRMAKSPGTCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  429  VATITTTDPSHGSCIF  444



>ref|XP_002883709.1| hypothetical protein ARALYDRAFT_480193 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59968.1| hypothetical protein ARALYDRAFT_480193 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 84/154 (55%), Gaps = 20/154 (13%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNG----------  741
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G      G +   + G          
Sbjct  314  LFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTGGDQTTTKPPMS  373

Query  740  ----------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASF  591
                      +WC+A+  A E  L+  L++ACG G  DCS+IQP   C+ PD L +HASF
Sbjct  374  GGVSKSLNGHSWCVANGDAGEEKLQGGLDYACGEGGADCSSIQPGANCYSPDTLEAHASF  433

Query  590  AFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            AFNSYYQ+ G    +C FGG     ++ P Y  C
Sbjct  434  AFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRC  467



>ref|XP_006837267.2| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Amborella trichopoda]
Length=467

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 85/140 (61%), Gaps = 6/140 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGA----NLTSSNG--TWCI  729
            LFNEN+K G  SERN+GL FPD+  VYN+      + D   G+    ++ S+ G  +WC+
Sbjct  322  LFNENKKNGPTSERNYGLFFPDEEKVYNVPLLMAKSGDDHKGSSPPVDVGSAAGGQSWCV  381

Query  728  ASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDV  549
            AS  ASE  L+ AL++ACG G  DC  IQP   C++PD L +HASFAFNSYYQ+N  T  
Sbjct  382  ASEEASEDQLQAALDYACGEGGADCKEIQPGASCYDPDTLKAHASFAFNSYYQKNARTTG  441

Query  548  ACSFGGVGVRTNKNPSYDNC  489
             C F G     ++ P +  C
Sbjct  442  TCDFHGAAYVVSQLPKFGKC  461



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 86/136 (63%), Gaps = 6/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+++ G  SERNWG+ FP+ TSVY L  +G      S  A L  S+  +C+A + A 
Sbjct  317  LYNEDKRSGPVSERNWGILFPNGTSVYPLSLSGG-----SNSAALNDSS-MFCVAKADAD  370

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L + LNWACG G  +C+AIQP QPC+ P+++ SHASFAFN YYQ+  +    C F G
Sbjct  371  DDKLIDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDG  430

Query  530  VGVRTNKNPSYDNCLY  483
              + T ++PSY  C Y
Sbjct  431  TAITTTRDPSYRTCAY  446



>gb|ERN00121.1| hypothetical protein AMTR_s00112p00108890 [Amborella trichopoda]
Length=464

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 85/140 (61%), Gaps = 6/140 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGA----NLTSSNG--TWCI  729
            LFNEN+K G  SERN+GL FPD+  VYN+      + D   G+    ++ S+ G  +WC+
Sbjct  319  LFNENKKNGPTSERNYGLFFPDEEKVYNVPLLMAKSGDDHKGSSPPVDVGSAAGGQSWCV  378

Query  728  ASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDV  549
            AS  ASE  L+ AL++ACG G  DC  IQP   C++PD L +HASFAFNSYYQ+N  T  
Sbjct  379  ASEEASEDQLQAALDYACGEGGADCKEIQPGASCYDPDTLKAHASFAFNSYYQKNARTTG  438

Query  548  ACSFGGVGVRTNKNPSYDNC  489
             C F G     ++ P +  C
Sbjct  439  TCDFHGAAYVVSQLPKFGKC  458



>gb|EYU43154.1| hypothetical protein MIMGU_mgv1a005917mg [Erythranthe guttata]
Length=465

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 81/143 (57%), Gaps = 9/143 (6%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKG-------AVDVSTGANL--TSSNGT  738
            LFNEN+K G  SERN+GL +PDQ  VY++  T +G          VS G     T+S  T
Sbjct  317  LFNENKKVGPTSERNFGLFYPDQKKVYDIPLTAEGLRGLGEKTTPVSGGEQRMATASGET  376

Query  737  WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA  558
            WC+A   A +  L+  L++ACG G  DC  IQP   CF+P+ L +HASFAFNSY+Q+ G 
Sbjct  377  WCVAKEEAGKDKLQEGLDYACGEGGADCHPIQPGSTCFDPNTLEAHASFAFNSYFQKKGR  436

Query  557  TDVACSFGGVGVRTNKNPSYDNC  489
                C FGG      + P Y  C
Sbjct  437  AIGTCFFGGAAYIVTQKPKYGKC  459



>ref|XP_003519328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN41067.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   + T +Y L  T  GAV     AN TS+N T+CIA   A 
Sbjct  315  LYNEDMKPGPLSEKNWGLFDANGTPIYILHLTESGAV----LANDTSNN-TFCIAKDGAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G V+CS +   QPC+EPDN+++HA++AF++YY + G T  AC F G
Sbjct  370  PKMLQAALDWACGPGKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNG  429

Query  530  VGVRTNKNPSYDNCLY  483
            V   +  +PS+ +CL+
Sbjct  430  VATISTSDPSHGSCLF  445



>ref|XP_009784559.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13 [Nicotiana sylvestris]
Length=188

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A + A + DL+NAL+WACG G  DC  IQ   PCFEPD L+SHASFAFN YYQQNG
Sbjct  53   TWCVARAGAPQFDLQNALDWACGLGMADCRPIQAGGPCFEPDTLLSHASFAFNDYYQQNG  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG  + T  NPS++ C+Y
Sbjct  113  NSDIACNFGGTAMLTKSNPSHEKCIY  138



>ref|NP_194413.2| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEE85258.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=455

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 81/137 (59%), Gaps = 3/137 (2%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDV---STGANLTSSNGTWCIASS  720
            LFNEN+KPG  SERN+GL +P++  VYN+ FT K    V        +T    TWC+++ 
Sbjct  313  LFNENQKPGPTSERNYGLFYPNEGKVYNVPFTKKSTTPVNGNRGKVPVTHEGHTWCVSNG  372

Query  719  TASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACS  540
              ++  L+ AL++ACG G  DC  IQP   C+ P++L +HAS+AFNSYYQ+N      C 
Sbjct  373  EVAKEKLQEALDYACGEGGADCRPIQPGATCYHPESLEAHASYAFNSYYQKNSRRVGTCF  432

Query  539  FGGVGVRTNKNPSYDNC  489
            FGG      + P Y  C
Sbjct  433  FGGAAHVVTQPPRYGKC  449



>gb|AFU52644.1| beta-1,3-glucanase 9 [Solanum tuberosum]
Length=181

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  761  NLTSSNGT-WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAF  585
            N+T   GT WC+A + A + DL+NAL+WACG G  DC  IQ   PCFEP+ L+SHASFAF
Sbjct  15   NITFLGGTTWCVARAGARQFDLQNALDWACGLGMADCRPIQTGGPCFEPNTLLSHASFAF  74

Query  584  NSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            N+YYQQNG +D+AC+FGG  + T  NPS++ C+Y+
Sbjct  75   NTYYQQNGNSDIACNFGGTAMLTKINPSHEKCIYV  109



>ref|NP_178637.2| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEC05971.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=472

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 82/153 (54%), Gaps = 19/153 (12%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNG----------  741
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G      G +   + G          
Sbjct  314  LFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTGGDQVTKPPMSG  373

Query  740  ---------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFA  588
                     TWC+A+  A E  L+  L++ACG G  DC  IQP   C+ PD L +HASFA
Sbjct  374  GVSKSLNGYTWCVANGDAGEERLQGGLDYACGEGGADCRPIQPGANCYSPDTLEAHASFA  433

Query  587  FNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            FNSYYQ+ G    +C FGG     ++ P Y  C
Sbjct  434  FNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRC  466



>gb|ACL53837.1| unknown [Zea mays]
Length=282

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 87/156 (56%), Gaps = 23/156 (15%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT------------------GKGAVDVST-  768
            LFNEN+KPG  SERN+G+ +P+Q  VY+++F                   G GA   ST 
Sbjct  122  LFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLGWQENGGGASSTSTN  181

Query  767  ---GANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHA  597
               G  +T+    WC+A++ A E  L+ AL++ACG G  DC AIQP   CFEP+ +V+HA
Sbjct  182  PPSGVKVTTGE-AWCVANAMAGEHRLQAALDYACGPGGADCKAIQPGAACFEPNTMVAHA  240

Query  596  SFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            S+AFN YYQ+ G +   C F G     N+ P    C
Sbjct  241  SYAFNDYYQRKGRSIGTCDFAGAAYVVNQAPKMGKC  276



>ref|XP_009402144.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=173

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A   AS+ DLENAL+WACG G  DCS++QP   C++PD L+SHAS+AFNSYYQ NG
Sbjct  54   TWCVAHPGASQFDLENALDWACGVGGADCSSVQPGAACYQPDTLLSHASYAFNSYYQHNG  113

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLYM  480
             +DVAC+FGG    T+++PSY +C Y+
Sbjct  114  NSDVACNFGGTATITSRDPSYGSCKYL  140



>ref|XP_006575486.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=505

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   + T +Y L  T  GAV     AN TS+N T+CIA   A 
Sbjct  322  LYNEDMKPGPLSEKNWGLFDANGTPIYILHLTESGAV----LANDTSNN-TFCIAKDGAD  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G V+CS +   QPC+EPDN+++HA++AF++YY + G T  AC F G
Sbjct  377  PKMLQAALDWACGPGKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNG  436

Query  530  VGVRTNKNPSYDNCLY  483
            V   +  +PS+ +CL+
Sbjct  437  VATISTSDPSHGSCLF  452



>ref|XP_004306417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Fragaria 
vesca subsp. vesca]
Length=173

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ DL+NAL+WACG G  DC AIQ   PC++PD L+SHASFAFNSYYQQNG
Sbjct  54   TWCVALAGVSQVDLQNALDWACGLGMADCKAIQDGGPCYDPDTLLSHASFAFNSYYQQNG  113

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  C+Y
Sbjct  114  NSDIACNFGGTAAVTKYNPSYGKCVY  139



>ref|XP_009137621.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=465

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 83/139 (60%), Gaps = 3/139 (2%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTG---ANLTSSNGTWCIASS  720
            LFNEN+KPG  SERN+GL +P++  VY + F    +  V+     A +     TWC+++ 
Sbjct  323  LFNENQKPGPTSERNYGLFYPNERKVYAVPFAATTSTPVNRNKEQAPVAHEGETWCVSNG  382

Query  719  TASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACS  540
             A++  L+ AL++ACG G  DC  IQP   C+ P +L +HASFAFNSYYQ+N   D  C 
Sbjct  383  DAAKEKLQAALDYACGEGGADCRPIQPGATCYHPKSLEAHASFAFNSYYQKNARRDGTCY  442

Query  539  FGGVGVRTNKNPSYDNCLY  483
            FGG      ++P Y  C +
Sbjct  443  FGGTAHVVTQHPRYGKCKF  461



>ref|XP_004135538.1| PREDICTED: major pollen allergen Ole e 10 [Cucumis sativus]
Length=172

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHASFAFNSYYQQNG
Sbjct  48   TWCVAKAGVSQIDLQNALDWACGMGKADCRAIQKGGRCYEPDTLLSHASFAFNSYYQQNG  107

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T K+PSY  C Y
Sbjct  108  NSDIACNFGGCATLTKKDPSYGKCDY  133



>gb|AIR93909.1| glucanase [Cicer arietinum]
Length=454

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ + G  SE+NWGL + D   VY L   G G +     AN T+ N T+C+  S A 
Sbjct  318  LYNEDLRSGEVSEKNWGLFYADGEPVYTLHLAGAGVI----FANDTT-NQTFCVTKSNAD  372

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS +   QPC+EPDN+V+HA++AFN+YYQ+   +   C F G
Sbjct  373  TKMLQAALDWACGPGKVDCSPLLQGQPCYEPDNVVAHAAYAFNAYYQKMAKSPGTCDFKG  432

Query  530  VGVRTNKNPSYDNCLY  483
            V V T  +PS+ +C++
Sbjct  433  VAVITTTDPSHGSCVF  448



>ref|XP_004503372.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cicer arietinum]
Length=501

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ + G  SE+NWGL + D   VY L   G G +     AN T+ N T+C+  S A 
Sbjct  318  LYNEDLRSGEVSEKNWGLFYADGEPVYTLHLAGAGVI----FANDTT-NQTFCVTKSNAD  372

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS +   QPC+EPDN+V+HA++AFN+YYQ+   +   C F G
Sbjct  373  TKMLQAALDWACGPGKVDCSPLLQGQPCYEPDNVVAHAAYAFNAYYQKMAKSPGTCDFKG  432

Query  530  VGVRTNKNPSYDNCLY  483
            V V T  +PS+ +C++
Sbjct  433  VAVITTTDPSHGSCVF  448



>gb|EPS65983.1| hypothetical protein M569_08793, partial [Genlisea aurea]
Length=459

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 85/134 (63%), Gaps = 5/134 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG ESERNWGL   D   VY L  T  G +     AN T+ + T+C+A   A 
Sbjct  294  LYNEDLKPGPESERNWGLFQADGKPVYALQLTQSGDL----LANDTTRD-TYCVAREDAD  348

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS++   QPC+EPD++ SH+S+AFN+YY   G  D +C+F G
Sbjct  349  RKMLQAALDWACGPGKVDCSSLVQGQPCYEPDDVASHSSYAFNAYYHSMGMADGSCNFNG  408

Query  530  VGVRTNKNPSYDNC  489
            V   T  +PS+ +C
Sbjct  409  VAAITTTDPSHGSC  422



>ref|XP_004490818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Cicer arietinum]
Length=448

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG+ SE+NWGL   +   +Y L  TG GAV     AN TS N T+C+A   A 
Sbjct  315  LYNEDTKPGVLSEKNWGLFDANGVPIYILHLTGSGAV----LANDTS-NQTFCVAKDGAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               ++ AL+WACG G V+C  +   QPC+EPDN+++HA++AF+SYY + G T  +C F G
Sbjct  370  PKMIQAALDWACGPGKVECDLLLQGQPCYEPDNVIAHANYAFDSYYHKMGNTPDSCDFKG  429

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  430  VATITTSDPSHGSCIF  445



>ref|XP_006407197.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407198.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407199.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48650.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48651.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48652.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
Length=500

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 83/136 (61%), Gaps = 9/136 (7%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE++  G  SERNWG+ FP+ TSVY L  T       S G+ L      +C+A + A 
Sbjct  314  LYNEDKLSGPVSERNWGILFPNGTSVYPLGLTDGSE---SAGSTL------FCVAKADAE  364

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E +LE  LNWACG G  +C+ IQP Q CF P+++ SHASFA+N YYQ+  +T   C F G
Sbjct  365  EDELEGGLNWACGQGGANCALIQPGQACFFPNDIKSHASFAYNDYYQKKKSTGGTCDFSG  424

Query  530  VGVRTNKNPSYDNCLY  483
              + T ++PSY  C Y
Sbjct  425  TAITTTRDPSYKTCAY  440



>ref|NP_001275111.1| glucan endo-1,3-beta-glucosidase 12-like precursor [Solanum tuberosum]
 gb|AFU52640.1| beta-1,3-glucanase 5 [Solanum tuberosum]
Length=477

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 84/143 (59%), Gaps = 13/143 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGA---VD----------VSTGANLTS  750
            LFNEN+KPG  SERN+GL +P++  VYN+  T +G    VD             G  +  
Sbjct  316  LFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRLPVAGDQRTEKGGKVNV  375

Query  749  SNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQ  570
            S  TWC+AS  A +  L+ AL++ACG G  DC +IQP   C+ P+ L +HASFAFNSYYQ
Sbjct  376  SGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSYYQ  435

Query  569  QNGATDVACSFGGVGVRTNKNPS  501
            + G    +C FGG     ++ PS
Sbjct  436  KKGRAMGSCYFGGAAFIVHQQPS  458



>ref|XP_011085458.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=464

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 84/143 (59%), Gaps = 9/143 (6%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAV---DVSTGA-----NLTSSNG-T  738
            LFNEN+KPG  SERN+GL +P+Q  VY++  T +G     D+ +        ++++NG T
Sbjct  316  LFNENKKPGPTSERNFGLFYPNQKKVYDIPLTAEGLKSYRDIQSPVTGGEQRVSTANGQT  375

Query  737  WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGA  558
            WC+A   A +    + L++ACG G  DC  IQP   CF+P+ L +HASFAFNSYYQ+ G 
Sbjct  376  WCVAKEEAGKEKQSSGLDYACGEGGADCHPIQPGSTCFDPNTLEAHASFAFNSYYQKKGR  435

Query  557  TDVACSFGGVGVRTNKNPSYDNC  489
                C FGG      + P Y  C
Sbjct  436  AIGTCYFGGAAYIVTQQPKYGKC  458



>ref|XP_004490817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Cicer arietinum]
Length=498

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG+ SE+NWGL   +   +Y L  TG GAV     AN TS N T+C+A   A 
Sbjct  315  LYNEDTKPGVLSEKNWGLFDANGVPIYILHLTGSGAV----LANDTS-NQTFCVAKDGAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               ++ AL+WACG G V+C  +   QPC+EPDN+++HA++AF+SYY + G T  +C F G
Sbjct  370  PKMIQAALDWACGPGKVECDLLLQGQPCYEPDNVIAHANYAFDSYYHKMGNTPDSCDFKG  429

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  430  VATITTSDPSHGSCIF  445



>ref|XP_010465199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010465200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 87/138 (63%), Gaps = 10/138 (7%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGT--WCIASST  717
            L++E+++ G  SE+NWG+ FP+ TSVY L  +G        G+N  S NG+  +C+A + 
Sbjct  317  LYSEDKRTGPVSEKNWGILFPNGTSVYPLSLSG--------GSNSASVNGSSMFCVAKAD  368

Query  716  ASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSF  537
            A +  L + LNWACG G  +C+AIQP  PC+ P+N+ SHASFA+N Y+Q+  +    C F
Sbjct  369  ADDDKLVDGLNWACGQGQANCAAIQPGHPCYLPNNVKSHASFAYNDYFQKMKSAGGTCDF  428

Query  536  GGVGVRTNKNPSYDNCLY  483
             G  + T ++PSY  C Y
Sbjct  429  SGTAITTTRDPSYKTCAY  446



>ref|XP_007159617.1| hypothetical protein PHAVU_002G252400g [Phaseolus vulgaris]
 gb|ESW31611.1| hypothetical protein PHAVU_002G252400g [Phaseolus vulgaris]
Length=175

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ DL+NAL+WACG G  +C AIQ   PCFEP  LVSHASFAFNSY+Q NG
Sbjct  53   TWCVALAGVSQGDLQNALDWACGLGMANCKAIQQGGPCFEPQTLVSHASFAFNSYFQTNG  112

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T +NPSY  C+Y
Sbjct  113  NSDIACNFGGTAALTKRNPSYGKCVY  138



>gb|ACF79018.1| unknown [Zea mays]
 gb|ACF86741.1| unknown [Zea mays]
 gb|ACN33486.1| unknown [Zea mays]
 gb|AFW73667.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=481

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 87/156 (56%), Gaps = 23/156 (15%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT------------------GKGAVDVST-  768
            LFNEN+KPG  SERN+G+ +P+Q  VY+++F                   G GA   ST 
Sbjct  321  LFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLGWQENGGGASSTSTN  380

Query  767  ---GANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHA  597
               G  +T+    WC+A++ A E  L+ AL++ACG G  DC AIQP   CFEP+ +V+HA
Sbjct  381  PPSGVKVTTGE-AWCVANAMAGEHRLQAALDYACGPGGADCKAIQPGAACFEPNTMVAHA  439

Query  596  SFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            S+AFN YYQ+ G +   C F G     N+ P    C
Sbjct  440  SYAFNDYYQRKGRSIGTCDFAGAAYVVNQAPKMGKC  475



>ref|NP_001136613.1| uncharacterized protein LOC100216736 precursor [Zea mays]
 gb|ACF82271.1| unknown [Zea mays]
 gb|ACN31778.1| unknown [Zea mays]
 gb|ACR35803.1| unknown [Zea mays]
 gb|ACR36343.1| unknown [Zea mays]
Length=481

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 87/156 (56%), Gaps = 23/156 (15%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT------------------GKGAVDVST-  768
            LFNEN+KPG  SERN+G+ +P+Q  VY+++F                   G GA   ST 
Sbjct  321  LFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLGWQENGGGASSTSTN  380

Query  767  ---GANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHA  597
               G  +T+    WC+A++ A E  L+ AL++ACG G  DC AIQP   CFEP+ +V+HA
Sbjct  381  PPSGVKVTTGE-AWCVANAMAGEHRLQAALDYACGPGGADCKAIQPGAACFEPNTMVAHA  439

Query  596  SFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            S+AFN YYQ+ G +   C F G     N+ P    C
Sbjct  440  SYAFNDYYQRKGRSIGTCDFAGAAYVVNQAPKMGKC  475



>ref|XP_002962275.1| hypothetical protein SELMODRAFT_76256, partial [Selaginella moellendorffii]
 gb|EFJ37535.1| hypothetical protein SELMODRAFT_76256, partial [Selaginella moellendorffii]
Length=410

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 78/130 (60%), Gaps = 9/130 (7%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+ + G  S RNWGL  PD T VYNLDF     V           N ++C+A+  AS
Sbjct  290  LFNEDLREGPTSNRNWGLFKPDGTKVYNLDFGNSVVVQ---------RNRSFCVANPNAS  340

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
              DL+ AL+WACG G+ DC AIQP Q C+ PD + SHAS+AFNSY+Q NG    AC F G
Sbjct  341  FTDLQIALDWACGPGHADCQAIQPGQSCYLPDTVASHASYAFNSYFQSNGMDPSACDFSG  400

Query  530  VGVRTNKNPS  501
                T  +PS
Sbjct  401  AAAVTIADPS  410



>ref|XP_007142328.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
 gb|ESW14322.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
Length=466

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 13/149 (9%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGA------------VDVSTGANLTSS  747
            LFNEN+K G  SERN+GL +P +  VY++    +G             V  S   + TS 
Sbjct  314  LFNENQKTGPTSERNYGLFYPSEKKVYDIPLKAEGVTEAPSSGVEKSQVPASGEVSTTSR  373

Query  746  NG-TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQ  570
            +G TWC+A+  ASE  L+N LN+ACG G  DCSAIQP   C+ P+ L +HAS+AFNSYYQ
Sbjct  374  DGQTWCVANGGASEEKLQNGLNYACGEGGADCSAIQPDATCYNPNTLEAHASYAFNSYYQ  433

Query  569  QNGATDVACSFGGVGVRTNKNPSYDNCLY  483
            +       C FGG        P Y +C +
Sbjct  434  KKARAAGTCDFGGTAYVVTHPPKYGSCEF  462



>ref|XP_002305879.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE86390.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=491

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   +   VY L  TG G V  +      ++N T+C A   A 
Sbjct  308  LYNEDLKPGPVSEKNWGLFNANGEPVYILHLTGSGLVLAND-----TTNQTYCTAKQGAD  362

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   +PC++PDN+++HA++AFNSYY Q G     C F G
Sbjct  363  PKMLQAALDWACGPGKVDCSAMLQGEPCYQPDNVIAHATYAFNSYYNQMGKAPGTCDFNG  422

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  NPS+  C++
Sbjct  423  VAAITTTNPSHGTCVF  438



>ref|XP_008460530.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Cucumis 
melo]
Length=463

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SERNWGL   +   VY L  TG G V  +      ++N T+C A     
Sbjct  281  LYNEDLKPGPISERNWGLFDANGKPVYILRLTGSGLVLAND-----TTNQTYCAAKEGVD  335

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   QPC+EPDN+++HA++AFN+YY Q G    +C F G
Sbjct  336  PRMLQAALDWACGPGRVDCSALLQGQPCYEPDNVMAHATYAFNTYYLQMGKASGSCDFNG  395

Query  530  VGVRTNKNPSYDNC  489
            V   T  NPS+ +C
Sbjct  396  VAAVTTTNPSHGSC  409



>ref|XP_009102359.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
 ref|XP_009102360.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=473

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 82/154 (53%), Gaps = 20/154 (13%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNG----------  741
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G      G + T + G          
Sbjct  314  LFNENKKFGPTSERNYGLFFPDEKKVYDIPFTQEGLKHYRDGGHNTPATGDQQVTPPNNG  373

Query  740  ----------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASF  591
                      TWC+A+  A +  L+  L++ACG G  DC  IQ   PC+ PD L +HASF
Sbjct  374  GGVSKSLTGSTWCVANGDAGKDRLQGGLDYACGDGGADCRPIQRGAPCYSPDTLEAHASF  433

Query  590  AFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            AFNSYYQ+ G    +C FGG      + P Y  C
Sbjct  434  AFNSYYQKKGRAGGSCYFGGAAYVVTQPPKYGRC  467



>ref|XP_002876767.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53026.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL + + T VY L   G GA+     AN T+ N T+CIA     
Sbjct  314  LYNEDTRPGPISEKNWGLFYTNGTPVYTLRLAGAGAI----LANDTT-NQTFCIAKEKVD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   + C+EPD++V+H+++AFN+YYQ+ G    +C F G
Sbjct  369  KKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS   C++
Sbjct  429  VATVTTTDPSRGTCVF  444



>ref|XP_008460531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Cucumis 
melo]
Length=481

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SERNWGL   +   VY L  TG G V  +      ++N T+C A     
Sbjct  299  LYNEDLKPGPISERNWGLFDANGKPVYILRLTGSGLVLAND-----TTNQTYCAAKEGVD  353

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   QPC+EPDN+++HA++AFN+YY Q G    +C F G
Sbjct  354  PRMLQAALDWACGPGRVDCSALLQGQPCYEPDNVMAHATYAFNTYYLQMGKASGSCDFNG  413

Query  530  VGVRTNKNPSYDNC  489
            V   T  NPS+ +C
Sbjct  414  VAAVTTTNPSHGSC  427



>ref|XP_006372566.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP50363.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=481

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   +   +Y L  TG G V  +      ++N T+C A   A 
Sbjct  300  LYNEDLKPGPVSEKNWGLFNANGEPIYILHLTGAGLVLAND-----TTNQTYCTAKEGAD  354

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G V+CSAI   +PC+EPDN+++HA++AFNSYY + G     C F G
Sbjct  355  PKMLQAALDWACGPGKVNCSAILQGEPCYEPDNVIAHATYAFNSYYSRMGKAPGTCDFNG  414

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  NPS+  CL+
Sbjct  415  VAAITTTNPSHGTCLF  430



>ref|XP_004297451.2| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 85/135 (63%), Gaps = 5/135 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   +   VY L  TG G V     AN T+ N T+C+A   A 
Sbjct  320  LYNEDLRPGSVSEKNWGLFDANGLPVYTLHLTGAGTV----LANDTT-NQTFCVAKDGAD  374

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS +   QPC+EPDN+V+HA++AFN+YYQ+   +   C F G
Sbjct  375  RKMLQAALDWACGPGKVDCSPMLQGQPCYEPDNVVTHATYAFNAYYQKMAKSPGTCDFKG  434

Query  530  VGVRTNKNPSYDNCL  486
            V   T  +PS+ +C+
Sbjct  435  VATITTTDPSHGSCI  449



>ref|NP_565269.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
 sp|Q9ZU91.2|E133_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 3; AltName: Full=(1->3)-beta-glucan 
endohydrolase 3; Short=(1->3)-beta-glucanase 
3; AltName: Full=Beta-1,3-endoglucanase 3; Short=Beta-1,3-glucanase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD12708.2| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM62724.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC05475.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
Length=501

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL + + T VY L   G GA+     AN T+ N T+CIA     
Sbjct  314  LYNEDTRPGPVSEKNWGLFYTNGTPVYTLRLAGAGAI----LANDTT-NQTFCIAKEKVD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   + C+EPD++V+H+++AFN+YYQ+ G    +C F G
Sbjct  369  RKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS   C++
Sbjct  429  VATVTTTDPSRGTCVF  444



>ref|XP_011023912.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Populus 
euphratica]
Length=498

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   D   VY L  TG G V  +      ++N T+C+A   A 
Sbjct  314  LYNEDLRPGALSEKNWGLFDADGMPVYTLHLTGAGTVLAND-----TTNQTFCVAKEGAD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS +   QPC+EPDN+V+H+++AFN+Y+Q+   +   C F G
Sbjct  369  PKMLQAALDWACGPGKVDCSYLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  429  VATITTTDPSHGSCIF  444



>ref|XP_011007238.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Populus euphratica]
 ref|XP_011007239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Populus euphratica]
Length=505

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   +   VY L  TG G V  +      ++N T+C A   A 
Sbjct  322  LYNEDLKPGPVSEKNWGLFNANGEPVYILHLTGSGLVLAND-----TTNQTYCTAKQGAD  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   +PC++PDN+++HA++AFNSYY Q G     C F G
Sbjct  377  PKMLQAALDWACGPGKVDCSAMLQGEPCYQPDNVIAHATYAFNSYYNQMGKAPGTCDFNG  436

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  NPS+  C++
Sbjct  437  VAAITTTNPSHGTCVF  452



>ref|XP_011001568.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Populus euphratica]
Length=503

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   +   +Y L  TG G V  +      ++N T+C A   A 
Sbjct  322  LYNEDLKPGPVSEKNWGLFNANGEPIYILHLTGAGLVLAND-----TTNQTYCTAKEGAD  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G V+CSAI   +PC+EPDN+++HA++AFNSYY + G     C F G
Sbjct  377  PKMLQAALDWACGPGKVNCSAILQGEPCYEPDNVIAHATYAFNSYYSRMGKAPGTCDFNG  436

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  NPS+  CL+
Sbjct  437  VAAITTTNPSHGTCLF  452



>ref|XP_001752749.1| predicted protein [Physcomitrella patens]
 gb|EDQ82253.1| predicted protein, partial [Physcomitrella patens]
Length=434

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 81/137 (59%), Gaps = 7/137 (5%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTG-------KGAVDVSTGANLTSSNGTWC  732
            L+NEN KPG  SER +GL   DQ+ VYN+  TG         A     G   T +  TWC
Sbjct  297  LYNENLKPGAVSERFYGLFNVDQSPVYNVGLTGGSTRNPPPAAPSPVGGGEFTIAGKTWC  356

Query  731  IASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATD  552
            +A + A E D+ NALN+ACG G  DCSAIQP   C+ P+ LV+HASFAFN YY + GA  
Sbjct  357  VAKAGAPEQDMLNALNYACGVGTTDCSAIQPGAMCYFPNTLVAHASFAFNEYYHKFGANY  416

Query  551  VACSFGGVGVRTNKNPS  501
              C F G  + +N +PS
Sbjct  417  YNCYFNGTAIISNSDPS  433



>gb|ACF88240.1| unknown [Zea mays]
Length=481

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 87/156 (56%), Gaps = 23/156 (15%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT------------------GKGAVDVST-  768
            LFNEN+KPG  SERN+G+ +P+Q  VY+++F                   G GA   ST 
Sbjct  321  LFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLGWQENGGGASSTSTN  380

Query  767  ---GANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHA  597
               G  +T+    WC+A++ A E  L+ AL++ACG G  DC AIQP   CFEP+ +V+HA
Sbjct  381  PPSGVKVTTGE-AWCVANAMAGEHRLQAALDYACGPGGADCKAIQPGAACFEPNTMVAHA  439

Query  596  SFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            S+AFN YYQ+ G +   C F G     N+ P    C
Sbjct  440  SYAFNDYYQRKGRSIGTCDFAGAACVVNQAPKMGKC  475



>emb|CDY46679.1| BnaA03g48290D [Brassica napus]
Length=446

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 10/136 (7%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNEN+KPG  SERN+GL +P++  VY + F           A  ++   TWC+++  A+
Sbjct  317  LFNENQKPGPTSERNYGLFYPNERKVYAVPF----------AATTSTPGETWCVSNGDAA  366

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL++ACG G  DC  IQP   C+ P +L +HASFAFNSYYQ+N   D  C FGG
Sbjct  367  KEKLQAALDYACGEGGADCRPIQPGATCYHPKSLEAHASFAFNSYYQKNARRDGTCYFGG  426

Query  530  VGVRTNKNPSYDNCLY  483
                  ++P Y  C +
Sbjct  427  TAHVVTQHPRYGKCKF  442



>ref|XP_010542461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
 ref|XP_010542462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=509

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 6/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+++PG  SERNWG+ +P+ + VY L   G    +   G+ +      +C+A   A 
Sbjct  317  LYNEDKRPGPVSERNWGMFYPNGSMVYRLSLGGSDQAESLNGSVV------FCVAKDDAD  370

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L++ LNWACG G  +CSAIQP +PC+ PDNL SHASFA+N YYQ+      +C F G
Sbjct  371  PEKLQDGLNWACGRGQANCSAIQPGRPCYLPDNLKSHASFAYNDYYQKMKNAGGSCDFDG  430

Query  530  VGVRTNKNPSYDNCLY  483
                T ++PSY  C +
Sbjct  431  TATTTTRDPSYGTCRF  446



>ref|XP_006647977.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Oryza brachyantha]
Length=487

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 84/162 (52%), Gaps = 28/162 (17%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT-------------------------GKG  786
            LFNEN+KPG  SERN+G+ +P+Q  VY+++F                          G G
Sbjct  320  LFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGNSAGSSSSKGNGGLGWQDNGGVGSG  379

Query  785  A---VDVSTGANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPD  615
            +        G   TS+   WC+A++   E  L+ AL++ACG G  DC AIQP   CFEP+
Sbjct  380  SNAPTGAGGGVKATSTGEAWCVANAMVGEERLQKALDYACGPGGADCKAIQPGAACFEPN  439

Query  614  NLVSHASFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
             +VSHAS+AFN YYQ+ G T   C F G     N+ P    C
Sbjct  440  TMVSHASYAFNDYYQRKGRTIGTCDFAGAAYVVNQAPKMGKC  481



>ref|XP_007041111.1| Carbohydrate-binding X8 domain superfamily protein isoform 3 
[Theobroma cacao]
 gb|EOX96942.1| Carbohydrate-binding X8 domain superfamily protein isoform 3 
[Theobroma cacao]
Length=154

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD LVSHAS+AFN+YYQQNG
Sbjct  32   TWCVALAGVSQIDLQNALDWACGLGMADCIAIQEGGQCYEPDTLVSHASYAFNNYYQQNG  91

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  CLY
Sbjct  92   NSDIACNFGGTATLTKNNPSYGKCLY  117



>ref|XP_002965189.1| hypothetical protein SELMODRAFT_82513, partial [Selaginella moellendorffii]
 gb|EFJ34027.1| hypothetical protein SELMODRAFT_82513, partial [Selaginella moellendorffii]
Length=410

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 78/130 (60%), Gaps = 9/130 (7%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+ + G  S RNWGL  PD T VYN+DF     V           N ++C+A+  AS
Sbjct  290  LFNEDLREGPTSNRNWGLFKPDGTKVYNIDFGNSIVVQ---------RNRSFCVANPNAS  340

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
              DL+ AL+WACG G+ DC AIQP Q C+ PD + SHAS+AFNSY+Q NG    AC F G
Sbjct  341  FTDLQIALDWACGPGHADCQAIQPGQSCYLPDTVASHASYAFNSYFQSNGMDPSACDFSG  400

Query  530  VGVRTNKNPS  501
                T  +PS
Sbjct  401  AAAVTIADPS  410



>gb|KJB66065.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66068.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=458

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+++PG  SE+NWG+ + + T+V+ L F+G   +       + ++   +C+A   AS
Sbjct  281  LFNEDKRPGPVSEKNWGVLYTNGTAVFPLSFSGSSQI-------MGNATTVFCVAKDDAS  333

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L++ LNWACG G  +CS IQ  QPC+ P+N  +HAS+A+N YYQ+       C FGG
Sbjct  334  EGKLQDGLNWACGQGQANCSVIQSGQPCYLPNNTKNHASYAYNDYYQRMHTVGATCDFGG  393

Query  530  VGVRTNKNPSYDNCLY  483
                T+ +PSY +C++
Sbjct  394  TATITSNDPSYRSCIF  409



>ref|XP_006395867.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33153.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=516

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   + T VY L   G GA+     AN T+ N T+CIA     
Sbjct  330  LYNEDTRPGPVSEKNWGLFHTNGTPVYTLRLAGAGAI----LANDTT-NQTFCIAKEKVD  384

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   + C+EPD++V+H+++AFN+YYQ+ G    +C F G
Sbjct  385  KKMLQAALDWACGPGKVDCSALMQGEACYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKG  444

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS   C++
Sbjct  445  VATVTTTDPSRGTCVF  460



>ref|XP_007041109.1| Carbohydrate-binding X8 domain superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOX96940.1| Carbohydrate-binding X8 domain superfamily protein isoform 1 
[Theobroma cacao]
Length=191

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD LVSHAS+AFN+YYQQNG
Sbjct  69   TWCVALAGVSQIDLQNALDWACGLGMADCIAIQEGGQCYEPDTLVSHASYAFNNYYQQNG  128

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  CLY
Sbjct  129  NSDIACNFGGTATLTKNNPSYGKCLY  154



>gb|KJB66066.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66067.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66069.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=494

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+++PG  SE+NWG+ + + T+V+ L F+G   +       + ++   +C+A   AS
Sbjct  317  LFNEDKRPGPVSEKNWGVLYTNGTAVFPLSFSGSSQI-------MGNATTVFCVAKDDAS  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L++ LNWACG G  +CS IQ  QPC+ P+N  +HAS+A+N YYQ+       C FGG
Sbjct  370  EGKLQDGLNWACGQGQANCSVIQSGQPCYLPNNTKNHASYAYNDYYQRMHTVGATCDFGG  429

Query  530  VGVRTNKNPSYDNCLY  483
                T+ +PSY +C++
Sbjct  430  TATITSNDPSYRSCIF  445



>ref|XP_006395869.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33155.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=483

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   + T VY L   G GA+     AN T+ N T+CIA     
Sbjct  297  LYNEDTRPGPVSEKNWGLFHTNGTPVYTLRLAGAGAI----LANDTT-NQTFCIAKEKVD  351

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   + C+EPD++V+H+++AFN+YYQ+ G    +C F G
Sbjct  352  KKMLQAALDWACGPGKVDCSALMQGEACYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKG  411

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS   C++
Sbjct  412  VATVTTTDPSRGTCVF  427



>gb|ACR35980.1| unknown [Zea mays]
Length=488

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 87/152 (57%), Gaps = 23/152 (15%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT------------------GKGAVDVST-  768
            LFNEN+KPG  SERN+G+ +P+Q  VY+++F                   G GA   ST 
Sbjct  321  LFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLGWQENGGGASSTSTN  380

Query  767  ---GANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHA  597
               G  +T+    WC+A++ A E  L+ AL++ACG G  DC AIQP   CFEP+ +V+HA
Sbjct  381  PPSGVKVTTGE-AWCVANAMAGEHRLQAALDYACGPGGADCKAIQPGAACFEPNTMVAHA  439

Query  596  SFAFNSYYQQNGATDVACSFGGVGVRTNKNPS  501
            S+AFN YYQ+ G +   C F G     N+ PS
Sbjct  440  SYAFNDYYQRKGRSIGTCDFAGAAYVVNQAPS  471



>ref|XP_010066584.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Eucalyptus 
grandis]
 gb|KCW64517.1| hypothetical protein EUGRSUZ_G02118 [Eucalyptus grandis]
Length=499

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+++PG  SE+NWGL   +   +Y L  TG G V  +      ++N T+C+    A 
Sbjct  315  LYNEDQRPGSVSEKNWGLFDANGVPIYILHLTGAGTVLAND-----TTNQTFCVGKDGAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCS +   Q C+EPDN+V+HA++AFN+YYQ+ G     C F G
Sbjct  370  KKMLQAALDWACGPGKVDCSLLLQGQACYEPDNVVAHATYAFNAYYQKMGKALGTCDFKG  429

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  NPS+ +C++
Sbjct  430  VATVTTTNPSHGSCIF  445



>emb|CDP00829.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   +   VY L  TG G V  +      ++N T+C+A   A 
Sbjct  323  LYNEDLRPGSISEKNWGLFNANGVPVYILHLTGSGTVLAND-----TTNQTYCVAKEGAD  377

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDC+ +    PC++PD +V+HAS+AF++YY + G TD  C F G
Sbjct  378  KKLLQAALDWACGPGKVDCNPLMQGNPCYDPDTVVAHASYAFDAYYHKMGMTDGTCDFNG  437

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+++C++
Sbjct  438  VATVTTSDPSHNSCIF  453



>ref|XP_007141644.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
 gb|ESW13638.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
Length=473

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 90/157 (57%), Gaps = 21/157 (13%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTG-----------KG----------AVDV  774
            LFNEN+K G  SERN+GL +PD+  VYN+ FT            KG          A +V
Sbjct  313  LFNENQKSGPTSERNFGLFYPDEKRVYNVPFTAEELKDYHDSPVKGGSHNQTTQAPAPNV  372

Query  773  STGANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHAS  594
            S G + +++  TWC+A+  A +  L+ AL++ACG G  DC+ IQ    C++P+ +V+HAS
Sbjct  373  SGGVSKSTTGNTWCVANPDADKVKLQAALDFACGEGGADCAPIQHGATCYDPNTIVAHAS  432

Query  593  FAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLY  483
            FAFNSYYQ+      +C FGG      + P Y NC +
Sbjct  433  FAFNSYYQKQARKGGSCYFGGTSYVVTQEPRYGNCEF  469



>ref|XP_008444815.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=170

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A    S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHAS+AFNSYYQQNG
Sbjct  47   TWCVAKPGVSQIDLQNALDWACGMGKADCRAIQKGGRCYEPDTLLSHASYAFNSYYQQNG  106

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T K+PSY  C Y
Sbjct  107  NSDIACNFGGCATLTKKDPSYGKCDY  132



>ref|XP_007014685.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 ref|XP_007014686.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32304.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32305.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+++PG  SE+NWG+ F + T+VY L  +G   +   TG    +S   +C+A    S
Sbjct  317  LFNEDKRPGPASEKNWGVLFLNGTAVYPLSLSGSSQI---TG----NSTTVFCVAKDDTS  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            E  L++ LNWACG G  +CSAIQ  QPC+ P+N+ +HAS+A+N YYQ+  +    C F G
Sbjct  370  EDKLQDGLNWACGQGQANCSAIQSGQPCYLPNNIKNHASYAYNDYYQKMHSLGGTCDFDG  429

Query  530  VGVRTNKNPSYDNCLY  483
                T  NPSY +C++
Sbjct  430  TATTTTNNPSYGSCIF  445



>ref|XP_010552278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=507

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 83/136 (61%), Gaps = 6/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+++ G  SERNWG+ + + ++VY L  +G      S  A L  S G +C+A     
Sbjct  317  LYNEDKRSGPVSERNWGMFYSNGSAVYPLSLSG------SEPAALNGSGGVFCMAREETD  370

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L++ LNWACG G  +C+AIQ  QPC+ P+NL SHASFA+N YYQ+  +    C F G
Sbjct  371  PDKLQDGLNWACGQGRANCAAIQQGQPCYLPNNLKSHASFAYNDYYQKMRSVGGTCDFDG  430

Query  530  VGVRTNKNPSYDNCLY  483
              + T ++PSY  C+Y
Sbjct  431  TAITTTRDPSYGKCIY  446



>gb|KHG21190.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=470

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 88/152 (58%), Gaps = 16/152 (11%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKG----------------AVDVSTGAN  759
            LFNEN+KPG  SERN+GL +P++  VYN+  + KG                 V+   G +
Sbjct  315  LFNENQKPGPTSERNYGLFYPNEQRVYNIPLSQKGLNGNQSPPASNVNQTAPVNNGGGVS  374

Query  758  LTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNS  579
              +S  TWC+AS  A   +L+  L++ACG G  DC  IQP+  C+ P++LV+HAS+A+NS
Sbjct  375  KATSGQTWCMASPNAEAEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNS  434

Query  578  YYQQNGATDVACSFGGVGVRTNKNPSYDNCLY  483
            YYQ+      +C F G    + + PS+ NC +
Sbjct  435  YYQKKARVSGSCFFSGTAYVSTQRPSFGNCQF  466



>ref|XP_006430586.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
 gb|ESR43826.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
Length=497

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   +   VY L  TG G+V  +      ++N T+C A   A 
Sbjct  314  LYNEDNKPGPLSEKNWGLFDANGDPVYILHLTGSGSVLAND-----TTNQTYCTARDGAD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS +   QPC+EPDN+++HA++AF++YY Q      AC+F G
Sbjct  369  PKMLQAALDWACGPGKVDCSGLLQGQPCYEPDNVIAHATYAFDTYYHQMRKDPAACNFNG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  429  VAAITTSDPSHGSCIF  444



>gb|AAD26909.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM15281.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=473

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 84/156 (54%), Gaps = 19/156 (12%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNG----------  741
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G      G +   + G          
Sbjct  314  LFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTGGDQVTKPPMSG  373

Query  740  ---------TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFA  588
                     TWC+A+  A E  L+  L++ACG G  DC  IQP   C+ PD L +HASFA
Sbjct  374  GVSKSLNGYTWCVANGDAGEERLQGGLDYACGEGGADCRPIQPGANCYSPDTLEAHASFA  433

Query  587  FNSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLYM  480
            FNSYYQ+ G    +C FGG     ++ PS  N  ++
Sbjct  434  FNSYYQKKGRAGGSCYFGGAAYVVSQPPSKYNFFFV  469



>ref|XP_006596503.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=448

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ K G  SE+NWGL   + T +Y L  T  GAV     AN TS+N T+CIA   A 
Sbjct  315  LYNEDMKSGPLSEKNWGLFDANGTPIYILHLTESGAV----LANDTSNN-TFCIAKDGAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G V+CS +   QPC+EPDN+++HA++AF++YY + G T  AC F G
Sbjct  370  PKMLQAALDWACGPGKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNG  429

Query  530  VGVRTNKNPSYDNCLY  483
            V   +  +PS+ +CL+
Sbjct  430  VATISTSDPSHGSCLF  445



>ref|XP_007041110.1| Carbohydrate-binding X8 domain superfamily protein isoform 2, 
partial [Theobroma cacao]
 gb|EOX96941.1| Carbohydrate-binding X8 domain superfamily protein isoform 2, 
partial [Theobroma cacao]
Length=220

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD LVSHAS+AFN+YYQQNG
Sbjct  98   TWCVALAGVSQIDLQNALDWACGLGMADCIAIQEGGQCYEPDTLVSHASYAFNNYYQQNG  157

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  CLY
Sbjct  158  NSDIACNFGGTATLTKNNPSYGKCLY  183



>ref|XP_010412737.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 83/155 (54%), Gaps = 21/155 (14%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANL---------------  756
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G      G +                
Sbjct  313  LFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTGDHQVTTPPMSG  372

Query  755  -----TSSNG-TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHAS  594
                  S NG +WC+A+  A E  L+  L++ACG G  DC  IQP   C+ PD L +HAS
Sbjct  373  GGGVSKSLNGQSWCVANGDAGEERLQKGLDYACGEGGADCRPIQPGANCYSPDTLEAHAS  432

Query  593  FAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            FAFNSYYQ+ G    +C FGG     ++ P Y  C
Sbjct  433  FAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRC  467



>ref|XP_011097840.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Sesamum indicum]
Length=467

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 10/146 (7%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSN----------G  741
            LFNEN KPG  SERN+GL +P++  VYN+  T +G     +  N + S            
Sbjct  317  LFNENEKPGPTSERNYGLFYPNEQKVYNIPLTAEGLAGSPSMMNGSKSQVVAQPPSSVGQ  376

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A++ A E  L+ AL++ACG G  DC AIQP   C++P+ + +HAS+AFNSYYQ+N 
Sbjct  377  TWCVANAGAGEEKLQQALDYACGEGGADCGAIQPGATCYDPNTVEAHASYAFNSYYQRNA  436

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
                 C F G      ++P + +C +
Sbjct  437  RGSGTCDFAGAAYVVTQSPKFGSCEF  462



>ref|XP_010448205.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=457

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 1/135 (1%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVS-TGANLTSSNGTWCIASSTA  714
            LFNEN KPG  SERN+GL +P++  VY++ FT + A  V+  G  +   + TWC+++   
Sbjct  317  LFNENEKPGPTSERNYGLFYPNEGKVYDVPFTARSAFPVNGKGDEVPVVSSTWCVSNGEM  376

Query  713  SEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFG  534
            +   L+ AL++ACG G  DC  IQP   C+ P+ L +HAS+AFNSYYQ+N      C FG
Sbjct  377  ARDRLQAALDYACGEGGADCRPIQPGATCYHPETLEAHASYAFNSYYQKNARRVGTCYFG  436

Query  533  GVGVRTNKNPSYDNC  489
            G      + P +  C
Sbjct  437  GAAHVVTQPPRFGKC  451



>ref|XP_011628180.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Amborella 
trichopoda]
Length=498

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 5/134 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   D + VY L  T  G V  +      ++N T+C+A S A 
Sbjct  315  LYNEDARPGPMSEKNWGLFNADGSPVYTLHLTDSGVVLAND-----TTNQTYCVAISGAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDC+ +   QPC++PDN+ SHAS+AF++YY + G     C F G
Sbjct  370  KKLLQAALDWACGPGKVDCTPLLQGQPCYDPDNVESHASYAFDTYYHKMGMAVGTCDFKG  429

Query  530  VGVRTNKNPSYDNC  489
            V   T  +PS+D+C
Sbjct  430  VATVTTTDPSHDSC  443



>ref|XP_002274294.2| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Vitis vinifera]
Length=177

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -3

Query  761  NLTSSNGT-WCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAF  585
            N T  +GT WC+A    S+ DL+NAL+WACG G  DC AIQ    CFEPD LVSHAS+AF
Sbjct  48   NTTFLDGTNWCVALPGVSQVDLQNALDWACGLGMADCGAIQAGGACFEPDTLVSHASYAF  107

Query  584  NSYYQQNGATDVACSFGGVGVRTNKNPSYDNCLY  483
            NSYYQQNG +D+AC+FGG    + K+PSY  C Y
Sbjct  108  NSYYQQNGNSDIACNFGGTATLSKKDPSYGKCSY  141



>ref|XP_003544983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN39465.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ K G  SE+NWGL   + T +Y L  T  GAV     AN TS+N T+CIA   A 
Sbjct  315  LYNEDMKSGPLSEKNWGLFDANGTPIYILHLTESGAV----LANDTSNN-TFCIAKDGAD  369

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G V+CS +   QPC+EPDN+++HA++AF++YY + G T  AC F G
Sbjct  370  PKMLQAALDWACGPGKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNG  429

Query  530  VGVRTNKNPSYDNCLY  483
            V   +  +PS+ +CL+
Sbjct  430  VATISTSDPSHGSCLF  445



>ref|XP_010488778.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 83/155 (54%), Gaps = 21/155 (14%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANL---------------  756
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G      G +                
Sbjct  313  LFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTGDHQVTTPPMSG  372

Query  755  -----TSSNG-TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHAS  594
                  S NG +WC+A+  A E  L+  L++ACG G  DC  IQP   C+ PD L +HAS
Sbjct  373  GGGVSKSLNGQSWCVANGDAGEERLQGGLDYACGEGGADCRPIQPGANCYSPDTLEAHAS  432

Query  593  FAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            FAFNSYYQ+ G    +C FGG     ++ P Y  C
Sbjct  433  FAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRC  467



>gb|AAK85402.2| beta-1,3-glucanase [Camellia sinensis]
Length=495

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   +   +Y L  TG G+V  +  AN      T+C A   A 
Sbjct  313  LYNEDMKPGPLSEKNWGLFDANGVPIYILHLTGSGSVLANDTAN-----QTYCTAKDGAD  367

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G V+CSA+   QPC+EPD + +HA++AF++YYQQ G     C F G
Sbjct  368  AKMLQAALDWACGPGKVNCSALLQGQPCYEPDTVAAHATYAFDTYYQQMGKASGTCDFNG  427

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  NP++ +C++
Sbjct  428  VATITTTNPTHGSCVF  443



>ref|XP_007141916.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
 gb|ESW13910.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
Length=498

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   +   VY L  T  GA+  +      +SN T+CIA   A 
Sbjct  314  LYNEDTKPGPISEKNWGLFDSNGAPVYILRLTESGALLAND-----TSNQTFCIAKDGAD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G V+CS +   QPC+EPDN+++HA++AF++YY + G T  AC F G
Sbjct  369  PKMLQAALDWACGPGKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   +  +PS+ +CL+
Sbjct  429  VATISTSDPSHGSCLF  444



>ref|XP_009351539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Pyrus x bretschneideri]
Length=498

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   D   VY L  TG G V  +      ++N T+C+A   + 
Sbjct  314  LYNEDLRPGSVSEKNWGLFNADGVPVYTLHLTGAGTVLAND-----TTNQTFCVAKEGSD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+  L+WACG G VDCS +   QPC+EPDN+++HA++AFN+Y+Q+       C F G
Sbjct  369  KKMLQAGLDWACGPGKVDCSPLLQGQPCYEPDNVLTHATYAFNAYFQRMAKAPGTCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  429  VATVTTTDPSHGSCIF  444



>ref|XP_002312452.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE89819.2| glucan endo-1 family protein [Populus trichocarpa]
Length=465

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   +   VY L  TG G V  +      ++N T+C+A   A 
Sbjct  281  LYNEDLRPGAISEKNWGLFDANGMPVYTLHLTGAGTVLAND-----TTNQTFCVAKEGAD  335

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCS +   QPC+EPDN+V+H+++AFN+Y+Q+   +   C F G
Sbjct  336  PKMLQAALDWACGPGKVDCSYLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKG  395

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+ +C++
Sbjct  396  VATITTTDPSHGSCIF  411



>gb|KJB47941.1| hypothetical protein B456_008G047800 [Gossypium raimondii]
Length=176

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHAS+AFN+YYQQNG
Sbjct  55   TWCVALAGVSQIDLQNALDWACGLGMSDCGAIQEGGKCYEPDTLLSHASYAFNNYYQQNG  114

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  CLY
Sbjct  115  NSDIACNFGGTATLTKNNPSYGKCLY  140



>ref|XP_010467085.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 84/155 (54%), Gaps = 21/155 (14%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANL---------------  756
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G      G++                
Sbjct  313  LFNENKKLGPTSERNYGLFFPDEKKVYDIPFTLEGLKHYRDGSHTPVTGDHQVTTPPMSG  372

Query  755  -----TSSNG-TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHAS  594
                  S NG +WC+A+  A E  L+  L++ACG G  DC  IQP   C+ PD L +HAS
Sbjct  373  GGGVSKSLNGQSWCVANGDAGEERLQGGLDYACGEGGADCRPIQPGANCYSPDTLEAHAS  432

Query  593  FAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            FAFNSYYQ+ G    +C FGG     ++ P Y  C
Sbjct  433  FAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRC  467



>gb|KJB10704.1| hypothetical protein B456_001G216900 [Gossypium raimondii]
Length=336

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 84/156 (54%), Gaps = 28/156 (18%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFT----------------------GKGAVD  777
            LFNEN K G  SERN+GL +P +  VY++ FT                      GKG V 
Sbjct  181  LFNENNKVGPTSERNYGLFYPTEEKVYDIPFTVEGLKNYHDRRSPVAGNQPVNGGKGGVS  240

Query  776  VSTGANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHA  597
             ST  N      TWC+A+  A +  L+ AL++ACG G  DC +IQP   C++P+ L +HA
Sbjct  241  KSTTGN------TWCVANGEAGKEKLQAALDFACGEGGADCHSIQPGATCYDPNTLEAHA  294

Query  596  SFAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            SFAFNSYYQ+NG     C FGG      + P Y +C
Sbjct  295  SFAFNSYYQKNGRHMGTCYFGGAAYVVTQPPKYGDC  330



>ref|XP_011047200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Populus euphratica]
Length=470

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 84/152 (55%), Gaps = 18/152 (12%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKG------------------AVDVSTG  765
            LFNEN K G  SERN+GL +PDQ  VY++ FT +G                  +  V  G
Sbjct  313  LFNENEKDGPTSERNYGLFYPDQQKVYDIPFTVEGLKNYKAPSRSPVSGGQPVSAPVRGG  372

Query  764  ANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAF  585
             + +++  TWC+A+  A +  L+ AL++ACG G  DC  IQP   C+ P+ LV+H+SFAF
Sbjct  373  VSKSTTGNTWCVANPDAGKEKLQAALDFACGEGGADCRPIQPEATCYNPNTLVAHSSFAF  432

Query  584  NSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            NSYYQ+ G     C FGG      + P +  C
Sbjct  433  NSYYQKKGRGMGDCYFGGAAFVVTQEPKFGEC  464



>ref|XP_008366987.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Malus domestica]
Length=498

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 84/136 (62%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   D   VY L  TG G V  +      ++N T+C+A   A 
Sbjct  314  LYNEDLRPGSVSEKNWGLFNADGVPVYTLHLTGAGTVLAND-----TTNQTFCVAREGAD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCS +   QPC+EP+N+++HA++AFN+Y+Q    +   C F G
Sbjct  369  KKMLQAALDWACGPGKVDCSPLLQGQPCYEPNNVLTHATYAFNAYFQLMAKSPGTCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS+  C++
Sbjct  429  VATVTTTDPSHGTCIF  444



>ref|XP_010424935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Camelina sativa]
Length=501

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   + T VY L   G GA+     AN T+ N T+CIA     
Sbjct  314  LYNEDSRPGPVSEKNWGLFNTNGTPVYTLRLAGAGAI----LANDTT-NQTFCIAKEKVD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   + C+EPD++V+H+++AFNSYYQ+ G    +C F G
Sbjct  369  KKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNSYYQKMGKALGSCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS   C++
Sbjct  429  VATVTTTDPSRGTCVF  444



>ref|XP_010502143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=501

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   + T VY L   G GA+  +      ++N T+CIA     
Sbjct  314  LYNEDSRPGPVSEKNWGLFNTNGTPVYTLRLAGAGAILAND-----TTNQTFCIAKEKVD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   + C+EPD++V+H+++AFNSYYQ+ G    +C F G
Sbjct  369  KKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNSYYQKMGKALGSCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS   C++
Sbjct  429  VATVTTTDPSRGTCVF  444



>gb|KJB47942.1| hypothetical protein B456_008G047800 [Gossypium raimondii]
Length=169

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A +  S+ DL+NAL+WACG G  DC AIQ    C+EPD L+SHAS+AFN+YYQQNG
Sbjct  48   TWCVALAGVSQIDLQNALDWACGLGMSDCGAIQEGGKCYEPDTLLSHASYAFNNYYQQNG  107

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG    T  NPSY  CLY
Sbjct  108  NSDIACNFGGTATLTKNNPSYGKCLY  133



>ref|XP_004140301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Cucumis sativus]
 gb|KGN51058.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=503

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ KPG  SE+NWGL   +   VY L  TG G V  +      ++N T+C A     
Sbjct  321  LYNEDLKPGPISEKNWGLFDANGKPVYILRLTGSGLVLAND-----TTNQTYCAAKEGVD  375

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
               L+ AL+WACG G VDCSA+   QPC+EPDN+++HA++AFN+YY Q G    +C F G
Sbjct  376  PRMLQAALDWACGPGRVDCSALLQGQPCYEPDNVMAHATYAFNTYYLQMGKGSGSCDFNG  435

Query  530  VGVRTNKNPSYDNC  489
            V   T  NPS+ +C
Sbjct  436  VAAVTTTNPSHGSC  449



>ref|XP_010513892.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=497

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   + T VY L   G GA+  +      ++N T+CIA     
Sbjct  314  LYNEDSRPGPVSEKNWGLFNTNGTPVYTLRLAGAGAILAND-----TTNQTFCIAKEKVD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   + C+EPD++V+H+++AFNSYYQ+ G    +C F G
Sbjct  369  KKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNSYYQKMGKALGSCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS   C++
Sbjct  429  VATVTTTDPSRGTCVF  444



>ref|XP_010244529.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nelumbo nucifera]
Length=171

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  740  TWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  561
            TWC+A   AS+ D++NAL+WACG G  DC  IQ    CFEPD L+SHAS+AFNSYYQQNG
Sbjct  52   TWCVALPGASQIDVQNALDWACGLGMADCGPIQSGGVCFEPDTLLSHASYAFNSYYQQNG  111

Query  560  ATDVACSFGGVGVRTNKNPSYDNCLY  483
             +D+AC+FGG      +NPSY +CLY
Sbjct  112  NSDIACNFGGTATVVTRNPSYGSCLY  137



>ref|XP_001767901.1| predicted protein [Physcomitrella patens]
 gb|EDQ67176.1| predicted protein [Physcomitrella patens]
Length=489

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 80/136 (59%), Gaps = 0/136 (0%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            LFNE+++ G  S R+ GL   +   VY +D +G     V  G    S+  TWC+A   AS
Sbjct  317  LFNEDKRQGPLSTRSMGLFSAEMAPVYAVDLSGSQVTQVPIGPPAASATRTWCVAKQDAS  376

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL++ACG G  DC  IQP Q CF P+   SHAS+A NSYYQ+N  +  AC+F G
Sbjct  377  QDALQAALDYACGLGQADCLPIQPGQACFLPNTRTSHASWAINSYYQKNSNSANACNFQG  436

Query  530  VGVRTNKNPSYDNCLY  483
                T K+PSY  C+Y
Sbjct  437  TATLTTKDPSYTACVY  452



>ref|XP_006297583.1| hypothetical protein CARUB_v10013604mg [Capsella rubella]
 gb|EOA30481.1| hypothetical protein CARUB_v10013604mg [Capsella rubella]
Length=475

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 85/155 (55%), Gaps = 21/155 (14%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVD---------------------V  774
            LFNEN+K G  SERN+GL FPD+  VY++ FT +G                        +
Sbjct  315  LFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKQYHDGGGHNTPVTGDHQVTTPPM  374

Query  773  STGANLTSSNGTWCIASSTASEADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHAS  594
            S G + + +  +WC+A+  A +  L+  L++ACG G  DCS IQP   C+ PD L +HAS
Sbjct  375  SGGVSKSLNGQSWCVANGDAGKERLQGGLDYACGEGGADCSQIQPGANCYSPDTLEAHAS  434

Query  593  FAFNSYYQQNGATDVACSFGGVGVRTNKNPSYDNC  489
            FAFNSYYQ+ G    +C FGG     ++ P Y  C
Sbjct  435  FAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRC  469



>ref|XP_006828511.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Amborella 
trichopoda]
 gb|ERM95927.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
Length=526

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 5/134 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   D + VY L  T  G V  +      ++N T+C+A S A 
Sbjct  343  LYNEDARPGPMSEKNWGLFNADGSPVYTLHLTDSGVVLAND-----TTNQTYCVAISGAD  397

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDC+ +   QPC++PDN+ SHAS+AF++YY + G     C F G
Sbjct  398  KKLLQAALDWACGPGKVDCTPLLQGQPCYDPDNVESHASYAFDTYYHKMGMAVGTCDFKG  457

Query  530  VGVRTNKNPSYDNC  489
            V   T  +PS+D+C
Sbjct  458  VATVTTTDPSHDSC  471



>dbj|BAB01763.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=469

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 86/136 (63%), Gaps = 6/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+++ G  SERNWG+ FP+ TSVY L  +G  +     G+++      +C+A + A 
Sbjct  281  LYNEDKRSGPVSERNWGILFPNGTSVYPLSLSGGSSSAALNGSSM------FCVAKADAD  334

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L + LNWACG G  +C+AIQP QPC+ P+++ SHASFAFN YYQ+  +    C F G
Sbjct  335  DDKLVDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDG  394

Query  530  VGVRTNKNPSYDNCLY  483
              + T ++PSY  C Y
Sbjct  395  TAITTTRDPSYRTCAY  410



>ref|XP_006293165.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
 gb|EOA26063.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
Length=500

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  890  LFNENRKPGLESERNWGLXFPDQTSVYNLDFTGKGAVDVSTGANLTSSNGTWCIASSTAS  711
            L+NE+ +PG  SE+NWGL   + T VY L   G GA+     AN T+ N T+CIA     
Sbjct  314  LYNEDSRPGPVSEKNWGLFNTNGTPVYTLRLAGAGAI----LANDTT-NQTFCIAKEKVD  368

Query  710  EADLENALNWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNGATDVACSFGG  531
            +  L+ AL+WACG G VDCSA+   + C+EPD++V+H+++AFN+YYQ+ G    +C F G
Sbjct  369  KKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKG  428

Query  530  VGVRTNKNPSYDNCLY  483
            V   T  +PS   C++
Sbjct  429  VATVTTTDPSRGTCVF  444



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2045999315917