BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5320

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD20626.1|  squalene synthase                                       343   1e-113   Capsicum annuum
ref|XP_009594336.1|  PREDICTED: squalene synthase-like                  343   1e-113   Nicotiana tomentosiformis
ref|NP_001236365.1|  squalene synthase                                  342   4e-113   
ref|XP_006591920.1|  PREDICTED: squalene synthase isoform X2            340   1e-112   
gb|AGS57530.1|  squalene synthase                                       340   2e-112   Solanum nigrum
gb|ADG36719.1|  squalene synthase 2                                     339   3e-112   Glycyrrhiza uralensis [Chinese licorice]
gb|ACS66749.1|  squalene synthase                                       339   4e-112   Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ77655.1|  squalene synthase 2                                    339   4e-112   Glycyrrhiza eurycarpa
ref|XP_009759256.1|  PREDICTED: squalene synthase-like                  339   4e-112   Nicotiana sylvestris
gb|ACT52825.1|  squalene synthase 2                                     339   4e-112   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_003537842.1|  PREDICTED: squalene synthase-like isoform X1       339   5e-112   Glycine max [soybeans]
gb|AEX26930.1|  squalene synthase 1-2                                   338   5e-112   Solanum tuberosum [potatoes]
dbj|BAA82093.1|  squalene synthase                                      338   6e-112   Solanum tuberosum [potatoes]
ref|XP_006591919.1|  PREDICTED: squalene synthase isoform X1            340   6e-112   
ref|XP_006362006.1|  PREDICTED: squalene synthase-like isoform X1       338   7e-112   Solanum tuberosum [potatoes]
gb|AGB05603.1|  squalene synthase                                       338   8e-112   Camellia oleifera [abura-tsubaki]
gb|AAB02945.1|  squalene synthase                                       337   9e-112   Nicotiana tabacum [American tobacco]
ref|NP_001234716.1|  squalene synthase                                  338   1e-111   
ref|XP_008236983.1|  PREDICTED: squalene synthase-like                  338   1e-111   Prunus mume [ume]
emb|CAJ77653.1|  squalene synthase 2                                    338   1e-111   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_012067183.1|  PREDICTED: squalene synthase-like                  338   1e-111   Jatropha curcas
ref|XP_009631700.1|  PREDICTED: squalene synthase                       338   1e-111   Nicotiana tomentosiformis
gb|AFR77735.1|  squalene synthase                                       337   2e-111   Camellia oleifera [abura-tsubaki]
gb|AEX26929.1|  squalene synthase 1-1                                   337   3e-111   Solanum tuberosum [potatoes]
gb|ACN69082.1|  squalene synthase                                       337   3e-111   Diospyros kaki [Japanese persimmon]
gb|ACU21003.1|  unknown                                                 336   6e-111   Glycine max [soybeans]
gb|AHA84150.1|  squalene synthase                                       336   7e-111   Phaseolus vulgaris [French bean]
gb|AAB08578.1|  squalene synthase                                       336   7e-111   Nicotiana tabacum [American tobacco]
gb|ADG36717.1|  squalene synthase 2                                     336   7e-111   Glycyrrhiza uralensis [Chinese licorice]
gb|AEX26932.1|  squalene synthase                                       335   1e-110   Solanum chacoense
ref|XP_002512982.1|  farnesyl-diphosphate farnesyltransferase, pu...    335   1e-110   
dbj|BAH23428.1|  squalene synthetase                                    334   2e-110   Euphorbia tirucalli
gb|ADW27427.1|  squalene synthase                                       334   3e-110   Astragalus membranaceus
ref|XP_009802568.1|  PREDICTED: squalene synthase                       334   3e-110   Nicotiana sylvestris
gb|ADV57358.1|  squalene synthase                                       334   4e-110   Astragalus membranaceus
gb|AAM27472.1|  squalene synthase                                       330   4e-110   Nicotiana tabacum [American tobacco]
ref|XP_011088477.1|  PREDICTED: squalene synthase-like                  333   1e-109   Sesamum indicum [beniseed]
ref|XP_007131767.1|  hypothetical protein PHAVU_011G040100g             333   1e-109   Phaseolus vulgaris [French bean]
ref|XP_011047507.1|  PREDICTED: squalene synthase isoform X2            330   1e-109   Populus euphratica
sp|P53800.1|FDFT_NICBE  RecName: Full=Squalene synthase; Short=SQ...    332   2e-109   Nicotiana benthamiana
dbj|BAA13084.1|  squalene synthase                                      332   2e-109   Glycyrrhiza glabra
ref|XP_007199882.1|  hypothetical protein PRUPE_ppa006420mg             332   2e-109   
ref|XP_006360639.1|  PREDICTED: squalene synthase-like                  332   2e-109   
emb|CAD23250.1|  farnesyl-diphosphate farnesyltransferase               332   4e-109   Medicago truncatula
gb|ADX01171.1|  putative squalene synthase                              332   4e-109   Bacopa monnieri
ref|XP_011047498.1|  PREDICTED: squalene synthase isoform X1            331   4e-109   Populus euphratica
ref|XP_011649259.1|  PREDICTED: squalene synthase                       331   5e-109   Cucumis sativus [cucumbers]
gb|ADC95435.1|  squalene synthase                                       331   5e-109   Withania somnifera [ashwagandha]
ref|XP_010066209.1|  PREDICTED: squalene synthase                       331   6e-109   Eucalyptus grandis [rose gum]
ref|XP_009376518.1|  PREDICTED: squalene synthase-like                  331   7e-109   Pyrus x bretschneideri [bai li]
gb|AFI33135.3|  squalene synthase                                       330   8e-109   Eriobotrya japonica [loquat]
ref|XP_004290304.1|  PREDICTED: squalene synthase-like isoform X1       330   9e-109   Fragaria vesca subsp. vesca
gb|AEA41713.1|  squalene synthase                                       330   1e-108   Eleutherococcus senticosus
ref|XP_011458278.1|  PREDICTED: squalene synthase-like isoform X2       330   1e-108   Fragaria vesca subsp. vesca
gb|AEA41712.1|  squalene synthase                                       330   1e-108   Eleutherococcus senticosus
emb|CDP20866.1|  unnamed protein product                                331   1e-108   Coffea canephora [robusta coffee]
gb|ABA29019.1|  squalene synthase                                       330   1e-108   Panax notoginseng [san-qi]
ref|XP_003607040.1|  Squalene synthase                                  330   1e-108   
gb|AEM42980.1|  squalene synthase                                       330   1e-108   Siraitia grosvenorii [arhat fruit]
gb|AGI19256.1|  squalene synthase                                       330   2e-108   Panax notoginseng [san-qi]
gb|KDO43896.1|  hypothetical protein CISIN_1g015087mg                   326   2e-108   Citrus sinensis [apfelsine]
ref|XP_006487314.1|  PREDICTED: squalene synthase isoform X1            330   2e-108   
gb|AER23670.1|  squalene synthase                                       330   2e-108   Eleutherococcus senticosus
ref|XP_002266150.1|  PREDICTED: squalene synthase                       330   2e-108   Vitis vinifera
gb|AED99863.1|  squalene synthase                                       330   2e-108   Panax quinquefolius
gb|KDO43893.1|  hypothetical protein CISIN_1g015087mg                   328   2e-108   Citrus sinensis [apfelsine]
gb|KDO43895.1|  hypothetical protein CISIN_1g015087mg                   327   2e-108   Citrus sinensis [apfelsine]
emb|CAN81937.1|  hypothetical protein VITISV_028001                     330   3e-108   Vitis vinifera
gb|KDO43892.1|  hypothetical protein CISIN_1g015087mg                   328   3e-108   Citrus sinensis [apfelsine]
ref|XP_010109768.1|  hypothetical protein L484_008444                   329   3e-108   Morus notabilis
dbj|BAC56854.1|  squalene synthase                                      329   3e-108   Lotus japonicus
gb|EYU37849.1|  hypothetical protein MIMGU_mgv1a007228mg                326   4e-108   Erythranthe guttata [common monkey flower]
gb|AGS78117.1|  squalene synthase 1                                     328   8e-108   Malus domestica [apple tree]
gb|EYU37850.1|  hypothetical protein MIMGU_mgv1a007228mg                328   9e-108   Erythranthe guttata [common monkey flower]
gb|AAV58897.1|  squalene synthase                                       328   1e-107   Centella asiatica [Asiatic pennywort]
gb|ACX42425.1|  squalene synthase                                       328   1e-107   Bupleurum chinense
gb|ACX42426.1|  squalene synthase                                       328   1e-107   Bupleurum chinense
ref|XP_004507500.1|  PREDICTED: squalene synthase-like                  327   1e-107   Cicer arietinum [garbanzo]
ref|XP_004248691.1|  PREDICTED: squalene synthase-like                  327   2e-107   Solanum lycopersicum
ref|XP_008461009.1|  PREDICTED: squalene synthase-like                  327   2e-107   Cucumis melo [Oriental melon]
dbj|BAA24289.1|  squalene synthase                                      327   2e-107   Panax ginseng [Asiatic ginseng]
gb|ACX42423.1|  squalene synthase                                       327   2e-107   Bupleurum chinense
gb|AFZ93644.1|  squalene synthetase                                     327   2e-107   Euphorbia lathyris
gb|ACA66014.1|  squalene synthase                                       327   2e-107   Panax ginseng [Asiatic ginseng]
emb|CAJ77652.1|  squalene synthase 1                                    327   2e-107   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_006423442.1|  hypothetical protein CICLE_v10028537mg             327   3e-107   
emb|CAJ58418.1|  squalene synthase                                      327   3e-107   Panax quinquefolius
gb|ACV88718.1|  squalene synthase                                       327   3e-107   Panax ginseng [Asiatic ginseng]
ref|XP_009378420.1|  PREDICTED: squalene synthase-like                  326   4e-107   Pyrus x bretschneideri [bai li]
gb|AFK29283.1|  putative squalene synthase 1                            326   5e-107   Salvia miltiorrhiza [Chinese salvia]
ref|NP_001280921.1|  squalene synthase-like                             326   6e-107   Malus domestica [apple tree]
gb|ACR57219.1|  squalene synthase                                       326   6e-107   Salvia miltiorrhiza [Chinese salvia]
gb|ADG36705.1|  squalene synthase 1                                     326   6e-107   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_011092839.1|  PREDICTED: squalene synthase-like                  326   7e-107   Sesamum indicum [beniseed]
gb|ADG36702.1|  squalene synthase 1                                     326   7e-107   Glycyrrhiza uralensis [Chinese licorice]
gb|AAY46017.1|  squalene synthase                                       326   7e-107   Bupleurum falcatum
gb|AFK36923.1|  unknown                                                 325   7e-107   Medicago truncatula
gb|AIK21786.1|  squalene synthase                                       325   9e-107   Panax notoginseng [san-qi]
gb|ADC32654.1|  squalene synthase                                       325   1e-106   Aralia elata
gb|ADW78251.1|  squalene synthase                                       325   1e-106   Withania somnifera [ashwagandha]
ref|XP_010263865.1|  PREDICTED: squalene synthase-like                  325   2e-106   Nelumbo nucifera [Indian lotus]
gb|EYU42585.1|  hypothetical protein MIMGU_mgv1a007225mg                325   2e-106   Erythranthe guttata [common monkey flower]
gb|ACS66750.1|  squalene synthase                                       325   2e-106   Glycyrrhiza uralensis [Chinese licorice]
gb|KHG01756.1|  Squalene synthase                                       324   2e-106   Gossypium arboreum [tree cotton]
gb|ADG36706.1|  squalene synthase 1                                     324   2e-106   Glycyrrhiza uralensis [Chinese licorice]
gb|KJB12166.1|  hypothetical protein B456_002G004400                    324   3e-106   Gossypium raimondii
gb|KJB12169.1|  hypothetical protein B456_002G004400                    324   3e-106   Gossypium raimondii
gb|ACT52826.1|  squalene synthase 1                                     324   4e-106   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36707.1|  squalene synthase 1                                     323   5e-106   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36699.1|  squalene synthase 1                                     323   5e-106   Glycyrrhiza uralensis [Chinese licorice]
gb|AFN61199.1|  squalene synthase                                       323   5e-106   Chlorophytum borivilianum
gb|ADG36701.1|  squalene synthase 1                                     323   5e-106   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36711.1|  squalene synthase 1                                     323   6e-106   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36704.1|  squalene synthase 1                                     323   7e-106   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_010526913.1|  PREDICTED: squalene synthase-like                  323   8e-106   
gb|AFK29284.1|  putative squalene synthase 2                            322   1e-105   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010548076.1|  PREDICTED: squalene synthase-like isoform X2       322   1e-105   Tarenaya hassleriana [spider flower]
gb|ADG36709.1|  squalene synthase 1                                     322   1e-105   Glycyrrhiza uralensis [Chinese licorice]
gb|ACX42424.1|  squalene synthase                                       322   1e-105   Bupleurum chinense
gb|ABG66304.1|  squalene synthase                                       322   2e-105   Polygala tenuifolia [Chinese senega-root]
ref|XP_010548075.1|  PREDICTED: squalene synthase-like isoform X1       322   2e-105   Tarenaya hassleriana [spider flower]
gb|ADD54645.1|  squalene synthase                                       322   2e-105   Bruguiera gymnorhiza [Burma mangrove]
gb|ACZ71037.1|  squalene synthase                                       322   2e-105   Panax ginseng [Asiatic ginseng]
emb|CAJ77654.1|  squalene synthase 1                                    322   3e-105   Glycyrrhiza eurycarpa
dbj|BAA13083.1|  squalene synthase                                      321   4e-105   Glycyrrhiza glabra
gb|AFT92039.1|  squalene synthase                                       321   5e-105   Euphorbia pekinensis
gb|ADG36703.1|  squalene synthase 1                                     321   6e-105   Glycyrrhiza uralensis [Chinese licorice]
gb|AAR20329.1|  squalene synthase                                       321   6e-105   Artemisia annua [sweet Annie]
gb|ACQ90302.1|  squalene synthase                                       321   7e-105   Gynostemma pentaphyllum [jiaogulan]
ref|XP_011037190.1|  PREDICTED: squalene synthase-like                  320   1e-104   Populus euphratica
ref|XP_010039888.1|  PREDICTED: squalene synthase-like isoform X2       320   2e-104   Eucalyptus grandis [rose gum]
gb|ADG36708.1|  squalene synthase 1                                     319   2e-104   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_002313765.1|  squalene synthase family protein                   318   4e-104   Populus trichocarpa [western balsam poplar]
emb|CAJ58419.1|  squalene synthase                                      318   4e-104   Panax quinquefolius
gb|AAR20328.1|  squalene synthase                                       318   5e-104   Artemisia annua [sweet Annie]
ref|XP_010039880.1|  PREDICTED: squalene synthase-like isoform X1       318   5e-104   Eucalyptus grandis [rose gum]
ref|XP_007042047.1|  Squalene synthase 1 isoform 1                      317   1e-103   
gb|AIX97193.1|  squalene synthase                                       316   3e-103   Matricaria chamomilla var. recutita [German chamomile]
gb|KJB32574.1|  hypothetical protein B456_005G247700                    316   3e-103   Gossypium raimondii
gb|KHN25422.1|  Squalene synthase                                       316   5e-103   Glycine soja [wild soybean]
gb|KHG07441.1|  Squalene synthase                                       315   7e-103   Gossypium arboreum [tree cotton]
ref|XP_002305455.2|  hypothetical protein POPTR_0004s16830g             317   1e-102   
gb|KJB12171.1|  hypothetical protein B456_002G004400                    315   1e-102   Gossypium raimondii
gb|AAG14896.2|AF302464_1  squalene synthase                             315   1e-102   Artemisia annua [sweet Annie]
gb|ABQ96265.1|  squalene synthase                                       315   1e-102   Psammosilene tunicoides
ref|NP_195190.1|  Squalene synthase 1                                   313   6e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ABX10442.1|  squalene synthase 2                                     313   7e-102   Gossypium hirsutum [American cotton]
ref|XP_002869133.1|  hypothetical protein ARALYDRAFT_912921             310   9e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_010690774.1|  PREDICTED: squalene synthase-like                  310   1e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010437580.1|  PREDICTED: squalene synthase-like isoform X2       309   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006412201.1|  hypothetical protein EUTSA_v10025338mg             309   2e-100   Eutrema salsugineum [saltwater cress]
ref|XP_010432389.1|  PREDICTED: squalene synthase                       309   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010447048.1|  PREDICTED: squalene synthase-like                  309   3e-100   Camelina sativa [gold-of-pleasure]
gb|KFK30097.1|  hypothetical protein AALP_AA7G216600                    308   3e-100   Arabis alpina [alpine rockcress]
ref|XP_008796682.1|  PREDICTED: squalene synthase-like isoform X3       307   3e-100   
ref|XP_010437579.1|  PREDICTED: squalene synthase-like isoform X1       309   3e-100   Camelina sativa [gold-of-pleasure]
ref|XP_009110610.1|  PREDICTED: squalene synthase                       308   5e-100   
ref|XP_006283828.1|  hypothetical protein CARUB_v10004929mg             307   9e-100   Capsella rubella
ref|XP_010934354.1|  PREDICTED: squalene synthase-like                  307   1e-99    Elaeis guineensis
gb|AGW25489.1|  squalene synthase                                       306   1e-99    Paris polyphylla var. yunnanensis
ref|XP_008796678.1|  PREDICTED: squalene synthase-like isoform X1       307   1e-99    Phoenix dactylifera
ref|XP_008796681.1|  PREDICTED: squalene synthase-like isoform X2       306   2e-99    Phoenix dactylifera
gb|EPS74249.1|  hypothetical protein M569_00507                         303   2e-99    Genlisea aurea
ref|XP_006412200.1|  hypothetical protein EUTSA_v10025392mg             305   7e-99    
ref|XP_008795798.1|  PREDICTED: squalene synthase-like isoform X2       303   9e-99    
ref|XP_009138312.1|  PREDICTED: squalene synthase-like                  304   3e-98    Brassica rapa
ref|XP_008795796.1|  PREDICTED: squalene synthase-like isoform X1       303   4e-98    Phoenix dactylifera
ref|XP_010025621.1|  PREDICTED: squalene synthase-like                  303   5e-98    Eucalyptus grandis [rose gum]
ref|XP_009389044.1|  PREDICTED: squalene synthase-like                  302   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009108714.1|  PREDICTED: squalene synthase-like isoform X1       301   2e-97    Brassica rapa
gb|AAY22201.1|  squalene synthase                                       300   3e-97    Datura inoxia [downy thornapple]
ref|XP_006285747.1|  hypothetical protein CARUB_v10007220mg             300   4e-97    Capsella rubella
gb|AFY63035.1|  squalene synthase                                       300   5e-97    Alisma plantago-aquatica subsp. orientale
ref|XP_002869132.1|  squalene synthase 2                                300   5e-97    
ref|XP_010447047.1|  PREDICTED: squalene synthase-like                  300   9e-97    Camelina sativa [gold-of-pleasure]
gb|AGN32410.1|  squalene synthase                                       299   2e-96    Dioscorea zingiberensis
emb|CDX72493.1|  BnaC07g45150D                                          299   2e-96    
gb|AHB20141.2|  squalene synthase                                       298   3e-96    Fritillaria thunbergii
ref|XP_010437578.1|  PREDICTED: squalene synthase-like isoform X2       298   3e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010437577.1|  PREDICTED: squalene synthase-like isoform X1       298   4e-96    Camelina sativa [gold-of-pleasure]
gb|AGI56082.1|  squalene synthase                                       298   5e-96    Dendrobium officinale
ref|XP_009760451.1|  PREDICTED: squalene synthase-like                  297   6e-96    Nicotiana sylvestris
gb|KJB32578.1|  hypothetical protein B456_005G247700                    297   7e-96    Gossypium raimondii
gb|AAB61927.1|  squalene synthase 2                                     297   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396917.1|  PREDICTED: squalene synthase-like                  296   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_195191.2|  squalene synthase 2                                   296   2e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CDY17472.1|  BnaC03g65910D                                          296   3e-95    Brassica napus [oilseed rape]
ref|XP_010432387.1|  PREDICTED: squalene synthase-like                  295   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006841632.1|  PREDICTED: squalene synthase                       294   1e-94    Amborella trichopoda
ref|XP_010065915.1|  PREDICTED: squalene synthase-like                  294   2e-94    Eucalyptus grandis [rose gum]
ref|XP_010690775.1|  PREDICTED: squalene synthase-like                  293   3e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|ACI14294.1|  squalene synthase                                       287   1e-93    Linum usitatissimum
emb|CDX72494.1|  BnaC07g45160D                                          291   2e-93    
ref|XP_009110500.1|  PREDICTED: squalene synthase                       291   2e-93    Brassica rapa
emb|CDX69076.1|  BnaC01g03770D                                          291   2e-93    
emb|CDY45323.1|  BnaA03g52960D                                          284   4e-93    Brassica napus [oilseed rape]
ref|XP_002466259.1|  hypothetical protein SORBIDRAFT_01g004550          290   4e-93    Sorghum bicolor [broomcorn]
emb|CDX75451.1|  BnaA01g02510D                                          290   8e-93    
gb|KFK30098.1|  hypothetical protein AALP_AA7G216700                    288   3e-92    Arabis alpina [alpine rockcress]
ref|XP_006651930.1|  PREDICTED: squalene synthase-like                  285   6e-91    Oryza brachyantha
ref|NP_001130502.1|  uncharacterized protein LOC100191601               285   6e-91    
ref|NP_001104839.1|  squalene synthase1                                 284   8e-91    Zea mays [maize]
tpg|DAA52014.1|  TPA: hypothetical protein ZEAMMB73_299336              284   9e-91    
gb|AFJ15526.1|  squalene synthase                                       283   1e-90    Azadirachta indica [Indian-lilac]
ref|XP_010025618.1|  PREDICTED: squalene synthase-like                  283   2e-90    Eucalyptus grandis [rose gum]
ref|NP_001051625.1|  Os03g0805100                                       282   4e-90    
emb|CDX75450.1|  BnaA01g02520D                                          281   9e-90    
emb|CDX69075.1|  BnaC01g03780D                                          280   3e-89    
emb|CDX76294.1|  BnaA08g11060D                                          279   7e-89    
gb|ABI14439.1|  squalene synthase                                       276   2e-87    Taxus cuspidata [ichii]
gb|EEE60131.1|  hypothetical protein OsJ_13016                          274   1e-86    Oryza sativa Japonica Group [Japonica rice]
gb|AHI96421.1|  squalene synthase                                       268   2e-84    Pinus massoniana [Chinese red pine]
ref|XP_006351382.1|  PREDICTED: squalene synthase-like                  266   1e-83    
emb|CDY45322.1|  BnaA03g52950D                                          265   2e-83    Brassica napus [oilseed rape]
dbj|BAJ87710.1|  predicted protein                                      265   3e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24732.1|  unknown                                                 265   3e-83    Picea sitchensis
ref|XP_003564211.1|  PREDICTED: squalene synthase-like                  261   9e-82    Brachypodium distachyon [annual false brome]
ref|NP_001059129.1|  Os07g0200700                                       260   2e-81    
ref|XP_006351216.1|  PREDICTED: squalene synthase-like                  260   3e-81    Solanum tuberosum [potatoes]
ref|XP_010312074.1|  PREDICTED: squalene synthase-like isoform X2       259   3e-81    
gb|AEX26931.1|  squalene synthase 1-3                                   249   7e-81    Solanum tuberosum [potatoes]
ref|XP_004249733.1|  PREDICTED: squalene synthase-like isoform X1       259   7e-81    Solanum lycopersicum
ref|XP_007042048.1|  Squalene synthase 1 isoform 2                      249   1e-78    
ref|XP_009591242.1|  PREDICTED: squalene synthase-like                  248   2e-78    
gb|AEX58673.1|  squalene synthase                                       250   3e-77    Huperzia serrata [toothed club-moss]
gb|AIW04729.1|  squalene synthase                                       249   6e-77    Dryopteris fragrans
ref|XP_001775898.1|  predicted protein                                  246   4e-76    
ref|XP_003559279.1|  PREDICTED: squalene synthase-like                  246   6e-76    Brachypodium distachyon [annual false brome]
gb|EMT03383.1|  Squalene synthetase                                     239   6e-73    
ref|XP_009769885.1|  PREDICTED: squalene synthase-like                  238   1e-72    Nicotiana sylvestris
ref|XP_006423443.1|  hypothetical protein CICLE_v10028537mg             220   2e-66    
ref|XP_003058046.1|  predicted protein                                  214   3e-63    Micromonas pusilla CCMP1545
ref|XP_009619298.1|  PREDICTED: squalene synthase-like                  213   4e-63    
ref|XP_011395550.1|  Squalene synthase                                  213   1e-62    Auxenochlorella protothecoides
ref|XP_002501456.1|  predicted protein                                  210   2e-61    Micromonas commoda
ref|XP_005651444.1|  farnesyl-diphosphate farnesyltransferase           207   2e-61    Coccomyxa subellipsoidea C-169
ref|XP_001417488.1|  predicted protein                                  209   4e-61    Ostreococcus lucimarinus CCE9901
ref|XP_005851990.1|  hypothetical protein CHLNCDRAFT_18492              203   6e-61    Chlorella variabilis
ref|XP_003078740.1|  FDFT_NICBE Farnesyl-diphosphate farnesyltran...    200   2e-60    
ref|XP_007512409.1|  squalene synthase                                  207   2e-60    Bathycoccus prasinos
ref|XP_001773253.1|  predicted protein                                  202   6e-60    
ref|XP_001756673.1|  predicted protein                                  201   1e-58    
gb|ADP89473.1|  squalene synthase                                       193   1e-58    Betula platyphylla [Asian white birch]
ref|XP_002946755.1|  hypothetical protein VOLCADRAFT_79344              201   3e-58    Volvox carteri f. nagariensis
ref|XP_001703447.1|  farnesyl-diphosphate farnesyltransferase           199   4e-58    Chlamydomonas reinhardtii
emb|CEF97547.1|  Squalene/phytoene synthase                             199   4e-58    Ostreococcus tauri
gb|ABW37701.1|  squalene synthase                                       191   1e-57    Panax notoginseng [san-qi]
gb|AEY76157.1|  squalene synthase                                       186   6e-56    Dioscorea zingiberensis
ref|XP_002971951.1|  hypothetical protein SELMODRAFT_96714              191   1e-54    
gb|KDD74507.1|  squalene/phytoene synthase                              187   5e-54    Helicosporidium sp. ATCC 50920
gb|ABA01562.1|  squalene synthase                                       178   4e-53    Bupleurum falcatum
gb|KIZ04121.1|  farnesyl-diphosphatefarnesyltransferase                 187   2e-52    Monoraphidium neglectum
sp|G0Y287.1|BOSS_BOTBR  RecName: Full=Botryococcus squalene synth...    183   4e-51    Botryococcus braunii
ref|XP_006658375.1|  PREDICTED: squalene synthase-like                  180   6e-51    
sp|Q9SDW9.1|BSS_BOTBR  RecName: Full=Squalene synthase                  179   7e-50    Botryococcus braunii
emb|CDM86349.1|  unnamed protein product                                176   1e-49    Triticum aestivum [Canadian hard winter wheat]
gb|AAI68496.1|  Unknown (protein for MGC:173117)                        171   8e-47    Xenopus tropicalis [western clawed frog]
ref|NP_001135642.2|  farnesyl-diphosphate farnesyltransferase 1         170   9e-47    
ref|XP_005837525.1|  farnesyl-diphosphate farnesyltransferase           172   2e-46    Guillardia theta CCMP2712
gb|KJE94382.1|  farnesyl-diphosphate farnesyltransferase 1              167   2e-45    Capsaspora owczarzaki ATCC 30864
ref|XP_004346713.1|  farnesyl-diphosphate farnesyltransferase 1         167   2e-45    Capsaspora owczarzaki ATCC 30864
gb|EAY92248.1|  hypothetical protein OsI_13969                          164   1e-44    Oryza sativa Indica Group [Indian rice]
emb|CCC50058.1|  putative farnesyltransferase                           162   4e-44    Trypanosoma vivax Y486
ref|XP_009560856.1|  PREDICTED: squalene synthase isoform X1            163   5e-44    Cuculus canorus
ref|XP_009560858.1|  PREDICTED: squalene synthase isoform X2            163   5e-44    Cuculus canorus
ref|XP_003386611.1|  PREDICTED: squalene synthase-like                  162   6e-44    Amphimedon queenslandica
ref|NP_001034383.1|  squalene synthase                                  162   9e-44    Gallus gallus [bantam]
gb|ESL10210.1|  farnesyltransferase                                     162   1e-43    Trypanosoma rangeli SC58
ref|XP_005075330.1|  PREDICTED: squalene synthase                       162   1e-43    Mesocricetus auratus [Syrian golden hamster]
gb|ELT92149.1|  hypothetical protein CAPTEDRAFT_164295                  162   1e-43    Capitella teleta
ref|XP_006681876.1|  hypothetical protein BATDEDRAFT_14137              161   1e-43    Batrachochytrium dendrobatidis JAM81
dbj|BAE36836.1|  unnamed protein product                                161   2e-43    Mus musculus [mouse]
ref|XP_005146462.1|  PREDICTED: squalene synthase                       161   2e-43    Melopsittacus undulatus
ref|XP_003498025.1|  PREDICTED: squalene synthase isoform X2            161   2e-43    Cricetulus griseus [Chinese hamsters]
ref|NP_034321.2|  squalene synthase                                     161   2e-43    Mus musculus [mouse]
ref|XP_008170096.1|  PREDICTED: squalene synthase                       161   3e-43    Chrysemys picta bellii
gb|AAL91344.1|  squalene synthase                                       154   3e-43    Cricetulus griseus [Chinese hamsters]
ref|XP_806809.1|  farnesyltransferase                                   160   4e-43    Trypanosoma cruzi strain CL Brener
gb|AAF00038.1|  squalene synthase                                       159   5e-43    Mus musculus [mouse]
ref|XP_005044492.1|  PREDICTED: squalene synthase                       160   7e-43    
ref|NP_062111.1|  squalene synthase                                     160   7e-43    
ref|XP_003225597.2|  PREDICTED: squalene synthase                       160   7e-43    
ref|XP_008977274.1|  PREDICTED: squalene synthase isoform X2            159   9e-43    
ref|XP_007429053.1|  PREDICTED: squalene synthase isoform X1            160   9e-43    
ref|XP_010863270.1|  PREDICTED: squalene synthase                       159   1e-42    
dbj|BAA06102.1|  squalene synthase                                      159   1e-42    
ref|XP_009046088.1|  hypothetical protein LOTGIDRAFT_56072              155   1e-42    
ref|XP_005290732.1|  PREDICTED: squalene synthase-like                  159   1e-42    
ref|XP_002756812.1|  PREDICTED: squalene synthase isoform X1            159   2e-42    
ref|XP_008351286.1|  PREDICTED: squalene synthase-like                  150   2e-42    
gb|KFO77427.1|  Squalene synthase                                       159   2e-42    
ref|XP_009210757.1|  PREDICTED: squalene synthase isoform X3            157   2e-42    
gb|EKG06138.1|  squalene synthase, putative                             158   2e-42    
ref|XP_006716310.1|  PREDICTED: squalene synthase isoform X1            157   2e-42    
ref|XP_806417.1|  farnesyltransferase                                   158   2e-42    
ref|XP_004707702.1|  PREDICTED: squalene synthase isoform X2            158   3e-42    
ref|XP_005528843.1|  PREDICTED: squalene synthase                       158   3e-42    
ref|XP_008290524.1|  PREDICTED: squalene synthase-like                  155   3e-42    
ref|XP_008826308.1|  PREDICTED: squalene synthase                       158   4e-42    
gb|AHG98484.1|  FDFT1                                                   154   5e-42    
ref|XP_008629248.1|  PREDICTED: squalene synthase                       158   5e-42    
ref|XP_007068988.1|  PREDICTED: squalene synthase-like                  158   5e-42    
ref|XP_003271489.1|  PREDICTED: squalene synthase isoform 1             157   5e-42    
ref|XP_006774849.1|  PREDICTED: squalene synthase isoform X2            157   5e-42    
gb|EMS67019.1|  Squalene synthase                                       157   6e-42    
ref|XP_006263357.1|  PREDICTED: squalene synthase-like                  157   6e-42    
ref|NP_001189454.1|  squalene synthase                                  157   6e-42    
ref|XP_008120692.1|  PREDICTED: squalene synthase-like                  157   6e-42    
ref|XP_010382892.1|  PREDICTED: squalene synthase isoform X2            157   8e-42    
ref|XP_011798220.1|  PREDICTED: squalene synthase isoform X1            157   8e-42    
ref|NP_001247653.1|  squalene synthase                                  157   9e-42    
ref|XP_008997579.1|  PREDICTED: squalene synthase-like isoform X2       156   9e-42    
ref|XP_006864384.1|  PREDICTED: squalene synthase isoform X2            157   9e-42    
ref|XP_004046700.1|  PREDICTED: squalene synthase isoform 1             157   9e-42    
ref|XP_008311147.1|  PREDICTED: squalene synthase isoform X2            157   9e-42    
ref|NP_004453.3|  squalene synthase isoform 1                           157   9e-42    
gb|AAP36671.1|  Homo sapiens farnesyl-diphosphate farnesyltransfe...    157   1e-41    
gb|AFJ73943.1|  squalene synthase                                       151   1e-41    
emb|CAA48896.1|  farnesyl-diphosphate farnesyltransferase               157   1e-41    
ref|XP_002186800.1|  PREDICTED: squalene synthase                       157   1e-41    
gb|AAB33404.1|  squalene synthase                                       157   1e-41    
gb|AAH09251.1|  Farnesyl-diphosphate farnesyltransferase 1              157   1e-41    
ref|XP_009438499.1|  PREDICTED: squalene synthase isoform X1            157   1e-41    
ref|XP_002709483.1|  PREDICTED: squalene synthase isoform X2            157   1e-41    
ref|XP_003944232.1|  PREDICTED: squalene synthase isoform X2            156   1e-41    
ref|XP_005495474.1|  PREDICTED: squalene synthase                       156   1e-41    
ref|XP_010771634.1|  PREDICTED: squalene synthase isoform X2            156   1e-41    
ref|XP_002749744.1|  PREDICTED: squalene synthase-like isoform X1       156   2e-41    
ref|XP_003793967.1|  PREDICTED: squalene synthase isoform 1             156   2e-41    
ref|XP_006906366.1|  PREDICTED: squalene synthase isoform X2            156   2e-41    
ref|XP_010971494.1|  PREDICTED: squalene synthase                       156   3e-41    
gb|AFJ73947.1|  squalene synthase                                       151   3e-41    
ref|XP_010993460.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    155   3e-41    
ref|XP_005800260.1|  PREDICTED: squalene synthase-like                  155   4e-41    
ref|XP_004541881.1|  PREDICTED: squalene synthase-like isoform X2       155   4e-41    
gb|AFJ73953.1|  squalene synthase                                       150   4e-41    
gb|EKF38258.1|  squalene synthase, putative                             155   4e-41    
ref|XP_007192741.1|  PREDICTED: squalene synthase isoform X1            155   5e-41    
ref|XP_005859689.1|  PREDICTED: squalene synthase                       155   5e-41    
ref|XP_004433568.1|  PREDICTED: squalene synthase isoform 2             155   5e-41    
ref|XP_007128199.1|  PREDICTED: squalene synthase isoform X2            155   6e-41    
ref|XP_005683583.1|  PREDICTED: squalene synthase                       155   6e-41    
ref|XP_005914533.1|  PREDICTED: squalene synthase-like                  155   7e-41    
gb|KFO99755.1|  Squalene synthase                                       154   7e-41    
gb|EDL20655.1|  mCG10034                                                154   7e-41    
gb|AFJ73951.1|  squalene synthase                                       149   7e-41    
ref|NP_001267081.1|  squalene synthase                                  154   8e-41    
gb|AFJ73959.1|  squalene synthase                                       149   8e-41    
gb|AFJ73955.1|  squalene synthase                                       149   8e-41    
ref|XP_004671442.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    154   9e-41    
gb|AEP82679.1|  farnesyltransferase                                     149   9e-41    
gb|AFJ73957.1|  squalene synthase                                       149   1e-40    
gb|AFJ73935.1|  squalene synthase                                       149   1e-40    
ref|XP_003449965.1|  PREDICTED: squalene synthase-like                  154   1e-40    
ref|XP_011984436.1|  PREDICTED: squalene synthase isoform X1            153   1e-40    
gb|AFJ73941.1|  squalene synthase                                       149   1e-40    
gb|AFJ73937.1|  squalene synthase                                       149   1e-40    
ref|XP_008574546.1|  PREDICTED: squalene synthase isoform X3            152   1e-40    
ref|XP_010838568.1|  PREDICTED: squalene synthase                       154   1e-40    
ref|XP_008529254.1|  PREDICTED: squalene synthase isoform X2            154   2e-40    
ref|XP_011243253.1|  PREDICTED: squalene synthase isoform X2            154   2e-40    
ref|XP_004382266.1|  PREDICTED: squalene synthase isoform 2             154   2e-40    
gb|KFW77295.1|  Squalene synthase                                       153   2e-40    
ref|XP_004707701.1|  PREDICTED: squalene synthase isoform X1            154   2e-40    
gb|AFJ73939.1|  squalene synthase                                       149   2e-40    
ref|NP_001013022.1|  squalene synthase                                  153   2e-40    
gb|AFJ73961.1|  squalene synthase                                       148   2e-40    
ref|XP_006060304.1|  PREDICTED: squalene synthase                       153   2e-40    
ref|XP_004004500.1|  PREDICTED: squalene synthase isoform X3            153   2e-40    
gb|AFJ73945.1|  squalene synthase                                       148   2e-40    
sp|Q32KR6.1|FDFT_BOVIN  RecName: Full=Squalene synthase; Short=SQ...    153   2e-40    
ref|XP_007618604.1|  PREDICTED: squalene synthase isoform X1            154   3e-40    
ref|XP_005095010.1|  PREDICTED: squalene synthase-like isoform X1       153   3e-40    
gb|KFP31735.1|  Squalene synthase                                       152   3e-40    
ref|XP_003757973.1|  PREDICTED: squalene synthase                       154   3e-40    
ref|XP_008574545.1|  PREDICTED: squalene synthase isoform X2            153   3e-40    
ref|XP_008311146.1|  PREDICTED: squalene synthase isoform X1            153   4e-40    
ref|XP_008768968.1|  PREDICTED: squalene synthase isoform X1            153   4e-40    
ref|XP_005734456.1|  PREDICTED: squalene synthase-like                  152   4e-40    
ref|XP_007552931.1|  PREDICTED: squalene synthase isoform X2            152   4e-40    
pdb|3WCA|A  Chain A, The Complex Structure Of Tcsqs With Ligand, ...    151   5e-40    
pdb|3WCB|A  Chain A, The Complex Structure Of Tcsqs With Ligand, ...    151   5e-40    
gb|AFJ73933.1|  squalene synthase                                       147   5e-40    
ref|XP_003971766.1|  PREDICTED: squalene synthase isoform X2            152   5e-40    
ref|XP_004278741.1|  PREDICTED: squalene synthase                       152   6e-40    
gb|KFW01543.1|  Squalene synthase                                       152   6e-40    
ref|XP_006884952.1|  PREDICTED: squalene synthase isoform X2            152   6e-40    
ref|XP_007517287.1|  PREDICTED: squalene synthase isoform X1            152   7e-40    
gb|ELR63024.1|  Squalene synthase                                       152   8e-40    
ref|XP_002735807.1|  PREDICTED: squalene synthase-like                  149   1e-39    
ref|XP_008148988.1|  PREDICTED: squalene synthase isoform X2            151   1e-39    
ref|XP_007471181.1|  PREDICTED: squalene synthase isoform X2            151   1e-39    
ref|XP_003479432.1|  PREDICTED: squalene synthase isoform X1            151   1e-39    
ref|XP_006906365.1|  PREDICTED: squalene synthase isoform X1            152   2e-39    
pdb|1EZF|A  Chain A, Crystal Structure Of Human Squalene Synthase       149   2e-39    
ref|XP_004766139.1|  PREDICTED: squalene synthase isoform X2            150   2e-39    
ref|XP_007882609.1|  PREDICTED: squalene synthase                       150   2e-39    
ref|XP_008396056.1|  PREDICTED: squalene synthase isoform X2            150   2e-39    
pdb|3LEE|A  Chain A, Crystal Structure Of The Human Squalene Synt...    149   2e-39    
ref|NP_001161120.1|  squalene synthase                                  150   2e-39    
pdb|3WEJ|A  Chain A, Crystal Structure Of The Human Squalene Synt...    149   2e-39    
ref|XP_005513697.1|  PREDICTED: squalene synthase                       150   2e-39    
pdb|3VJ8|A  Chain A, Crystal Structure Of The Human Squalene Synt...    149   2e-39    
pdb|3WEK|A  Chain A, Crystal Structure Of The Human Squalene Synt...    149   2e-39    
ref|XP_007936895.1|  PREDICTED: squalene synthase isoform X2            150   3e-39    
ref|XP_004848518.1|  PREDICTED: squalene synthase isoform X2            150   3e-39    
ref|XP_008977276.1|  PREDICTED: squalene synthase isoform X4            151   3e-39    
ref|XP_006864383.1|  PREDICTED: squalene synthase isoform X1            151   3e-39    
ref|XP_010771633.1|  PREDICTED: squalene synthase isoform X1            151   3e-39    
pdb|3WC9|A  Chain A, The Complex Structure Of Hssqs Wtih Ligand, ...    149   3e-39    
ref|XP_004088003.1|  PREDICTED: squalene synthase                       150   4e-39    
ref|XP_001372440.1|  PREDICTED: squalene synthase isoform X1            150   4e-39    
ref|XP_004541880.1|  PREDICTED: squalene synthase-like isoform X1       150   4e-39    
ref|XP_005425026.1|  PREDICTED: squalene synthase                       151   4e-39    
ref|XP_003868895.1|  GTP-binding protein                                147   4e-39    
ref|XP_006993063.1|  PREDICTED: squalene synthase                       150   5e-39    
ref|XP_004395309.1|  PREDICTED: squalene synthase isoform 2             150   5e-39    
ref|XP_011901460.1|  PREDICTED: squalene synthase isoform X3            149   5e-39    
ref|XP_002923714.1|  PREDICTED: squalene synthase isoform X2            149   5e-39    
ref|XP_005562631.1|  PREDICTED: squalene synthase isoform X3            149   5e-39    
ref|XP_006729443.1|  PREDICTED: squalene synthase isoform X2            149   6e-39    
ref|XP_534557.2|  PREDICTED: squalene synthase isoformX1                149   6e-39    
ref|XP_002114185.1|  hypothetical protein TRIADDRAFT_27912              149   7e-39    
ref|XP_004766138.1|  PREDICTED: squalene synthase isoform X1            149   7e-39    
ref|XP_010743678.1|  PREDICTED: squalene synthase-like                  146   7e-39    
ref|XP_003863390.1|  farnesyltransferase, putative                      149   7e-39    
ref|XP_001467618.1|  putative farnesyltransferase                       149   7e-39    
gb|KFH73802.1|  farnesyl-diphosphate farnesyltransferase                149   8e-39    
gb|KFV73970.1|  Squalene synthase                                       148   1e-38    
ref|XP_005562629.1|  PREDICTED: squalene synthase isoform X1            149   1e-38    
ref|XP_010382891.1|  PREDICTED: squalene synthase isoform X1            149   1e-38    
ref|XP_007959826.1|  PREDICTED: squalene synthase isoform X1            149   1e-38    
ref|XP_006642983.1|  PREDICTED: squalene synthase-like                  149   1e-38    
ref|XP_009906049.1|  PREDICTED: squalene synthase isoform X1            148   1e-38    
ref|XP_006774848.1|  PREDICTED: squalene synthase isoform X1            149   1e-38    
ref|XP_004382265.1|  PREDICTED: squalene synthase isoform 1             149   2e-38    
ref|XP_009438497.1|  PREDICTED: squalene synthase isoform X2            149   2e-38    
dbj|BAG60195.1|  unnamed protein product                                149   2e-38    
ref|NP_001274679.1|  squalene synthase isoform 3                        149   2e-38    
ref|XP_010330373.1|  PREDICTED: squalene synthase isoform X1            149   2e-38    
ref|XP_009241805.1|  PREDICTED: squalene synthase isoform X1            149   2e-38    
ref|XP_004083804.1|  PREDICTED: squalene synthase                       148   2e-38    
ref|XP_004614762.1|  PREDICTED: squalene synthase                       147   3e-38    
pdb|3WEI|A  Chain A, Crystal Structure Of The Human Squalene Synt...    146   3e-38    
ref|XP_007552930.1|  PREDICTED: squalene synthase isoform X1            148   4e-38    
gb|EFA80770.1|  farnesyl-diphosphate farnesyltransferase                147   4e-38    
ref|XP_006884951.1|  PREDICTED: squalene synthase isoform X1            147   5e-38    
ref|XP_011610382.1|  PREDICTED: squalene synthase isoform X1            147   6e-38    
ref|XP_004986173.1|  PREDICTED: squalene synthase-like                  139   6e-38    
ref|XP_008247080.1|  PREDICTED: squalene synthase isoform X1            147   6e-38    
ref|XP_001915483.1|  PREDICTED: squalene synthase                       146   6e-38    
ref|XP_004338669.1|  farnesyldiphosphate farnesyltransferase            147   7e-38    
ref|WP_040444080.1|  hypothetical protein                               146   7e-38    
ref|XP_007936894.1|  PREDICTED: squalene synthase isoform X1            147   1e-37    
ref|XP_011665372.1|  PREDICTED: squalene synthase                       146   1e-37    
ref|XP_005008182.1|  PREDICTED: squalene synthase isoform X2            147   1e-37    
ref|XP_003283681.1|  farnesyl-diphosphate farnesyltransferase           145   1e-37    
ref|XP_004433567.1|  PREDICTED: squalene synthase isoform 1             147   1e-37    
ref|XP_007374454.1|  hypothetical protein SPAPADRAFT_60279              146   2e-37    
ref|XP_008396055.1|  PREDICTED: squalene synthase isoform X1            146   2e-37    
ref|XP_002619326.1|  hypothetical protein CLUG_00485                    145   2e-37    
ref|XP_005535962.1|  squalene synthase                                  146   2e-37    
emb|CAG09159.1|  unnamed protein product                                145   3e-37    
ref|XP_004198715.1|  Piso0_002102                                       145   3e-37    
ref|XP_004992741.1|  farnesyl-diphosphate farnesyltransferase 1         145   3e-37    
ref|XP_008529253.1|  PREDICTED: squalene synthase isoform X1            145   3e-37    
ref|XP_003984893.2|  PREDICTED: squalene synthase                       144   3e-37    
ref|XP_011998897.1|  PREDICTED: squalene synthase isoform X2            145   4e-37    
gb|ESA03184.1|  hypothetical protein GLOINDRAFT_619                     145   4e-37    
ref|XP_009025212.1|  hypothetical protein HELRODRAFT_68312              144   4e-37    
ref|XP_010805999.1|  PREDICTED: squalene synthase isoform X1            145   4e-37    
ref|XP_001685284.1|  putative squalene synthase                         144   4e-37    
gb|AAC17923.1|  squalene synthase                                       144   4e-37    
ref|XP_005635705.1|  PREDICTED: squalene synthase isoform X2            144   5e-37    
ref|XP_007128198.1|  PREDICTED: squalene synthase isoform X1            145   5e-37    
gb|ACF35716.1|  squalene synthase 1                                     135   5e-37    
ref|XP_004328595.1|  PREDICTED: squalene synthase                       145   6e-37    
ref|XP_006172265.1|  PREDICTED: LOW QUALITY PROTEIN: farnesyl-dip...    144   6e-37    
gb|ACF35714.1|  squalene synthase 1                                     135   6e-37    
emb|CCE44873.1|  hypothetical protein CPAR2_406760                      144   7e-37    
ref|XP_005373886.1|  PREDICTED: squalene synthase                       144   7e-37    
gb|EHA98214.1|  Squalene synthetase                                     144   7e-37    
dbj|BAO39180.1|  squalene synthetase                                    144   9e-37    
ref|XP_004848519.1|  PREDICTED: squalene synthase isoform X3            143   9e-37    
ref|XP_004395308.1|  PREDICTED: squalene synthase isoform 1             144   1e-36    
ref|XP_008574544.1|  PREDICTED: squalene synthase isoform X1            144   1e-36    
sp|G0Y288.1|BOCS_BOTBR  RecName: Full=Botryococcene synthase; Alt...    143   1e-36    
ref|XP_004877252.1|  PREDICTED: squalene synthase                       143   1e-36    
ref|XP_011228676.1|  PREDICTED: squalene synthase isoform X1            144   1e-36    
ref|XP_006729442.1|  PREDICTED: squalene synthase isoform X1            144   1e-36    
ref|XP_007476301.1|  PREDICTED: squalene synthase isoform X2            144   1e-36    
ref|XP_008148987.1|  PREDICTED: squalene synthase isoform X1            144   1e-36    
ref|XP_004848517.1|  PREDICTED: squalene synthase isoform X1            144   1e-36    
gb|KFO38052.1|  Squalene synthase                                       142   2e-36    
gb|EMT23370.1|  Squalene synthetase                                     142   2e-36    
ref|XP_629811.1|  farnesyl-diphosphate farnesyltransferase              142   3e-36    
ref|XP_008116141.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    142   4e-36    
ref|XP_007471180.1|  PREDICTED: squalene synthase isoform X1            142   4e-36    
ref|XP_003877813.1|  putative farnesyltransferase                       141   5e-36    
sp|G0Y286.1|PSDS_BOTBR  RecName: Full=Presqualene diphosphate syn...    141   6e-36    



>gb|AAD20626.1| squalene synthase [Capsicum annuum]
Length=411

 Score =   343 bits (879),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHIYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|XP_009594336.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=411

 Score =   343 bits (879),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGAML++P+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML+KVSRSF+LVIQQLP+
Sbjct  1    MGSLGAMLRNPEDIYPLMKLKLAARYAEKQIPPQPHWAFCYIMLRKVSRSFSLVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTS+ATEVK PIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSVATEVKAPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+Y+EAIEDITMRMGAGMAKFICKEVETIDDY EYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKHYKEAIEDITMRMGAGMAKFICKEVETIDDYAEYCHYVAGLVGL  178



>ref|NP_001236365.1| squalene synthase [Glycine max]
 dbj|BAA22559.1| squalene synthase [Glycine max]
Length=413

 Score =   342 bits (876),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL I
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGI  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_006591920.1| PREDICTED: squalene synthase isoform X2 [Glycine max]
Length=413

 Score =   340 bits (872),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AGS57530.1| squalene synthase [Solanum nigrum]
Length=411

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ADG36719.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36721.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ACS66749.1| squalene synthase [Glycyrrhiza uralensis]
 gb|ADG36715.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36716.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36720.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36722.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36723.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36724.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>emb|CAJ77655.1| squalene synthase 2 [Glycyrrhiza eurycarpa]
Length=412

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_009759256.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=411

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGAML++P+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML KVSRSF+LVIQQLP+
Sbjct  1    MGSLGAMLRNPEDIYPLMKLKLAARYAEKQIPPQPHWAFCYIMLHKVSRSFSLVIQQLPL  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL K+Y+EAIEDITMRMGAGMAKFICKEVETI DYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKHYKEAIEDITMRMGAGMAKFICKEVETIGDYDEYCHYVAGLVGL  178



>gb|ACT52825.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36714.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_003537842.1| PREDICTED: squalene synthase-like isoform X1 [Glycine max]
 ref|XP_006590871.1| PREDICTED: squalene synthase-like isoform X2 [Glycine max]
 gb|KHN39832.1| Squalene synthase [Glycine soja]
Length=413

 Score =   339 bits (869),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AEX26930.1| squalene synthase 1-2 [Solanum tuberosum]
Length=411

 Score =   338 bits (868),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>dbj|BAA82093.1| squalene synthase [Solanum tuberosum]
Length=411

 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|XP_006591919.1| PREDICTED: squalene synthase isoform X1 [Glycine max]
Length=451

 Score =   340 bits (871),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362007.1| PREDICTED: squalene synthase-like isoform X2 [Solanum tuberosum]
 ref|XP_006362008.1| PREDICTED: squalene synthase-like isoform X3 [Solanum tuberosum]
Length=411

 Score =   338 bits (868),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>gb|AGB05603.1| squalene synthase [Camellia oleifera]
Length=414

 Score =   338 bits (868),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AAR+ EK IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLMKLKMAARRAEKNIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILMAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAF ELG+ YQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFSELGRGYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AAB02945.1| squalene synthase [Nicotiana tabacum]
Length=376

 Score =   337 bits (864),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|NP_001234716.1| squalene synthase [Solanum lycopersicum]
 gb|ACY25092.1| squalene synthase [Solanum lycopersicum]
Length=411

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|XP_008236983.1| PREDICTED: squalene synthase-like [Prunus mume]
Length=412

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+LG ++KHPDD+YPL+KLK+AA+ +EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGTLGTLMKHPDDIYPLLKLKMAAKNLEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>emb|CAJ77653.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMA+FICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMARFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_012067183.1| PREDICTED: squalene synthase-like [Jatropha curcas]
 gb|KDP41726.1| hypothetical protein JCGZ_26744 [Jatropha curcas]
Length=413

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD++WHF CG KDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDQDWHFSCGAKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKSYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_009631700.1| PREDICTED: squalene synthase [Nicotiana tomentosiformis]
Length=411

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+Y+VLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYRVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKHYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>gb|AFR77735.1| squalene synthase, partial [Camellia oleifera]
Length=413

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AAR+ EK IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLMKLKMAARRAEKNIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILMAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAF ELG+ YQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFSELGRGYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AEX26929.1| squalene synthase 1-1 [Solanum tuberosum]
Length=411

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSR FALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRGFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>gb|ACN69082.1| squalene synthase [Diospyros kaki]
Length=415

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL AML+HPDDVYPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLAAMLRHPDDVYPLVKLKMAARHAEKQIPPEPHWAFCYTMLHKVSRSFGLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FH HIYDR+WHF CGT++YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILLAFHHHIYDRDWHFSCGTREYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELGK YQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ACU21003.1| unknown [Glycine max]
Length=413

 Score =   336 bits (861),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW F YTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFRYTMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AHA84150.1| squalene synthase [Phaseolus vulgaris]
Length=413

 Score =   336 bits (861),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L ++LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGTLRSILKHPDDFYPLLKLKIAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            Q HHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QIHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AAB08578.1| squalene synthase [Nicotiana tabacum]
Length=411

 Score =   336 bits (861),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>gb|ADG36717.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36718.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   336 bits (861),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVA LVGL
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVARLVGL  178



>gb|AEX26932.1| squalene synthase [Solanum chacoense]
Length=411

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLE GK YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLEHGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
 gb|EEF49485.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
Length=412

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS+GA+L+HPDD YPL+KLK+AAR  EKQIPP+P WGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSVGAILRHPDDFYPLLKLKMAARNAEKQIPPEPRWGFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFH+HIY+ EWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIDFHKHIYNPEWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKSYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>dbj|BAH23428.1| squalene synthetase [Euphorbia tirucalli]
 dbj|BAH23429.1| squalene synthetase [Euphorbia tirucalli]
Length=411

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+L+HPDD YPL+KLK+A++  EKQIP QPHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMASKHAEKQIPAQPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHIYDREWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+YQEAIE+IT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKSYQEAIENITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADW27427.1| squalene synthase [Astragalus membranaceus]
Length=413

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSF LV QQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFGLVFQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLR LDTVEDDTSIATEVKVPILI FHRHIYD +WHFLCGTK+YKVLM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIATEVKVPILIAFHRHIYDHDWHFLCGTKEYKVLME  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLELGKNYQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETLDDYDEYCHYVAGLVGL  178



>ref|XP_009802568.1| PREDICTED: squalene synthase [Nicotiana sylvestris]
Length=411

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>gb|ADV57358.1| squalene synthase [Astragalus membranaceus]
Length=405

 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSF LV QQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFGLVFQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLR LDTVEDDTSIATEVKVPILI FHRHIYD +WHFLCGTK+YKVLM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIATEVKVPILIAFHRHIYDHDWHFLCGTKEYKVLME  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLELGKNYQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETLDDYDEYCHYVAGLVGL  178



>gb|AAM27472.1| squalene synthase [Nicotiana tabacum]
Length=290

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHY AGLVGL
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYEAGLVGL  178



>ref|XP_011088477.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011088478.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YP++KLK+A R  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPMVKLKLAVRSAEKQIPAEPHWAFCYSMLHKVSRSFGLVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSIATEVKVPIL+DFHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIATEVKVPILMDFHRHIYDREWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELG+ YQEAIEDITM+MGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMKMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_007131767.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 ref|XP_007131768.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03761.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03762.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
Length=413

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L ++LKHPDD YPL+KLKIAAR  EKQIPP+ HW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGTLRSILKHPDDFYPLLKLKIAARNAEKQIPPELHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            Q HHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QIHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_011047507.1| PREDICTED: squalene synthase isoform X2 [Populus euphratica]
Length=346

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIP +PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPSEPHWAFCYSMLHRVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYL+LRALDTVEDDTSI TEVKVPILI FHRHIYDR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLILRALDTVEDDTSIPTEVKVPILIAFHRHIYDRNWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFH VSTAFLELGK YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHVVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>sp|P53800.1|FDFT_NICBE RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Nicotiana benthamiana]
 gb|AAA87048.1| squalene synthetase [Nicotiana benthamiana]
Length=411

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP P+WGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPNWGFCYSMLHKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>dbj|BAA13084.1| squalene synthase [Glycyrrhiza glabra]
Length=412

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDCDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMA+FICKEVET+DDYDEYCHYVAGLVG+
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAEFICKEVETVDDYDEYCHYVAGLVGM  178



>ref|XP_007199882.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
 gb|EMJ01081.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
Length=412

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+LG ++KHPDD+YPL+KLK+AA+ +EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGTLGTLMKHPDDIYPLLKLKMAAKNLEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSIA +VKVPIL+ FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIAADVKVPILLAFHRHIYDPDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_006360639.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=411

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG L A+LKHP+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML KVSRSF+LVI+QLP+
Sbjct  1    MGILRAILKHPEDIYPLLKLKVAARYAEKQIPPQPHWAFCYIMLHKVSRSFSLVIKQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDA+CIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+Y+EAIEDITMRMGAGMAKFI KEVETIDDYDEYCH+VAGLVGL
Sbjct  121  QFHHVSTAFLELGKHYKEAIEDITMRMGAGMAKFIYKEVETIDDYDEYCHHVAGLVGL  178



>emb|CAD23250.1| farnesyl-diphosphate farnesyltransferase [Medicago truncatula]
 gb|AES89237.2| squalene synthase [Medicago truncatula]
Length=413

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDWHFGCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLELGKNYQ+AIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADX01171.1| putative squalene synthase [Bacopa monnieri]
Length=414

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+LKHPDD+YP++KLK+A R  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLRAILKHPDDLYPMVKLKLAVRNAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAV IFYLVLRALDTVEDDTSI+ EVKVPIL  FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVRIFYLVLRALDTVEDDTSISAEVKVPILKAFHRHIYDREWHFACGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELG  YQEAIEDITMRMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGSGYQEAIEDITMRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_011047498.1| PREDICTED: squalene synthase isoform X1 [Populus euphratica]
Length=413

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIP +PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPSEPHWAFCYSMLHRVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYL+LRALDTVEDDTSI TEVKVPILI FHRHIYDR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLILRALDTVEDDTSIPTEVKVPILIAFHRHIYDRNWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFH VS AFLELGK YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHDVSAAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_011649259.1| PREDICTED: squalene synthase [Cucumis sativus]
 ref|XP_011649260.1| PREDICTED: squalene synthase [Cucumis sativus]
 ref|XP_011649261.1| PREDICTED: squalene synthase [Cucumis sativus]
 ref|XP_011649262.1| PREDICTED: squalene synthase [Cucumis sativus]
 gb|KGN61845.1| hypothetical protein Csa_2G251460 [Cucumis sativus]
Length=417

 Score =   331 bits (849),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLKP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADC95435.1| squalene synthase [Withania somnifera]
Length=411

 Score =   331 bits (848),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG++ A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHW FCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTVRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWAFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI  +VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPADVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+YQ+AIEDIT+RMGAGMAKFICKEVET DDYDEYCHYVAG VGL
Sbjct  121  QFHHVSTAFLELGKHYQQAIEDITLRMGAGMAKFICKEVETTDDYDEYCHYVAGYVGL  178



>ref|XP_010066209.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 ref|XP_010066210.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 gb|KCW64053.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64054.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64055.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64056.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
Length=413

 Score =   331 bits (848),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EK+IPPQPHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARNAEKRIPPQPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+YQEAI+DIT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVG+
Sbjct  121  QFHHVSTAFLELGKSYQEAIDDITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGI  178



>ref|XP_009376518.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=412

 Score =   331 bits (848),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L  MLKHPDD+YPL+KLKIA+RQIEKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+A+C+FYLVLRALDTVEDDTS+AT+VKVPIL+ FHRHIYD  WHF CGTK+YKVLMD
Sbjct  61   ELRNAICLFYLVLRALDTVEDDTSVATDVKVPILLAFHRHIYDPNWHFACGTKNYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFI KEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFILKEVETIDDYDEYCHYVAGLVGL  178



>gb|AFI33135.3| squalene synthase [Eriobotrya japonica]
 gb|AGU36305.1| squalene synthase [Eriobotrya japonica]
Length=412

 Score =   330 bits (847),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L  MLKHPDD+YPL+KLKIA+RQI+KQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIKKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSIAT+VKVPIL+ FHRHIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCLFYLVLRALDTVEDDTSIATDVKVPILLAFHRHIYDPEWHFACGTNNYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFI KEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFIMKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_004290304.1| PREDICTED: squalene synthase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   330 bits (847),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS GAMLKHPDD+YPL+KLK+AAR +EKQIPPQPHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAMLKHPDDIYPLLKLKMAARNLEKQIPPQPHWAFCYTMLHKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDT++ T+VK+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTAVETDVKLPILIAFHRHIYDPKWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHV+TAFLELGK YQEAIEDIT RMGAGMAKFICKEVET++DYDEYCHYVAGLVGL
Sbjct  121  EFHHVATAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETVEDYDEYCHYVAGLVGL  178



>gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILIAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  Y++AIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGSGYKDAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_011458278.1| PREDICTED: squalene synthase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS GAMLKHPDD+YPL+KLK+AAR +EKQIPPQPHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAMLKHPDDIYPLLKLKMAARNLEKQIPPQPHWAFCYTMLHKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDT++ T+VK+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTAVETDVKLPILIAFHRHIYDPKWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHV+TAFLELGK YQEAIEDIT RMGAGMAKFICKEVET++DYDEYCHYVAGLVGL
Sbjct  121  EFHHVATAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETVEDYDEYCHYVAGLVGL  178



>gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILIAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  Y++AIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGSGYKDAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>emb|CDP20866.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M +LGA+LKHPDD+YPLIKLK+A  Q EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MRTLGAILKHPDDLYPLIKLKVAVMQAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDA+C+FYLVLRALDTVEDDT+IATEVKVPIL+ FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAICVFYLVLRALDTVEDDTNIATEVKVPILMAFHRHIYDREWHFACGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELG +YQ+ IEDITMRMGAGMAKFICKEVET +DYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGSSYQKVIEDITMRMGAGMAKFICKEVETTEDYDEYCHYVAGLVGL  178



>gb|ABA29019.1| squalene synthase [Panax notoginseng]
 gb|AGS79226.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGNGYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_003607040.1| Squalene synthase [Medicago truncatula]
Length=423

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDWHFGCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLELGKNYQ+AIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AEM42980.1| squalene synthase [Siraitia grosvenorii]
Length=417

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+L+HPDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLAP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+A+CIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AGI19256.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGNGYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|KDO43896.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=294

 Score =   326 bits (835),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKEVE+IDDYDEYC+YVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKEVESIDDYDEYCYYVAGLVGL  178



>ref|XP_006487314.1| PREDICTED: squalene synthase isoform X1 [Citrus sinensis]
 gb|KDO43888.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43889.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=413

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKEVE+IDDYDEYC+YVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKEVESIDDYDEYCYYVAGLVGL  178



>gb|AER23670.1| squalene synthase [Eleutherococcus senticosus]
Length=414

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLDA  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  +QEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGSGFQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera]
 ref|XP_010647676.1| PREDICTED: squalene synthase [Vitis vinifera]
 emb|CBI38008.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+L HPDD+YPL+KLK+A R  EKQIPP+PHW FCYT+L KVSRSF LVIQQL  
Sbjct  1    MGSLGAILTHPDDIYPLLKLKMAVRHAEKQIPPEPHWAFCYTLLHKVSRSFGLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+A+CIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIRTDVKVPILIAFHRHIYDRDWHFACGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL + YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELERGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AED99863.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|KDO43893.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43894.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=386

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKEVE+IDDYDEYC+YVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKEVESIDDYDEYCYYVAGLVGL  178



>gb|KDO43895.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=340

 Score =   327 bits (838),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKEVE+IDDYDEYC+YVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKEVESIDDYDEYCYYVAGLVGL  178



>emb|CAN81937.1| hypothetical protein VITISV_028001 [Vitis vinifera]
Length=431

 Score =   330 bits (846),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+L HPDD+YPL+KLK+A R  EKQIPP+PHW FCYT+L KVSRSF LVIQQL  
Sbjct  1    MGSLGAILTHPDDIYPLLKLKMAVRHAEKQIPPEPHWAFCYTLLHKVSRSFGLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+A+CIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIRTDVKVPILIAFHRHIYDRDWHFACGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL + YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELERGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|KDO43892.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=384

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKEVE+IDDYDEYC+YVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKEVESIDDYDEYCYYVAGLVGL  178



>ref|XP_010109768.1| hypothetical protein L484_008444 [Morus notabilis]
 gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis]
Length=411

 Score =   329 bits (844),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+L+HPDDVYPLIKLK+AAR  EK+IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALLRHPDDVYPLIKLKMAARNAEKRIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDT+EDDTSI T+VKVPIL +F+RH+Y+ +WHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTIEDDTSIPTDVKVPILKEFYRHMYNPKWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>dbj|BAC56854.1| squalene synthase [Lotus japonicus]
Length=413

 Score =   329 bits (844),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHPDD+YPL+KLK+AAR  EKQIP +PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVKHPDDLYPLLKLKMAARHAEKQIPSEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL  FHRHIYDR+WHF CGTK+YKVLM 
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATEVKVPILKAFHRHIYDRDWHFSCGTKEYKVLMG  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFH VSTAFLEL KNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHLVSTAFLELAKNYQEAIEDITDRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|EYU37849.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=346

 Score =   326 bits (836),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L++P+D+YPL+KLK+A+R  EKQIP +PHWGFCY+MLQKVSRSFA VIQQL  
Sbjct  1    MGSLRAILRNPEDLYPLLKLKLASRNAEKQIPSEPHWGFCYSMLQKVSRSFAFVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TE+KVPIL+ FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIKTEIKVPILMAFHQHIYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELG+ YQEAIEDITMRMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AGS78117.1| squalene synthase 1 [Malus domestica]
Length=412

 Score =   328 bits (841),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L  MLKHPDD+YPL+KLKIA+RQIEKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTS+AT+VKVPIL+ FHRHIYD +WHF CGT +YKVLMD
Sbjct  61   ELRNAVCLFYLVLRALDTVEDDTSVATDVKVPILLAFHRHIYDPDWHFACGTNNYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELG  YQEAIEDIT RMGAGMAKFI KEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGTGYQEAIEDITKRMGAGMAKFILKEVETIDDYDEYCHYVAGLVGL  178



>gb|EYU37850.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=414

 Score =   328 bits (841),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L++P+D+YPL+KLK+A+R  EKQIP +PHWGFCY+MLQKVSRSFA VIQQL  
Sbjct  1    MGSLRAILRNPEDLYPLLKLKLASRNAEKQIPSEPHWGFCYSMLQKVSRSFAFVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TE+KVPIL+ FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIKTEIKVPILMAFHQHIYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELG+ YQEAIEDITMRMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AAV58897.1| squalene synthase [Centella asiatica]
Length=415

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL  FHRHIYD  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILKAFHRHIYDNNWHFSCGTKEYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  Y+EAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGSGYKEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ACX42425.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELGK YQEAIEDITMRMGAGMAKFICKEVE+IDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICKEVESIDDYDEYCHYVAGLVGL  178



>gb|ACX42426.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELGK YQEAIEDITMRMGAGMAKFICKEVE+IDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICKEVESIDDYDEYCHYVAGLVGL  178



>ref|XP_004507500.1| PREDICTED: squalene synthase-like [Cicer arietinum]
Length=413

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M SLGA+LK+PDD +PL+KLK+AAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MASLGAILKNPDDFFPLLKLKMAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIDTDVKVPILKAFHRHIYDHDWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+YQ+AIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKDYQDAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_004248691.1| PREDICTED: squalene synthase-like [Solanum lycopersicum]
Length=411

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG L A+LKHP+D+YPL+KLK+AA+  EKQIP QPHW FCY ML KVSRSF+LVIQQLP+
Sbjct  1    MGILRAILKHPEDIYPLLKLKVAAQYAEKQIPSQPHWAFCYIMLHKVSRSFSLVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDA+CIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK Y+EAIEDITMRMGAGMAKFI KEVE+IDDYDEYCH+VAGLVGL
Sbjct  121  QFHHVSTAFLELGKQYKEAIEDITMRMGAGMAKFIYKEVESIDDYDEYCHHVAGLVGL  178



>ref|XP_008461009.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461010.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461011.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461012.1| PREDICTED: squalene synthase-like [Cucumis melo]
Length=417

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+ HWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARHAEKQIPPESHWGFCYTMLHKVSRSFALVIQQLKP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>dbj|BAA24289.1| squalene synthase [Panax ginseng]
 dbj|BAD08242.1| squalene synthase [Panax ginseng]
Length=415

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHP+D YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPEDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMRMGAGMAKFICKEVETINDYDEYCHYVAGLVGL  178



>gb|ACX42423.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNSSWHFSCGTKEYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELGK YQEAIEDITMRMGAGMAKFICKEVE+IDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICKEVESIDDYDEYCHYVAGLVGL  178



>gb|AFZ93644.1| squalene synthetase [Euphorbia lathyris]
Length=410

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AA+  EKQIP QPHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAAKHAEKQIPAQPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYD EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHIYDPEWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            Q HH+STAFLELGK+YQEAIEDIT +MGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QIHHLSTAFLELGKSYQEAIEDITKKMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ACA66014.1| squalene synthase [Panax ginseng]
Length=415

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHP+D YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPEDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMRMGAGMAKFICKEVETINDYDEYCHYVAGLVGL  178



>emb|CAJ77652.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_006423442.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36682.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=413

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPSEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKEVE+IDDYDEYC+YVAGLVGL
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKEVESIDDYDEYCYYVAGLVGL  178



>emb|CAJ58418.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFL+LG  Y+EAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ACV88718.1| squalene synthase [Panax ginseng]
Length=415

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFL+LG  Y+EAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_009378420.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=410

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L  M+KHPDD+YPL+KLKIA+R +EKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMIKHPDDIYPLLKLKIASRHVEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTS+AT+VKVPIL+ FH HIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSVATDVKVPILLAFHEHIYDPEWHFACGTNNYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFI KEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFILKEVETIDDYDEYCHYVAGLVGL  178



>gb|AFK29283.1| putative squalene synthase 1 [Salvia miltiorrhiza]
 gb|AFV13322.1| putative squalene synthase 1 [Salvia miltiorrhiza]
Length=413

 Score =   326 bits (835),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YPL+KLK AAR  EKQIPP+PHWGFCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPLLKLKYAARNAEKQIPPEPHWGFCYTMLHKVSRSFGLVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDA+CIFYLVLRALDTVEDDTSIATE+KVPIL+ FHRHI+DREWHF CGTK+Y+VLMD
Sbjct  61   DLRDAICIFYLVLRALDTVEDDTSIATELKVPILMAFHRHIFDREWHFSCGTKEYRVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL   YQ+AIEDITMRMGAGMAKFICKEVET +DYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELAPGYQDAIEDITMRMGAGMAKFICKEVETTNDYDEYCHYVAGLVGL  178



>ref|NP_001280921.1| squalene synthase-like [Malus domestica]
 ref|XP_008382334.1| PREDICTED: squalene synthase-like [Malus domestica]
 gb|AGS78118.1| squalene synthase 2 [Malus domestica]
Length=410

 Score =   326 bits (835),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L  M+KHPDD+YPL+KLKIA+R +EKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMIKHPDDIYPLLKLKIASRHVEKQIPSEPHWAFCYTMLQKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSIAT+VKVPIL+ FH+HIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATDVKVPILLAFHQHIYDPEWHFACGTNNYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELG  YQEAIEDIT RMGAGMAKFI KEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGNGYQEAIEDITKRMGAGMAKFILKEVETIDDYDEYCHYVAGLVGL  178



>gb|ACR57219.1| squalene synthase [Salvia miltiorrhiza]
Length=413

 Score =   326 bits (835),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+L+HPDD+YPL+KLK AAR  EKQIPP+PHWGFCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPLLKLKYAARNAEKQIPPEPHWGFCYTMLHKVSRSFGLVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDA+CIFYLVLRALDTVEDDTSIATE+KVPIL+ FHRHI+DREWHF CGTK+Y+VLMD
Sbjct  61   DLRDAICIFYLVLRALDTVEDDTSIATELKVPILMAFHRHIFDREWHFSCGTKEYRVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL   YQ+AIEDITMRMGAGMAKFICKEVET +DYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELAPGYQDAIEDITMRMGAGMAKFICKEVETTNDYDEYCHYVAGLVGL  178



>gb|ADG36705.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   326 bits (835),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_011092839.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011092841.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   326 bits (835),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M SL A+ +HPDD+YP++KLK+AAR+ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLQAIWRHPDDLYPMVKLKLAARRAEKQIPAEPHWAFCYSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI+ EVKVPIL+ FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSISMEVKVPILMAFHRHIYDREWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELG  YQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGSGYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ADG36702.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36710.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36712.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36713.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   326 bits (835),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|AAY46017.1| squalene synthase [Bupleurum falcatum]
Length=415

 Score =   326 bits (835),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAFLKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             FHHVS AFLELGK YQEAIEDITMRMGAGMAKFICKEVE+IDDYDEYCHYVAGLVGL
Sbjct  121  GFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICKEVESIDDYDEYCHYVAGLVGL  178



>gb|AFK36923.1| unknown [Medicago truncatula]
Length=413

 Score =   325 bits (834),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD + HF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDRHFGCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLELGKNYQ+AIED+T RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDLTKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AIK21786.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   325 bits (834),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFL+LG  Y+EAIEDITMRMGAGM+KFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMRMGAGMSKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ADC32654.1| squalene synthase [Aralia elata]
Length=414

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD+YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIY+++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYEKDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHH+S AFLELG  YQEAIEDITMRMGAGMAKFICKEVET+ DYDEYCHYVAGLVGL
Sbjct  121  EFHHLSNAFLELGSGYQEAIEDITMRMGAGMAKFICKEVETVGDYDEYCHYVAGLVGL  178



>gb|ADW78251.1| squalene synthase [Withania somnifera]
 gb|ADO22708.1| squalene synthase [Withania somnifera]
Length=413

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 167/180 (93%), Gaps = 2/180 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHW FCY MLQKVSRSFAL IQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWAFCYLMLQKVSRSFALAIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHF--LCGTKDYKVL  468
            ELRDAVCIFYLVLRALDTVEDDTSI  +VKVPILI FH+H+YDREWHF  L GTK+YKVL
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPADVKVPILISFHQHVYDREWHFSLLGGTKEYKVL  120

Query  469  MDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            MDQFHHVSTAFLELGK+YQ+AI+DIT+RMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  MDQFHHVSTAFLELGKHYQQAIQDITLRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  180



>ref|XP_010263865.1| PREDICTED: squalene synthase-like [Nelumbo nucifera]
Length=415

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG +LKHPDD+YPL KLK+AAR + KQIPP+PHWGFCY ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTVLKHPDDIYPLFKLKMAARNVGKQIPPEPHWGFCYKMLHKVSRSFSLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSIA+++KVPIL +FH+HIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIASDIKVPILKNFHQHIYDGDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFH VSTAFLELG++YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHLVSTAFLELGRSYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|EYU42585.1| hypothetical protein MIMGU_mgv1a007225mg [Erythranthe guttata]
Length=414

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M SL A+LKHPDD+YP++KLK+AAR+ EKQI  +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLRAILKHPDDLYPMVKLKLAARKAEKQIRSEPHWAFCYSMLLKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTS+AT+VKVPIL+DFH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSVATDVKVPILMDFHQHIYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELG  YQ+AIEDITMRMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGSGYQQAIEDITMRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ACS66750.1| squalene synthase [Glycyrrhiza uralensis]
Length=413

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETADDYDEYCHYVAGLVGL  178



>gb|KHG01756.1| Squalene synthase [Gossypium arboreum]
Length=413

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+ HIYDR+WHF CGTK++KVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYHHIYDRDWHFSCGTKEFKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT+RMGAGMAK+ICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLRMGAGMAKYICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36706.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHH STAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHDSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|KJB12166.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=413

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT+RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|KJB12169.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=427

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT+RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ACT52826.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36700.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   324 bits (830),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36707.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   323 bits (829),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36699.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   323 bits (829),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|AFN61199.1| squalene synthase [Chlorophytum borivilianum]
Length=410

 Score =   323 bits (828),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+ GA+LKHPDD YP++KL +A +   KQIPPQPHW FCYTML KVSRSFALVIQQL +
Sbjct  1    MGTFGAILKHPDDFYPIMKLAMAMKSAAKQIPPQPHWAFCYTMLHKVSRSFALVIQQLDV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LRDAVC+FYLVLRALDTVEDDTSI T+VKVPIL  FHRHIYD EWHF CGTKDYKVLMD
Sbjct  61   NLRDAVCVFYLVLRALDTVEDDTSIPTDVKVPILNSFHRHIYDCEWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36701.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   323 bits (829),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIESITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36711.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   323 bits (828),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHH STAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHDSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36704.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   323 bits (828),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT  MGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKGMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010526913.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526914.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526915.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
Length=413

 Score =   323 bits (827),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M +LGA+L+HPD+ YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MRNLGAILRHPDEFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHH+S AFLEL K YQ AIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHLSAAFLELEKGYQNAIEDITRRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AFK29284.1| putative squalene synthase 2 [Salvia miltiorrhiza]
 gb|AGE45641.1| squalene synthase 2 [Salvia miltiorrhiza]
 gb|AJR21118.1| squalene synthase 2 [Salvia miltiorrhiza]
Length=414

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M +LGA+LKHP+D+YP++KLK+AARQ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVNLGAILKHPEDLYPMVKLKLAARQAEKQIPAEPHWAFCYSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSIA+EVKVPIL  FHRHIY+ EWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIASEVKVPILKAFHRHIYNSEWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELGK YQEAIE+ITMRMG GMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSVAFLELGKGYQEAIENITMRMGEGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010548076.1| PREDICTED: squalene synthase-like isoform X2 [Tarenaya hassleriana]
Length=415

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+L+HPDD YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LR+AVC+FYLVLR LDTVEDD SI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   HLRNAVCVFYLVLRGLDTVEDDMSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQ+AIEDIT+RMGAGMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQDAIEDITLRMGAGMAKFICKEVETIEDYDEYCHYVAGLVGL  178



>gb|ADG36709.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT  MGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKGMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|ACX42424.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAFLKHPDDLYPLLKLKYAVKLAEKQIPPQPHWAFCYSMLHKVSRSFCLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFLELGK YQEAIEDITMRMGAGMAKFIC+EVE+IDDYDEYCH+VAGLVGL
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICQEVESIDDYDEYCHHVAGLVGL  178



>gb|ABG66304.1| squalene synthase [Polygala tenuifolia]
Length=413

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+A R  EKQIP +PHWGF Y+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAVLKHPDDFYPLLKLKLAVRHAEKQIPHEPHWGFSYSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTS+ T+VKVPIL  FHRHIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSVPTDVKVPILKAFHRHIYDREWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL K YQEAIEDIT RMG GMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELDKGYQEAIEDITQRMGVGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010548075.1| PREDICTED: squalene synthase-like isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+L+HPDD YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LR+AVC+FYLVLR LDTVEDD SI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   HLRNAVCVFYLVLRGLDTVEDDMSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQ+AIEDIT+RMGAGMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQDAIEDITLRMGAGMAKFICKEVETIEDYDEYCHYVAGLVGL  178



>gb|ADD54645.1| squalene synthase [Bruguiera gymnorhiza]
Length=416

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+ KHPDD+YPL+KLK+A +  EKQIPPQPHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIFKHPDDLYPLLKLKMAMKHAEKQIPPQPHWGFCYTMLHKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVC+FYLVLRALDTVEDDTSIAT+VKVPILI FH H+YDR+WHF CGTKDYKVLMD
Sbjct  61   QLRDAVCVFYLVLRALDTVEDDTSIATDVKVPILIAFHHHLYDRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             FHHVSTAF ELGK +QEAIE+IT RMGAGMAKFI KEVETIDDYDEYCHYVAGLVGL
Sbjct  121  LFHHVSTAFSELGKGHQEAIEEITKRMGAGMAKFISKEVETIDDYDEYCHYVAGLVGL  178



>gb|ACZ71037.1| squalene synthase [Panax ginseng]
Length=415

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPI++ FH HIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPIVMAFHCHIYDNDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFL+LG +Y+EAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLDLGSSYKEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>emb|CAJ77654.1| squalene synthase 1 [Glycyrrhiza eurycarpa]
Length=413

 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PH  FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHRAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra]
Length=413

 Score =   321 bits (823),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPD+VYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDEVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VK PILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKEPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT  MGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKEMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>gb|AFT92039.1| squalene synthase [Euphorbia pekinensis]
Length=411

 Score =   321 bits (822),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLK+AA+  EK IP  PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAAKNAEKHIPALPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDA+CIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKV MD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHVYDREWHFPCGTKEYKVPMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK+YQ+ IEDI  RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLELGKSYQDVIEDIAKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36703.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   321 bits (822),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL KNYQ AIE+IT  MGAGMAKFIC EVET+DDYDE+CHYVAGLVGL
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKGMGAGMAKFICNEVETVDDYDEHCHYVAGLVGL  178



>gb|AAR20329.1| squalene synthase [Artemisia annua]
Length=418

 Score =   321 bits (822),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  
Sbjct  1    MSSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL + YQEAIEDITMRMGAGMAKFICKEVET+DDYDEYCHYVAGLVG+
Sbjct  121  QFHHVSTAFLELKRGYQEAIEDITMRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGI  178



>gb|ACQ90302.1| squalene synthase [Gynostemma pentaphyllum]
Length=417

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS GA+L+HPDD YPL+KLK+AAR  EKQIP +PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAILRHPDDFYPLLKLKMAARNAEKQIPQEPHWGFCYTMLHKVSRSFALVIQQLQP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI T++KVPILI+FHRHIY+R+WHF CGTK YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIETDIKVPILINFHRHIYNRDWHFSCGTKHYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLEL K YQEAI D+T RMGAGMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELEKGYQEAIGDVTNRMGAGMAKFICKEVETIEDYDEYCHYVAGLVGL  178



>ref|XP_011037190.1| PREDICTED: squalene synthase-like [Populus euphratica]
Length=413

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHP D+YPL+KLK+AA+  EKQIPP+PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPVDIYPLLKLKMAAKHAEKQIPPEPHWAFCYSMLHRVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDHDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFH+VS AFLELGK Y EAIEDIT RMGAGMAKFI KEVE+IDDYDEYCHYVAGLVGL
Sbjct  121  QFHNVSNAFLELGKGYHEAIEDITKRMGAGMAKFILKEVESIDDYDEYCHYVAGLVGL  178



>ref|XP_010039888.1| PREDICTED: squalene synthase-like isoform X2 [Eucalyptus grandis]
Length=414

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS GA+L+HP D YPL+KLK+AA   EKQIPPQPHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSWGAILRHPGDFYPLMKLKMAASNAEKQIPPQPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLELGK+YQEAIEDIT RMG GMA FICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSMAFLELGKSYQEAIEDITKRMGVGMANFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ADG36708.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPGEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTA LEL KNYQ AIE+IT  MGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTALLELEKNYQAAIENITKGMGAGMAKFICNEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_002313765.1| squalene synthase family protein [Populus trichocarpa]
 gb|EEE87720.1| squalene synthase family protein [Populus trichocarpa]
Length=413

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHP D+YPL+KLK+AA+   KQIP +PHW FCY+ML +VSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPADLYPLLKLKMAAKHAAKQIPSEPHWAFCYSMLHRVSRSFAFVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR WHF CGT DY+VLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDRNWHFSCGTNDYRVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFH VSTAFLEL K YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHDVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>emb|CAJ58419.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRA DTVEDDTSI+TEVKVPI++ FH HIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRAFDTVEDDTSISTEVKVPIVMAFHCHIYDNDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVS AFL+LG  Y+EAIEDITMRMGAGMAKF+CKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMRMGAGMAKFLCKEVETIDDYDEYCHYVAGLVGL  178



>gb|AAR20328.1| squalene synthase [Artemisia annua]
Length=413

 Score =   318 bits (816),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +1

Query  118  GSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIE  297
             SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  +
Sbjct  1    SSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNPQ  60

Query  298  LRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQ  477
            LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMDQ
Sbjct  61   LRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMDQ  120

Query  478  FHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            FHHVSTAFLEL + YQEAIEDITMRMGAGMAKFICKEVET+DDYDEYCHYVAGLVG+
Sbjct  121  FHHVSTAFLELKRGYQEAIEDITMRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGI  177



>ref|XP_010039880.1| PREDICTED: squalene synthase-like isoform X1 [Eucalyptus grandis]
Length=419

 Score =   318 bits (816),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS GA+L+HP D YPL+KLK+AA   EKQIPPQPHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSWGAILRHPGDFYPLMKLKMAASNAEKQIPPQPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLELGK+YQEAIEDIT RMG GMA FICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSMAFLELGKSYQEAIEDITKRMGVGMANFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
 gb|EOX97878.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
Length=413

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++++PDD YPL KLK+AAR  EKQIP +PHW FC++ML KVSRSFA VIQQL  
Sbjct  1    MGSLGALVRNPDDFYPLFKLKMAARHAEKQIPSEPHWAFCFSMLLKVSRSFAFVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILIDFHRHIY+R+WHF CGTK YKVLMD
Sbjct  61   KLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIDFHRHIYNRDWHFSCGTKHYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLEL K YQ AIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELEKGYQVAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AIX97193.1| squalene synthase [Matricaria chamomilla var. recutita]
Length=409

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL A+LKHPDD +PL+KLK+AA + EKQIP +PHW F Y+ML KVSR+FALVIQQL  
Sbjct  1    MGSLKAVLKHPDDFFPLLKLKMAANKAEKQIPSEPHWAFSYSMLHKVSRNFALVIQQLNP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHQHIYNRDWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL + YQEAIEDITMRMGAGMAKFICKEVET+DDYDEYCHYVAGLVG+
Sbjct  121  QFHHVSTAFLELKRGYQEAIEDITMRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGI  178



>gb|KJB32574.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
 gb|KJB32576.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=412

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDRDWHFSCGTKNYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLEL K YQEAIEDIT RMGAGMAKFICKEVET+ DYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKEVETVGDYDEYCHYVAGLVGL  178



>gb|KHN25422.1| Squalene synthase [Glycine soja]
Length=408

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  139  KHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCI  318
            +  D+ YPL+KLKI AR  EKQIPP+PHW FCYTML KVSRSFALVIQQL IELR+AVCI
Sbjct  4    RSEDEFYPLLKLKIVARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGIELRNAVCI  63

Query  319  FYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTA  498
            FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLM QFHHVSTA
Sbjct  64   FYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMGQFHHVSTA  123

Query  499  FLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            FLELGKNYQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  124  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  173



>gb|KHG07441.1| Squalene synthase [Gossypium arboreum]
Length=412

 Score =   315 bits (808),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDPDWHFSCGTKNYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLEL K YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_002305455.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
 gb|EEE85966.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
Length=476

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  KMGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLP  291
            KMGSLGA+LKHP D+YPL+KLK+AA+  EKQIP +PHW FCY+ML +VSRSFALVIQQL 
Sbjct  63   KMGSLGAILKHPVDIYPLLKLKMAAKHAEKQIPREPHWAFCYSMLPRVSRSFALVIQQLD  122

Query  292  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  471
             ELR+AVC+FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD +WHF CGTK+YKVLM
Sbjct  123  TELRNAVCVFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDHDWHFSCGTKEYKVLM  182

Query  472  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            DQFH+VS AFLELGK YQEAIEDIT RMGAGMAKFI KEVE+IDDYDEYCHYVAGLVGL
Sbjct  183  DQFHNVSNAFLELGKGYQEAIEDITKRMGAGMAKFILKEVESIDDYDEYCHYVAGLVGL  241



>gb|KJB12171.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=412

 Score =   315 bits (806),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K   EAIEDIT+RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGL-EAIEDITLRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  177



>gb|AAG14896.2|AF302464_1 squalene synthase [Artemisia annua]
 gb|AAK92539.1|AF405310_1 squalene synthase [Artemisia annua]
Length=418

 Score =   315 bits (806),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  
Sbjct  1    MSSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLEL + YQEAI DITMRM AGMAKFICKEVET+DDYDE+CHYVAGLVG+
Sbjct  121  QFHHVSTAFLELKRGYQEAIGDITMRMSAGMAKFICKEVETVDDYDEFCHYVAGLVGI  178



>gb|ABQ96265.1| squalene synthase [Psammosilene tunicoides]
Length=414

 Score =   315 bits (806),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LK+PD+ YPL+KLK+A ++ EKQIP + HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKYPDEFYPLLKLKMAIKEAEKQIPQEHHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSIATEVKVPIL  FH+HIYDR+WHF CGTK YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIATEVKVPILRAFHQHIYDRDWHFSCGTKHYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLEL + YQEAIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELDRGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana]
 sp|P53799.1|FDFT_ARATH RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Arabidopsis thaliana]
 emb|CAA60385.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 dbj|BAA06103.1| squalene synthase [Arabidopsis thaliana]
 gb|AAB62242.1| squalene synthase 1 [Arabidopsis thaliana]
 emb|CAA18843.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAD00296.1| squalene synthase [Arabidopsis thaliana]
 emb|CAB80181.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAM20719.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AAO30082.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86403.1| Squalene synthase [Arabidopsis thaliana]
Length=410

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIYD +WH+ CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYDTDWHYSCGTKEYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum]
Length=412

 Score =   313 bits (801),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHP D YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPGDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILEEFYRHIYDRDWHFSCGTKNYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLEL K YQEAIEDIT RMGAGMAKFICKEVET+ DYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKEVETVGDYDEYCHYVAGLVGL  178



>ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45392.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   310 bits (794),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGT +YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTNEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010690774.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPD+ YPL+KLK+A ++ EKQIPP+ HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDEFYPLLKLKMAVKEAEKQIPPEAHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI  +VK+PIL +FH+HIYDR+WHF CGTK YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIDNDVKLPILRNFHQHIYDRDWHFSCGTKHYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLEL + YQ AIEDIT RMGAGMAKFICKEVET+ DYDEYCHYVAGLVGL
Sbjct  121  EFHHVSTAFLELDRGYQLAIEDITKRMGAGMAKFICKEVETVSDYDEYCHYVAGLVGL  178



>ref|XP_010437580.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=410

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_006412201.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 ref|XP_006412202.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53654.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53655.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
Length=409

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG ML++PDD+YPL+K+K A  Q EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEQAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PIL  FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILKAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010432389.1| PREDICTED: squalene synthase [Camelina sativa]
Length=410

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010447048.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=410

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>gb|KFK30097.1| hypothetical protein AALP_AA7G216600 [Arabis alpina]
Length=412

 Score =   308 bits (790),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M SLG +L++PDD+YPL+K+K A  Q EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MASLGTILRYPDDIYPLLKMKRAIEQAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_008796682.1| PREDICTED: squalene synthase-like isoform X3 [Phoenix dactylifera]
Length=378

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+VSTAFLELG +YQEAIEDIT RMGAGMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKRMGAGMAKFICKEVETINDYDEYCHYVAGLVGL  178



>ref|XP_010437579.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=419

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_009110610.1| PREDICTED: squalene synthase [Brassica rapa]
 ref|XP_009110680.1| PREDICTED: squalene synthase [Brassica rapa]
Length=409

 Score =   308 bits (789),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVSAAFLELDKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
 gb|EOA16726.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
Length=414

 Score =   307 bits (787),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG ML++PDD++PL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIFPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FH+HIY+ +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHQHIYNTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010934354.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
 ref|XP_010910886.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
Length=408

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LGA+++HP+D+YPL+KLK+AA +I++QIP +PHW F Y MLQKVSRSFALVIQQL +
Sbjct  1    MGMLGAIMEHPEDLYPLVKLKMAADRIKRQIPGEPHWAFSYAMLQKVSRSFALVIQQLGL  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHRHIYDCDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+VSTAFLELG +YQ AIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  KFHYVSTAFLELGPSYQVAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AGW25489.1| squalene synthase [Paris polyphylla var. yunnanensis]
Length=403

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG + A+L HP D+Y L+KLK+AA +IE+QIP +PHW F YTMLQKVSRSFA+VIQQL  
Sbjct  1    MGMMAAVLDHPGDLYVLVKLKMAASRIERQIPAEPHWAFAYTMLQKVSRSFAIVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+VSTAFLEL K YQEAIE+IT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  KFHYVSTAFLELDKGYQEAIEEITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_008796678.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008796679.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=409

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+VSTAFLELG +YQEAIEDIT RMGAGMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKRMGAGMAKFICKEVETINDYDEYCHYVAGLVGL  178



>ref|XP_008796681.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+VSTAFLELG +YQEAIEDIT RMGAGMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKRMGAGMAKFICKEVETINDYDEYCHYVAGLVGL  178



>gb|EPS74249.1| hypothetical protein M569_00507, partial [Genlisea aurea]
Length=292

 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG++GA+L+HP+D  P++KLK+A ++ EKQIP +P W FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGTVGAILRHPNDFIPMLKLKMAMKKAEKQIPEEPQWRFCYSMLHRVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDA+C+FYLVLRALDTVEDDTSIAT+VKVPILI FH H+YDR WHF CGTKDYK+LMD
Sbjct  61   DLRDAICVFYLVLRALDTVEDDTSIATDVKVPILISFHSHLYDRGWHFSCGTKDYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+V TAF ELG++YQEAIEDIT RMGAGMAKFICKEVET++DYDEYCHYVAGLVGL
Sbjct  121  EFHNVQTAFSELGRSYQEAIEDITKRMGAGMAKFICKEVETVEDYDEYCHYVAGLVGL  178



>ref|XP_006412200.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
 gb|ESQ53653.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
Length=396

 Score =   305 bits (780),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +++HPD++YPL+KLKIA  + + QIP +PH  FCY+MLQKVS+SF+LVIQQL  
Sbjct  1    MGSLSTIVRHPDEIYPLLKLKIAITKAQNQIPLEPHLAFCYSMLQKVSKSFSLVIQQLAT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTSI  E+KVPILI FHRHI+DR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSIPVEIKVPILIAFHRHIFDRNWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT RMGAGMAKF+CKEVET+DDYDEYCH+VAGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFVCKEVETVDDYDEYCHHVAGLVGL  178



>ref|XP_008795798.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=373

 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M  LGA+++HP+++YPL+KLK+AA +I+KQIP +PHW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MRMLGAIVEHPEELYPLVKLKMAAARIKKQIPGEPHWAFSYTMLQKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI  ++KVPIL  FH HIYDR+WHF CGTKDY+VLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPCDIKVPILESFHCHIYDRDWHFSCGTKDYRVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+VSTAFLELG +YQ+AIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  KFHYVSTAFLELGASYQQAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_009138312.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138313.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138314.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=417

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            Q HHVS AFLEL K YQEAIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  121  QLHHVSAAFLELEKGYQEAIEEITKRMGAGMAKFICHEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_008795796.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=408

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M  LGA+++HP+++YPL+KLK+AA +I+KQIP +PHW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MRMLGAIVEHPEELYPLVKLKMAAARIKKQIPGEPHWAFSYTMLQKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI  ++KVPIL  FH HIYDR+WHF CGTKDY+VLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPCDIKVPILESFHCHIYDRDWHFSCGTKDYRVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+VSTAFLELG +YQ+AIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  KFHYVSTAFLELGASYQQAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010025621.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPD++YPL+KLK+ AR  EKQ+P QPHW FCY+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGAILKHPDELYPLLKLKMKARNAEKQLPQQPHWRFCYSMLRKFSKTFAFVIEQLPT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCI YLVLRALDTVEDDTSI  +VKVPIL  F +H++D+EWHF CGTK+ KVLMD
Sbjct  61   ELRDAVCILYLVLRALDTVEDDTSIPVDVKVPILKAFLQHVFDKEWHFSCGTKECKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQE IE+IT RMGAGMAKFICKEVET+DDY+EYCHYV+GL+GL
Sbjct  121  QFHHVSTAFLELGKRYQEVIEEITKRMGAGMAKFICKEVETVDDYNEYCHYVSGLIGL  178



>ref|XP_009389044.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=408

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG L AM+ HPD+VYP++KLK+A+ +I +QIP +PHW F Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMLAAMVTHPDEVYPMVKLKLASDRIRRQIPAEPHWSFSYSMLQKVSRSFALVIQQLEP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVC+FYLVLRALDTVEDDTSI +++KVPIL +F+ HIYDR+WHF CG KDYK+LMD
Sbjct  61   QLRDAVCVFYLVLRALDTVEDDTSIPSDIKVPILQNFYLHIYDRKWHFSCGAKDYKILMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH VSTAFLEL K+YQEAIEDIT RMGAGMAKFICKEVE+IDDYDEYCHYVAGLVGL
Sbjct  121  KFHLVSTAFLELDKSYQEAIEDITRRMGAGMAKFICKEVESIDDYDEYCHYVAGLVGL  178



>ref|XP_009108714.1| PREDICTED: squalene synthase-like isoform X1 [Brassica rapa]
 ref|XP_009108715.1| PREDICTED: squalene synthase-like isoform X2 [Brassica rapa]
Length=410

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDE CHYVA LVGL
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDENCHYVAALVGL  178



>gb|AAY22201.1| squalene synthase [Datura inoxia]
Length=387

 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  184  ARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDT  363
            AR  EKQIPP+PHWGFCY ML KVSRSFALVIQQLP+ELRDAVCIFYLVLRALDTVEDDT
Sbjct  1    ARHAEKQIPPEPHWGFCYLMLHKVSRSFALVIQQLPVELRDAVCIFYLVLRALDTVEDDT  60

Query  364  SIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDI  543
            SI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMDQFHHVSTAFLELGK+YQ+AIEDI
Sbjct  61   SIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMDQFHHVSTAFLELGKHYQQAIEDI  120

Query  544  TMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            TMRMGAGMAKFICKEVET +DYDEYCHYVAGLVGL
Sbjct  121  TMRMGAGMAKFICKEVETTNDYDEYCHYVAGLVGL  155



>ref|XP_006285747.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
 gb|EOA18645.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
Length=413

 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +PH  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAITKAQKQIPLEPHLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTS+  E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVEMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIED+T RMGAGMAKFICKEVETIDDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDVTKRMGAGMAKFICKEVETIDDYDEYCHYAAGLVGL  178



>gb|AFY63035.1| squalene synthase [Alisma plantago-aquatica subsp. orientale]
Length=409

 Score =   300 bits (769),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG +GA+L+HP+D+  L+KLK+A R+IEKQIPP+PHWGF YTMLQ+VSRSFA+VIQQL  
Sbjct  1    MGVVGAILEHPEDLVALLKLKVAVRKIEKQIPPEPHWGFSYTMLQRVSRSFAIVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLR LDT+EDDTSI T+ K+PIL  FH+HIYD +WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRGLDTIEDDTSIPTDTKLPILNSFHQHIYDPDWHFSCGVKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             FH+VS AFLEL K+Y++AIEDIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  NFHYVSNAFLELDKSYKDAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_002869132.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45391.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   300 bits (769),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTSI  E KVPILI FHRH+YD  WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSIPMETKVPILIAFHRHLYDGGWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYAAGLVGL  178



>ref|XP_010447047.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +P+  FCYTML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKQIPLEPNLAFCYTMLHKVSKSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAVEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT RMG GMAKFICKEVET+DDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGEGMAKFICKEVETVDDYDEYCHYAAGLVGL  178



>gb|AGN32410.1| squalene synthase [Dioscorea zingiberensis]
Length=409

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG +GAM+++P +   L+KLK+AA +I +QIPP+ HW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MGMMGAMVENPGEAVALVKLKVAAARIARQIPPEEHWAFAYTMLQKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLRALDTVEDDTSI  +VKVPIL  FH HIYDR+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPADVKVPILQAFHCHIYDRDWHFSCGAKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH+VSTAFLELGK YQEAI+DIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  KFHYVSTAFLELGKGYQEAIDDITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>emb|CDX72493.1| BnaC07g45150D [Brassica napus]
Length=426

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 159/187 (85%), Gaps = 9/187 (5%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLC---------G  447
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C         G
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCKFYSIQTLGG  120

Query  448  TKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHY  627
            TK+YKVLMDQFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHY
Sbjct  121  TKEYKVLMDQFHHVSAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHY  180

Query  628  VAGLVGL  648
            VAGLVGL
Sbjct  181  VAGLVGL  187



>gb|AHB20141.2| squalene synthase [Fritillaria thunbergii]
Length=409

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG +   L HP+D+Y L+K+K AA Q+EKQIPP PHW FCYTMLQKVSRSFA VIQQL  
Sbjct  1    MGMMKEALMHPEDLYVLVKMKRAAAQVEKQIPPDPHWAFCYTMLQKVSRSFAFVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTSI  ++K+PIL  FHRHIY+ +WHF CGTKDYKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPEDIKLPILESFHRHIYNPDWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             F ++STAFLELGK+YQE IEDIT RMG GMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  121  NFRNISTAFLELGKSYQEGIEDITERMGKGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_010437578.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=407

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLKIA  + +K+IP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKKIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLM+
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLME  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYAAGLVGL  178



>ref|XP_010437577.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=410

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLKIA  + +K+IP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKKIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLM+
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLME  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYAAGLVGL  178



>gb|AGI56082.1| squalene synthase [Dendrobium catenatum]
Length=410

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG + A+L+HP+D+ PL K+ + A QI++QIPP+PHWGF Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMVKAVLEHPEDLIPLTKMMMTAEQIKRQIPPEPHWGFAYSMLQKVSRSFALVIQQLDA  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLRALDTVEDDTSI  ++KVPIL++FH+HIYDR+WHF CGT  YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPVDIKVPILLEFHKHIYDRDWHFSCGTNAYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FH +S AFLELGK+YQEAIED+T+RMGAGMAKF+ KEVET+DDYDEYCHYVAGLVGL
Sbjct  121  KFHFISIAFLELGKSYQEAIEDVTLRMGAGMAKFMFKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_009760451.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
 ref|XP_009760452.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=406

 Score =   297 bits (761),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG +G +++HP+++YPLIKL + A+  EKQIP +P+W FCY ML+ +SRSF+LVIQQLP+
Sbjct  1    MGIIGDIVRHPNEIYPLIKLLVTAKLAEKQIPSKPNWSFCYLMLRNISRSFSLVIQQLPL  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYLVLRALDTVEDDTSIATEVKVPILI FHRHIYD EWHF CGT  YK LMD
Sbjct  61   ELRDAVCVFYLVLRALDTVEDDTSIATEVKVPILIAFHRHIYDHEWHFSCGTDAYKDLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLELG NYQ+ IEDITMRMG GMAKFI  E++TIDDY+EYCHYVAGL GL
Sbjct  121  QFHHVSMAFLELGTNYQQVIEDITMRMGEGMAKFISTEIQTIDDYEEYCHYVAGLAGL  178



>gb|KJB32578.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=406

 Score =   297 bits (761),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 159/178 (89%), Gaps = 6/178 (3%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR      GTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDR------GTKNYKVLMD  114

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVSTAFLEL K YQEAIEDIT RMGAGMAKFICKEVET+ DYDEYCHYVAGLVGL
Sbjct  115  EFHHVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKEVETVGDYDEYCHYVAGLVGL  172



>gb|AAB61927.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY++L KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSILHKVSKSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTS+  E+KVPILI FHRHIYD +WHF CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVPVEIKVPILIAFHRHIYDGDWHFSCGTKEYKLLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFL+L K YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLKLEKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYAAGLVGL  178



>ref|XP_009396917.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396918.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=409

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LG ++ +P++VYPL+KLK+AA +I +QIP +PHW F Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMLGTVVAYPEEVYPLVKLKLAADRIRRQIPAEPHWAFSYSMLQKVSRSFALVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTSI +++KVPIL +F+RHIYD EWHF CGTKDYKVLMD
Sbjct  61   QLRNAVCVFYLVLRALDTVEDDTSIPSDIKVPILQNFYRHIYDCEWHFSCGTKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            + H VSTAFLEL ++YQEAIEDIT RMGAGMAKFICKEVET DDYDEYCHYVAGLVGL
Sbjct  121  KLHLVSTAFLELERSYQEAIEDITKRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|NP_195191.2| squalene synthase 2 [Arabidopsis thaliana]
 emb|CAA18844.2| putative squalene synthase [Arabidopsis thaliana]
 emb|CAB80182.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86404.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY++L KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSILHKVSKSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTS+  E+KVPILI FHRHIYD +WHF CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVPVEIKVPILIAFHRHIYDGDWHFSCGTKEYKLLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFL+L K YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLKLEKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYAAGLVGL  178



>emb|CDY17472.1| BnaC03g65910D [Brassica napus]
Length=426

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 160/194 (82%), Gaps = 16/194 (8%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLC----------  444
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C          
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCKSEESFNLFD  120

Query  445  ------GTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDD  606
                  GTK+YKVLMDQFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DD
Sbjct  121  LSHPFGGTKEYKVLMDQFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDD  180

Query  607  YDEYCHYVAGLVGL  648
            YDEYCHYVAGLVGL
Sbjct  181  YDEYCHYVAGLVGL  194



>ref|XP_010432387.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKQIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAVEIKLPILIAFHRHIYDCDWHFSCGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIEDIT RMGAGMA FICKEVET+D YDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMATFICKEVETVDGYDEYCHYAAGLVGL  178



>ref|XP_006841632.1| PREDICTED: squalene synthase [Amborella trichopoda]
 gb|ERN03307.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
Length=407

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LG++LKHP D+  L+KLK A+   EKQ+PP+PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGKLGSLLKHPADLPALVKLKFASLYAEKQVPPEPHWAFCYTMLQKVSRSFALVIQQLEP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLR LDTVEDDTSI  +VK+PIL  FHRHIYD  WHF CGT  YK+LMD
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIPADVKLPILESFHRHIYDVNWHFSCGTNHYKMLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             F HV+++FLELG+ YQEAIEDIT  MGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  HFQHVASSFLELGRRYQEAIEDITKGMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_010065915.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG +LKHPD++Y L+KLK+ AR  EKQIP QPHW F Y+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGVILKHPDELYHLLKLKMEARNAEKQIPQQPHWRFGYSMLRKFSKTFAFVIEQLPT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCI YLVLRALDTVEDDTSI  EVKVPIL  F  H++D+EWH  CGTK  KVLMD
Sbjct  61   ELRDAVCILYLVLRALDTVEDDTSIPIEVKVPILKAFLEHVFDKEWHLSCGTKKCKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQE IEDIT RMG GMAKFICKEVET+DDYDEYCHYV+GL+GL
Sbjct  121  QFHHVSTAFLELGKRYQEVIEDITKRMGVGMAKFICKEVETVDDYDEYCHYVSGLIGL  178



>ref|XP_010690775.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M SLGA++KHPD+ YPL+KLK+A  + EKQIP + HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLGAIMKHPDEFYPLLKLKMAVNKAEKQIPSEAHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTS+A +VK+PIL  FH HIYDR+WHF CGTK YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSLADDVKIPILRAFHEHIYDRDWHFSCGTKHYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +F++V TAFLEL + YQ AIEDIT RMGAGMAKF+CKEVETI DYDEYCHYVAGLVGL
Sbjct  121  EFNYVRTAFLELDRGYQVAIEDITKRMGAGMAKFVCKEVETIVDYDEYCHYVAGLVGL  178



>gb|ACI14294.1| squalene synthase [Linum usitatissimum]
Length=271

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  196  EKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIAT  375
            EKQIPP PHWGFCYTML KVSRSFALVIQQL  ELRDAVCIFYLVLRALDTVEDDTSIAT
Sbjct  2    EKQIPPHPHWGFCYTMLLKVSRSFALVIQQLGTELRDAVCIFYLVLRALDTVEDDTSIAT  61

Query  376  EVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRM  555
            EVKVPIL DFHRHIYD+EWHF CGTKDYKVLMD+FHHVSTAFLELG+ YQEAIEDIT RM
Sbjct  62   EVKVPILNDFHRHIYDQEWHFSCGTKDYKVLMDEFHHVSTAFLELGRGYQEAIEDITKRM  121

Query  556  GAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            G GMAKFI KEVE++DDYDEYCHYVAGLVGL
Sbjct  122  GDGMAKFILKEVESLDDYDEYCHYVAGLVGL  152



>emb|CDX72494.1| BnaC07g45160D [Brassica napus]
Length=395

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP  PH  FCY+ L KVS++F+L+IQQL  
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAITKAQKQIPLDPHLTFCYSTLNKVSKTFSLIIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYL+LRALDTVEDDTSI TE+KVPILI FHRHIYDR+WHF+CG + YKVLM+
Sbjct  61   ELRDAVCLFYLILRALDTVEDDTSIPTEIKVPILIAFHRHIYDRDWHFVCGEEKYKVLME  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQE IEDIT RMGAGMAKFI KEVET+DDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEIIEDITKRMGAGMAKFISKEVETVDDYDEYCHYAAGLVGL  178



>ref|XP_009110500.1| PREDICTED: squalene synthase [Brassica rapa]
Length=418

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  291
            MGSL  +L+HPD++YPL++LK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLRLKLAIMKAQNQIPLDDPHLAVCYSLLQKVSRSFSLVIQQLG  60

Query  292  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  471
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR+WHF CGTK+YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPIEIKVPILLAFHRHIYDRDWHFTCGTKEYKVLM  120

Query  472  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            DQFHHVS AFLEL + YQEAIEDIT RMGAGMAKFI KEVET+DDYDEYCHY AGLVGL
Sbjct  121  DQFHHVSAAFLELEEGYQEAIEDITKRMGAGMAKFISKEVETVDDYDEYCHYAAGLVGL  179



>emb|CDX69076.1| BnaC01g03770D [Brassica napus]
Length=428

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  291
            MGSL  +L+HPD++YPL+KLK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAIIKAQNQIPLDDPHLALCYSLLQKVSRSFSLVIQQLG  60

Query  292  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  471
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR+WHF+CGT++YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPMEIKVPILLAFHRHIYDRDWHFICGTEEYKVLM  120

Query  472  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            DQFHHVS AFLEL K YQEAIEDIT RMGAGMAKFI +EVET+D+YDEYCHY AGLVGL
Sbjct  121  DQFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFISREVETVDEYDEYCHYAAGLVGL  179



>emb|CDY45323.1| BnaA03g52960D [Brassica napus]
Length=218

 Score =   284 bits (726),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSL  +L HPD++YPL+KLK+A  + +KQIP  PH  FCY+ L KV ++F+L+IQQL  
Sbjct  1    MGSLSTILIHPDEIYPLLKLKLAITKAQKQIPLDPHLTFCYSTLNKVFKTFSLIIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYL+LRALDTVEDDTSI TE+KVPI I FHRHIYDR+WHF+CG + YKVLM+
Sbjct  61   ELRDAVCVFYLILRALDTVEDDTSIPTEIKVPIRIAFHRHIYDRDWHFVCGEEKYKVLME  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQE IEDIT RMGAGMAKFI KEVET+DDYDEYCHY AGLVGL
Sbjct  121  QFHHVSAAFLELEKGYQEIIEDITKRMGAGMAKFISKEVETVDDYDEYCHYAAGLVGL  178



>ref|XP_002466259.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
 gb|EER93257.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
Length=403

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = +1

Query  124  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  303
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQLP +LR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFGYSMLQKVSRSFALVIQQLPPQLR  59

Query  304  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  483
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RHIY+R+WHF CGT  Y+VLMD FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHFSCGTNHYRVLMDNFH  119

Query  484  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            HVSTAFLELG+ YQ+AIE+IT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVG
Sbjct  120  HVSTAFLELGQGYQKAIEEITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVG  173



>emb|CDX75451.1| BnaA01g02510D [Brassica napus]
Length=413

 Score =   290 bits (741),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  291
            MGSL  +L+HPD++YPL+KLK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAIMKAQNQIPLDDPHLAICYSLLQKVSRSFSLVIQQLG  60

Query  292  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  471
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR WHF CGT++YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPMEIKVPILLAFHRHIYDRGWHFTCGTEEYKVLM  120

Query  472  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            DQFHHVS AFLEL + YQEAIEDIT RMGAGMAKFI KEVET+DDYDEYCHY AGLVGL
Sbjct  121  DQFHHVSAAFLELEEGYQEAIEDITKRMGAGMAKFISKEVETVDDYDEYCHYAAGLVGL  179



>gb|KFK30098.1| hypothetical protein AALP_AA7G216700 [Arabis alpina]
Length=413

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  291
            MGSL  +L HPD++YPL KL IA  + + QIP  +PH  FCY+ML KVS+SF+LVIQQL 
Sbjct  1    MGSLSTILSHPDEIYPLFKLVIAITKAKNQIPFHEPHLAFCYSMLHKVSKSFSLVIQQLG  60

Query  292  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  471
             ELR+AVC+FYL+LRALDTVEDDTSI  E+KVPILIDFHRH+YDR+WHF CGTKDYKVLM
Sbjct  61   TELRNAVCLFYLILRALDTVEDDTSIPIEIKVPILIDFHRHMYDRDWHFSCGTKDYKVLM  120

Query  472  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVA  633
            +QFHHVS AFLEL K YQEAIEDIT RMGAGMAKFICKEVETIDDYDEYCHYVA
Sbjct  121  NQFHHVSAAFLELDKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVA  174



>ref|XP_006651930.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=403

 Score =   285 bits (728),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +1

Query  130  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  309
             +L  P++V PL+KL++AA ++++QIPP+ HW F YTMLQKVSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRLKRQIPPEEHWAFAYTMLQKVSRSFALVIQQLGPDLRNA  61

Query  310  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  489
            VCIFYLVLRALDTVEDDTSI TEVKVPIL  FH+HIY+R+WH+ CGTKDYKVLMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPTEVKVPILQQFHKHIYNRDWHYSCGTKDYKVLMDKFRLV  121

Query  490  STAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            STAFLELG+ YQEAIE+IT  MGAGMAKFICKEVET+ DYDEYCHYVAGLVG
Sbjct  122  STAFLELGQGYQEAIEEITRLMGAGMAKFICKEVETVSDYDEYCHYVAGLVG  173



>ref|NP_001130502.1| uncharacterized protein LOC100191601 [Zea mays]
 gb|ACF78747.1| unknown [Zea mays]
Length=403

 Score =   285 bits (728),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +1

Query  124  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  303
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  304  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  483
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RH+Y+R+WH+ CGT  YKVLMD+FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYKVLMDKFH  119

Query  484  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
             VSTAFLELG+ YQ+AIE+IT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVG
Sbjct  120  LVSTAFLELGQGYQKAIEEITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVG  173



>ref|NP_001104839.1| squalene synthase1 [Zea mays]
 dbj|BAA22558.1| squalene synthase [Zea mays]
 gb|ACN34757.1| unknown [Zea mays]
 gb|AFW67298.1| Squalene synthase isoform 1 [Zea mays]
 gb|AFW67299.1| Squalene synthase isoform 2 [Zea mays]
Length=401

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +1

Query  124  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  303
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  304  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  483
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RHIY+R+WH+ CGT  YK+LMD+F 
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHYSCGTNHYKMLMDKFR  119

Query  484  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            HVSTAFLELG+ YQ+AIE++T RMGAGMAKFICKEVET+DDYDEYCHYVAGLVG
Sbjct  120  HVSTAFLELGEGYQKAIEEVTRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVG  173



>tpg|DAA52014.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=403

 Score =   284 bits (727),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +1

Query  124  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  303
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  304  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  483
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RH+Y+R+WH+ CGT  YKVLMD+FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYKVLMDKFH  119

Query  484  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
             VSTAFLELG+ YQ+AIE+IT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVG
Sbjct  120  LVSTAFLELGQGYQKAIEEITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVG  173



>gb|AFJ15526.1| squalene synthase [Azadirachta indica]
Length=392

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  178  IAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVED  357
            +A R  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  +LR+AVCIFYLVLRALDTVED
Sbjct  1    MAVRHAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGTDLRNAVCIFYLVLRALDTVED  60

Query  358  DTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIE  537
            DTSI  +VKVPILI F  H+YDR WHF CGTK+YKVLMDQFH VSTAFLELGK YQEAIE
Sbjct  61   DTSIPADVKVPILIAFRHHVYDRNWHFSCGTKEYKVLMDQFHLVSTAFLELGKGYQEAIE  120

Query  538  DITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            DIT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  121  DITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  157



>ref|XP_010025618.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=407

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 6/178 (3%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLGA+LKHPD+      LK+ AR  EK IP QPHW FCY+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGAILKHPDE------LKMEARNAEKLIPQQPHWRFCYSMLRKFSKTFAFVIEQLPT  54

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCI YLVLRALDTVEDDTSI   VKVPIL  F +H++D+EWH  CG+K+ KVLMD
Sbjct  55   ELRDAVCILYLVLRALDTVEDDTSIPVAVKVPILKAFLQHVFDKEWHLSCGSKECKVLMD  114

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFLELGK YQE IEDIT RMGAGMAKFICKEVET+DDY+EYCHYV+GL+GL
Sbjct  115  QFHHVSTAFLELGKRYQEVIEDITKRMGAGMAKFICKEVETVDDYNEYCHYVSGLIGL  172



>ref|NP_001051625.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAA22557.1| squalene synthase [Oryza sativa Japonica Group]
 gb|AAS07223.1| squalene synthase [Oryza sativa Japonica Group]
 gb|ABF99429.1| Squalene synthetase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13539.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAH01306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +1

Query  130  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  309
             +L  P++V PL+KL++AA +I++QIPP+ HW F YTMLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRNA  61

Query  310  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  489
            VCIFYLVLRALDTVEDDTSI   VKVPIL +FHRHIY+R+WH+ CGTKDYK+LMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKLLMDKFRLV  121

Query  490  STAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            STAFLELG+ YQEAIE+IT  MGAGMAKFICKEVET+DDY+EYCHYVAGLVG
Sbjct  122  STAFLELGQGYQEAIEEITRLMGAGMAKFICKEVETVDDYNEYCHYVAGLVG  173



>emb|CDX75450.1| BnaA01g02520D [Brassica napus]
Length=398

 Score =   281 bits (719),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 11/178 (6%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTKEYKVLMD  109

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  110  QFHHVSAAFLELDKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  167



>emb|CDX69075.1| BnaC01g03780D [Brassica napus]
Length=398

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 151/178 (85%), Gaps = 11/178 (6%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GT +YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTNEYKVLMD  109

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  110  QFHHVSAAFLELDKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  167



>emb|CDX76294.1| BnaA08g11060D [Brassica napus]
Length=400

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 151/178 (85%), Gaps = 11/178 (6%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTKEYKVLMD  109

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+EVET+DDYDEYCHYVAGLVGL
Sbjct  110  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGL  167



>gb|ABI14439.1| squalene synthase [Taxus cuspidata]
Length=409

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            M S+GA+LKHP+DV  L+K+K AA    KQIP  P   FCYTMLQKVSRSFA VIQQL +
Sbjct  1    MASIGAILKHPEDVPALLKMKFAAAHASKQIPLDPDLAFCYTMLQKVSRSFAFVIQQLGL  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLR LDTVEDD SI  + K+PIL +FH+HIYD  WHF CG  DYK LMD
Sbjct  61   ELRNAVCVFYLVLRGLDTVEDDMSIPVDTKLPILTNFHQHIYDPSWHFSCGVNDYKELMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVSTAFL LGK YQE IE+IT RMGAGMAKFI +EVE+++DYDEYCHYVAGLVGL
Sbjct  121  QFHHVSTAFLALGKRYQEGIEEITKRMGAGMAKFIRQEVESVEDYDEYCHYVAGLVGL  178



>gb|EEE60131.1| hypothetical protein OsJ_13016 [Oryza sativa Japonica Group]
Length=413

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 152/182 (84%), Gaps = 10/182 (5%)
 Frame = +1

Query  130  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  309
             +L  P++V PL+KL++AA +I++QIPP+ HW F YTMLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRNA  61

Query  310  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  489
            VCIFYLVLRALDTVEDDTSI   VKVPIL +FHRHIY+R+WH+ CGTKDYK+LMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKLLMDKFRLV  121

Query  490  STAFLELGKNYQEAIEDITMRMGAGMAKFICKE----------VETIDDYDEYCHYVAGL  639
            STAFLELG+ YQEAIE+IT  MGAGMAKFICKE          VET+DDY+EYCHYVAGL
Sbjct  122  STAFLELGQGYQEAIEEITRLMGAGMAKFICKEFHVQFLAVLSVETVDDYNEYCHYVAGL  181

Query  640  VG  645
            VG
Sbjct  182  VG  183



>gb|AHI96421.1| squalene synthase [Pinus massoniana]
Length=409

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS+GA+LKHP+DV  L+++KIA     KQIP +P   FC+TMLQ+VSRSFA VIQQL  
Sbjct  1    MGSIGALLKHPEDVPALVRMKIAQTHALKQIPSEPDLAFCFTMLQRVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVCIFYLVLR LDTVEDDTSI  + K+PIL  F++HIYD  WHF CG   YK LM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIPLDTKLPILKAFYKHIYDPSWHFSCGVNHYKELME  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +FHHVST FL LG+ YQEAIE+IT +MGAGMAKFICKEVE+++DYDEYCHYVAGLVG 
Sbjct  121  KFHHVSTTFLRLGRGYQEAIEEITKKMGAGMAKFICKEVESVEDYDEYCHYVAGLVGF  178



>ref|XP_006351382.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=400

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 150/178 (84%), Gaps = 3/178 (2%)
 Frame = +1

Query  124  LGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQLPI  294
            +G ++KHPD++YPL+KL ++A+++EK+      QPHW FCY +L+KVSRSFALVIQQLP 
Sbjct  1    MGEIMKHPDELYPLMKLMLSAKRVEKKTSVWLLQPHWAFCYAILRKVSRSFALVIQQLPS  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRD VC++YLVLRALDTVEDDTS+ TEV+VPIL DF+ H++D EWHF C T  +KVLMD
Sbjct  61   DLRDVVCVYYLVLRALDTVEDDTSLTTEVRVPILKDFYSHLHDPEWHFSCDTIAFKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVST+ LEL  +YQE I+DIT RMG GMAKF+CKEVETI+DY+EYCHY AGL GL
Sbjct  121  QFHHVSTSLLELDTDYQEVIKDITKRMGEGMAKFLCKEVETINDYNEYCHYAAGLCGL  178



>emb|CDY45322.1| BnaA03g52950D [Brassica napus]
Length=407

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 145/178 (81%), Gaps = 10/178 (6%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C          
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSC----------  110

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +++    AFLEL K YQEAIE+IT RMGAGMAKFIC EVET+DDYDEYCHYVAGLVGL
Sbjct  111  KWYQGIQAFLELEKGYQEAIEEITKRMGAGMAKFICHEVETVDDYDEYCHYVAGLVGL  168



>dbj|BAJ87710.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +1

Query  130  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  309
             +L  P++V  L++LK+AA +I +QIPP+ HW F Y MLQ+VSRSFALVIQQL  ELR+A
Sbjct  2    GVLSRPEEVAALVRLKVAAGRIRRQIPPEAHWAFAYDMLQRVSRSFALVIQQLGPELRNA  61

Query  310  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  489
            VC+FYLVLRALDTVEDDT I  EVK+PIL DF+RHIY+ +W F CG  DY+VLMD F  V
Sbjct  62   VCVFYLVLRALDTVEDDTGIPNEVKLPILRDFYRHIYNPDWLFSCGANDYRVLMDNFRQV  121

Query  490  STAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            STAFLELG+ YQ+AIE+IT RMG GMAKFIC EV+TIDDYDEYCHYVAGLVG
Sbjct  122  STAFLELGEGYQKAIEEITRRMGEGMAKFICMEVQTIDDYDEYCHYVAGLVG  173



>gb|ABK24732.1| unknown [Picea sitchensis]
Length=409

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MGS+  +LKHP+DV  L+++KIA     KQIP +P   FC+TMLQ+VSRSFA VIQQL  
Sbjct  1    MGSIRTILKHPEDVPALVRMKIAQTHALKQIPSEPDLAFCFTMLQRVSRSFAFVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVCIFYLVLR LDTVEDDTSI  + K+PIL  F++HIYD  WHF CG KDYK LM+
Sbjct  61   DLRNAVCIFYLVLRGLDTVEDDTSIPLDTKLPILEAFYKHIYDPSWHFSCGVKDYKELME  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            +FHHVST FL LG+ YQEAIE+IT RMGAGMAKFIC EVE+++DYDEYCHYVAGLVG
Sbjct  121  KFHHVSTTFLRLGRGYQEAIEEITKRMGAGMAKFICSEVESVEDYDEYCHYVAGLVG  177



>ref|XP_003564211.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=402

 Score =   261 bits (666),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 144/174 (83%), Gaps = 1/174 (1%)
 Frame = +1

Query  124  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  303
            +GA L  P++V PL+K+  AA +I +QIPPQ HW F Y MLQKVSRSFALVIQQL  +LR
Sbjct  1    MGA-LSRPEEVAPLVKMAAAAWRIRRQIPPQEHWAFAYDMLQKVSRSFALVIQQLGPDLR  59

Query  304  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  483
            +AVCIFYLVLRALDTVEDDT + TEVK+PIL +F+RHIY+ +WHF CG   Y+VLMD F 
Sbjct  60   NAVCIFYLVLRALDTVEDDTGVPTEVKLPILQEFYRHIYNPDWHFSCGRGHYRVLMDNFR  119

Query  484  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            HVS AFLEL + YQ AIE+IT RMGAGMA +ICKEVET+DDY+EYCHYVAGLVG
Sbjct  120  HVSIAFLELDQGYQNAIEEITRRMGAGMAIYICKEVETVDDYNEYCHYVAGLVG  173



>ref|NP_001059129.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAC84212.1| putative squalene synthase [Oryza sativa Japonica Group]
 dbj|BAF21043.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAG88654.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66758.1| hypothetical protein OsJ_23470 [Oryza sativa Japonica Group]
Length=410

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 150/182 (82%), Gaps = 6/182 (3%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQP----HWGFCYTMLQKVSRSFALVIQ  282
            MG +GA+L    +   L++L+ AA ++ +++        HW F Y+ML +VSRSFA+VIQ
Sbjct  1    MGVVGALLG--PEAEALVRLRAAAWRLRREVAAATDDDEHWAFAYSMLHRVSRSFAIVIQ  58

Query  283  QLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  462
            QL  +LR+AVC+FYLVLRALDTVEDDTSI TE+KVPIL +FHRHIY+R+WHF CGTKD K
Sbjct  59   QLGPDLRNAVCVFYLVLRALDTVEDDTSIPTEIKVPILQEFHRHIYNRDWHFSCGTKDCK  118

Query  463  VLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLV  642
            +LMD+FH+V TAFLELG  YQEAIE+IT RMGAGMAKFICKEVET+DDYDEYCHYVAGLV
Sbjct  119  ILMDKFHYVLTAFLELGSGYQEAIEEITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLV  178

Query  643  GL  648
            G+
Sbjct  179  GI  180



>ref|XP_006351216.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=412

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  285
            M  +  +L HPD++YPL+KL + A+++EK+      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MELMQEILMHPDELYPLVKLMLTAKRVEKKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  286  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  465
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +WHF CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWHFSCGTKAFKV  120

Query  466  LMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            LMDQFHHVSTAFLEL  NYQE I+DIT RMG GMAKF+CKEVETIDDY+EY  Y +GL G
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKRMGEGMAKFLCKEVETIDDYNEYSFYASGLCG  180

Query  646  L  648
            L
Sbjct  181  L  181



>ref|XP_010312074.1| PREDICTED: squalene synthase-like isoform X2 [Solanum lycopersicum]
Length=384

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  285
            MG +  +L HPD++YPLIKL ++ +++E +      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MGFMQEILMHPDELYPLIKLMLSVKRVENKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  286  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  465
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +W+F CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWNFSCGTKAFKV  120

Query  466  LMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            LMDQFHHVSTAFLEL  NYQE I+DIT RMG GMAKF+CKEVETIDDY+EY  Y +GL G
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKRMGEGMAKFLCKEVETIDDYNEYSFYASGLCG  180

Query  646  L  648
            L
Sbjct  181  L  181



>gb|AEX26931.1| squalene synthase 1-3 [Solanum tuberosum]
Length=136

 Score =   249 bits (637),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+LK PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKTPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  475  QFHHVSTAFLELGKNY  522
            QFHHVSTAFLELGK Y
Sbjct  121  QFHHVSTAFLELGKLY  136



>ref|XP_004249733.1| PREDICTED: squalene synthase-like isoform X1 [Solanum lycopersicum]
Length=412

 Score =   259 bits (661),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  285
            MG +  +L HPD++YPLIKL ++ +++E +      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MGFMQEILMHPDELYPLIKLMLSVKRVENKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  286  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  465
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +W+F CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWNFSCGTKAFKV  120

Query  466  LMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            LMDQFHHVSTAFLEL  NYQE I+DIT RMG GMAKF+CKEVETIDDY+EY  Y +GL G
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKRMGEGMAKFLCKEVETIDDYNEYSFYASGLCG  180

Query  646  L  648
            L
Sbjct  181  L  181



>ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 ref|XP_007042049.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97879.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97880.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
Length=305

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +1

Query  241  MLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIY  420
            ML KVSRSFALVIQQL  +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILIDFHRHIY
Sbjct  1    MLHKVSRSFALVIQQLDTKLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIDFHRHIY  60

Query  421  DREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETI  600
            +R+WHF CGTK YKVLMD+FHHVSTAFLEL K YQ AIEDIT RMGAGMAKFICKEVET+
Sbjct  61   NRDWHFSCGTKHYKVLMDEFHHVSTAFLELEKGYQVAIEDITKRMGAGMAKFICKEVETV  120

Query  601  DDYDEYCHYVAGLVGL  648
            DDYDEYCHYVAGLVGL
Sbjct  121  DDYDEYCHYVAGLVGL  136



>ref|XP_009591242.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=282

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG +G +++HPD+VYPL+KL +AA+ IEK  P QPHW FC T L KVSRSFAL+IQQLP 
Sbjct  1    MGMMGKIMRHPDEVYPLMKLMLAAKLIEKGTPLQPHWAFCNTTLHKVSRSFALLIQQLPT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LR+AVC++YLVLR LDTVEDDTS+ATEV+VPIL + + H YDREWHF CGTK +KVLMD
Sbjct  61   DLRNAVCVYYLVLRVLDTVEDDTSLATEVRVPILRNVYCHFYDREWHFSCGTKAFKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  588
            QFH VSTAFLEL KNYQE I+DIT RMG GMAKF+CKE
Sbjct  121  QFHDVSTAFLELDKNYQEVIKDITKRMGEGMAKFLCKE  158



>gb|AEX58673.1| squalene synthase [Huperzia serrata]
Length=420

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG L  +L+HP++V  L+K+K  A +++ Q+P  PH  FCY MLQKVSRSFA+VIQQL  
Sbjct  1    MGVLTTVLQHPNEVPALLKMKFMASRLKWQLPSDPHRSFCYEMLQKVSRSFAVVIQQLGP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LRDAVC+FYLVLR LDTVEDD SI  + KVPIL  FH  IYD  W F+CG KDYKVLMD
Sbjct  61   NLRDAVCVFYLVLRGLDTVEDDMSIPLDTKVPILKAFHETIYDPAWRFVCGEKDYKVLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QFHHVST FL L K +Q+ I +IT RMG GMAKFI  EVETI+DY+EYCHYVAGLVG+
Sbjct  121  QFHHVSTTFLNLDKKFQDVIAEITQRMGNGMAKFIVTEVETIEDYNEYCHYVAGLVGI  178



>gb|AIW04729.1| squalene synthase [Dryopteris fragrans]
Length=412

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 142/179 (79%), Gaps = 1/179 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQ-PHWGFCYTMLQKVSRSFALVIQQLP  291
            MG L  +L+HP+++  L+KL+IAA  +   +P       FCY MLQ+VSRSFALVIQQL 
Sbjct  1    MGLLKGVLEHPEEIPALVKLRIAAATLRLHVPAHDADLSFCYLMLQRVSRSFALVIQQLG  60

Query  292  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  471
             ELRDA+CIFYLVLRALDTVEDD SI+ + K+P+L  FH++I+D  WHF CG +DYKVLM
Sbjct  61   TELRDAICIFYLVLRALDTVEDDMSISVDTKLPVLKSFHKNIHDPTWHFPCGERDYKVLM  120

Query  472  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            D+FHHVS AFL+L K YQ AIED   +MG GMAKFICKEVETI+DYDEYCHYVAGLVGL
Sbjct  121  DEFHHVSMAFLKLHKRYQVAIEDAANKMGHGMAKFICKEVETIEDYDEYCHYVAGLVGL  179



>ref|XP_001775898.1| predicted protein [Physcomitrella patens]
 gb|EDQ59263.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG +G ++KHPD++ PLIKLKIAA + +K IP  P+  FCY ML +VSRSF++VIQQL  
Sbjct  1    MGIIGTLVKHPDEIPPLIKLKIAAHRAQKAIPKDPNLAFCYRMLTRVSRSFSIVIQQLSP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYLVLR LDTVEDD +I  ++KVPIL  FH+HIYD  W F CG KDYK LM+
Sbjct  61   ELRDAVCVFYLVLRGLDTVEDDMAIPIDIKVPILKAFHKHIYDPSWKFSCGEKDYKELMN  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +F  VS AFL L + YQ+ I ++T RMG GMAKFI  EV T+DDYDEYCHYVAG+VGL
Sbjct  121  KFELVSNAFLNLEEGYQKVIAEMTERMGNGMAKFIESEVSTVDDYDEYCHYVAGIVGL  178



>ref|XP_003559279.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=403

 Score =   246 bits (628),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 138/164 (84%), Gaps = 3/164 (2%)
 Frame = +1

Query  163  LIKLKIAARQIEKQIPPQP---HWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVL  333
            L+KL++AA +++ QIPPQ    HW F Y MLQKVSRSFA VIQQL  +LR+AVCIFYL+L
Sbjct  10   LVKLRVAAGRVKLQIPPQEEEEHWAFAYDMLQKVSRSFAFVIQQLGPDLRNAVCIFYLLL  69

Query  334  RALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELG  513
            RALDTVEDDTSI TEVK+ IL +FHRH+Y+  WH+ CGT +Y+VLMD+F +VSTAFLEL 
Sbjct  70   RALDTVEDDTSIPTEVKLTILQEFHRHVYNPSWHYSCGTGNYRVLMDKFRYVSTAFLELD  129

Query  514  KNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            +  QEAI++IT RMG GM+KFICKEVET+DDYDEYCHY AGLVG
Sbjct  130  QGCQEAIKEITKRMGEGMSKFICKEVETVDDYDEYCHYAAGLVG  173



>gb|EMT03383.1| Squalene synthetase [Aegilops tauschii]
Length=450

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 144/218 (66%), Gaps = 46/218 (21%)
 Frame = +1

Query  130  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  309
             +L  P++V  L++LK+AA +I +QIPPQ HW F Y MLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVPALLRLKLAAGRIRRQIPPQDHWAFAYDMLQRVSRSFALVIQQLGPDLRNA  61

Query  310  V--------------------------------------CIFYLVLRALDTVEDDTSIAT  375
            V                                      C+FYLVLRALDTVEDDT+I  
Sbjct  62   VSTQFSPFPFPSGSPPIRIPEISETFTAADVALVLTLQVCVFYLVLRALDTVEDDTAIPN  121

Query  376  EVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKN--------YQEA  531
            EVK+PIL DF+RHIY+ +W F CG  DY+VLMD F  VSTAFLELG+         YQ+A
Sbjct  122  EVKLPILRDFYRHIYNPDWLFSCGANDYRVLMDNFRQVSTAFLELGEGHSLSIKCKYQKA  181

Query  532  IEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVG  645
            IE+IT RMG GMAKFIC EVETIDDYDEYCHYVAGLVG
Sbjct  182  IEEITRRMGEGMAKFICTEVETIDDYDEYCHYVAGLVG  219



>ref|XP_009769885.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=398

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 131/168 (78%), Gaps = 14/168 (8%)
 Frame = +1

Query  178  IAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA-----------VCIFY  324
            +AA+ IEK+ P QPHW FCYT L+ VS   AL+IQQLP +LR +           VC++Y
Sbjct  2    VAAKLIEKRTPLQPHWAFCYTTLRNVS---ALLIQQLPTDLRTSLSLVNFRPTLQVCVYY  58

Query  325  LVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFL  504
            LV RALDTVEDDTS+A EV+VPIL +F+ H YDREWHF CGT  +KVLMDQFHHVSTAFL
Sbjct  59   LVRRALDTVEDDTSLAIEVRVPILRNFYCHFYDREWHFSCGTNAFKVLMDQFHHVSTAFL  118

Query  505  ELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            E  KNYQE I+DIT RMG GMAKF+CKEVET+DDY+EYCHY AGL GL
Sbjct  119  EFDKNYQEVIKDITKRMGEGMAKFLCKEVETLDDYNEYCHYAAGLCGL  166



>ref|XP_006423443.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36683.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=356

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  310  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  489
            VCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMDQFHHV
Sbjct  9    VCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMDQFHHV  68

Query  490  STAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            STAFLELGK YQ+AIEDIT RMGAGMAKFICKEVE+IDDYDEYC+YVAGLVGL
Sbjct  69   STAFLELGKGYQDAIEDITKRMGAGMAKFICKEVESIDDYDEYCYYVAGLVGL  121



>ref|XP_003058046.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57997.1| predicted protein [Micromonas pusilla CCMP1545]
Length=454

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L  +LKHP D  PL+++K+ A +  K++P +P+  FCY ML KVSRSFA+VIQQLP 
Sbjct  1    MGALTLLLKHPSDFIPLVRVKMMADK-AKKLPKEPNLAFCYDMLNKVSRSFAIVIQQLPH  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            EL+DAVCIFYLVLRALDT+EDD +I  + K P L  FH+ IYD ++ + CG K YK LMD
Sbjct  60   ELQDAVCIFYLVLRALDTIEDDMAIPEKTKCPELEKFHQKIYDPKYVYPCGEKHYKRLMD  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            ++  V+  FL L K YQ+ I DIT RMG GM+ FI +EV ++ D+DEYCHYVAGLVG+
Sbjct  120  EYTKVTAVFLSLKKEYQDVIADITKRMGKGMSNFIRREVVSLKDWDEYCHYVAGLVGI  177



>ref|XP_009619298.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=405

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 109/132 (83%), Gaps = 11/132 (8%)
 Frame = +1

Query  253  VSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREW  432
            +SRS AL+           VC+FYLVLRALDTVEDDTSIATEVKVPILI FHRHIYD EW
Sbjct  57   ISRSIALL-----------VCVFYLVLRALDTVEDDTSIATEVKVPILIAFHRHIYDHEW  105

Query  433  HFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYD  612
            HF CGT  YK LMD FHHVSTAFLELGKNYQE IEDITMRMG GMAKFI KE+ETIDDY+
Sbjct  106  HFSCGTNAYKDLMDHFHHVSTAFLELGKNYQEVIEDITMRMGGGMAKFINKEIETIDDYE  165

Query  613  EYCHYVAGLVGL  648
            EYCHYVAGL GL
Sbjct  166  EYCHYVAGLAGL  177



>ref|XP_011395550.1| Squalene synthase [Auxenochlorella protothecoides]
 gb|KFM22694.1| Squalene synthase [Auxenochlorella protothecoides]
Length=458

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 127/178 (71%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LG +L HPD++ P+  + +AAR+    +P  P   FCY+ML KVSRSFA+VIQQLP 
Sbjct  1    MGKLGELLSHPDEIIPMAAMYLAARR-AAVLPHDPDLAFCYSMLNKVSRSFAIVIQQLPE  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            +LRDAVC+FYLVLRALDTVEDD +I    KVPIL+ FH   Y+++W   CG   Y  LM+
Sbjct  60   QLRDAVCVFYLVLRALDTVEDDMAIDQAEKVPILLSFHEKTYEKDWSMKCGHGHYVELME  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            Q+  V  AF  L   YQE I DI  RMGAGMA+FI KEVET+ DYD YCHYVAGLVG+
Sbjct  120  QYPVVCAAFQGLEPQYQEVITDICRRMGAGMAEFIVKEVETVKDYDLYCHYVAGLVGV  177



>ref|XP_002501456.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62714.1| predicted protein [Micromonas sp. RCC299]
Length=455

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L  +LKHP D+ PL ++K  A Q  K++P +P+  FCY ML  VSRSFA+VIQQLP 
Sbjct  1    MGALSLILKHPGDILPLYRVKCMADQ-AKKLPKEPNLRFCYHMLNLVSRSFAIVIQQLPH  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            EL+DAVC+FYLVLRALDTVEDD SI  + K   L  F + IYD E+ + CG K YKVLMD
Sbjct  60   ELQDAVCVFYLVLRALDTVEDDMSIPDKPKCAELEIFWKKIYDPEYVYPCGEKHYKVLMD  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            ++  V+  FL L K YQ+ I DIT RMGAGM+ FI +EV T++D+DEYCHYVAGLVG+
Sbjct  120  EYPKVTAVFLSLKKEYQDVIADITKRMGAGMSNFIKREVVTLEDWDEYCHYVAGLVGI  177



>ref|XP_005651444.1| farnesyl-diphosphate farnesyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26900.1| farnesyl-diphosphate farnesyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=347

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 126/178 (71%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG L  +L+HPD++ PL+++  AA++  K +P      FCY ML +VSRSFA+VIQ+LP 
Sbjct  1    MGKLREVLEHPDELIPLVQMAFAAKR-AKVLPKDKSLAFCYDMLNRVSRSFAVVIQRLPT  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYLVLRALDTVEDD ++    KVP+L  FH  IYDR W   CG   Y  LM 
Sbjct  60   ELRDAVCLFYLVLRALDTVEDDMAVPVATKVPLLRVFHEKIYDRSWKMSCGYGPYVDLMQ  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            Q+  V+ AFL L   YQ+ I DIT RMG GMA+FI KEV ++ DYD YCHYVAGLVG+
Sbjct  120  QYSLVTDAFLRLKPMYQKVIADITRRMGEGMAEFIEKEVISVKDYDLYCHYVAGLVGI  177



>ref|XP_001417488.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95781.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=456

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 128/178 (72%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L A+L HP DV PL+++K+ A    K++P  P   +CY +L KVSRSFA+VIQ+L  
Sbjct  1    MGALRAVLSHPGDVAPLVRVKMMA-NAAKRLPKDPDLAYCYDVLNKVSRSFAIVIQRLDA  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYLVLRALDTVEDD SI  E KVP L+ FH +IYD  +   CG K YK LM 
Sbjct  60   ELRDAVCVFYLVLRALDTVEDDMSIPIERKVPDLLAFHEYIYDANYSADCGEKHYKDLMK  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             +  V++ FL L K Y+  I DIT RMG GMAKFI KEV  + D+DEYCHYVAGLVG+
Sbjct  120  NYPRVTSVFLGLKKEYRTVIADITKRMGHGMAKFIEKEVMDMADFDEYCHYVAGLVGI  177



>ref|XP_005851990.1| hypothetical protein CHLNCDRAFT_18492 [Chlorella variabilis]
 gb|EFN59888.1| hypothetical protein CHLNCDRAFT_18492 [Chlorella variabilis]
Length=261

 Score =   203 bits (516),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 125/178 (70%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LG +L HPD++ P+  + +AAR+  KQ+P +P   FCY ML +VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLTHPDELVPMASMFMAARR-AKQLPQEPGLAFCYDMLNRVSRSFAIVIQQLPH  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LRDAVC+FYLVLRALDTVEDD  +  +VKVP+L  FH   YDR W   CG+ +Y  LM+
Sbjct  60   GLRDAVCVFYLVLRALDTVEDDMGLDPKVKVPLLRCFHEKSYDRSWKMSCGSGEYVRLME  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             +  V+  F  L K YQ+ I DI  +MGAGMA F+  +   ++DY+ YCHYVAGLVG+
Sbjct  120  NYPLVTDVFQGLDKRYQQVIADICKKMGAGMADFVTADAADVEDYNLYCHYVAGLVGI  177



>ref|XP_003078740.1| FDFT_NICBE Farnesyl-diphosphate farnesyltransferase (ISS), partial 
[Ostreococcus tauri]
Length=210

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 129/178 (72%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+LG +L HP DV  L+++ + A +  K++P   +  +CY +L KVSRSFA+VIQQL  
Sbjct  1    MGALGMILTHPGDVPSLLRVAMMANR-AKRLPRDANLAYCYDVLNKVSRSFAIVIQQLDE  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYL LRALDTVEDD SI  + K+P L DFH +I+D ++   CG K Y+ LM 
Sbjct  60   ELRDAVCVFYLALRALDTVEDDMSIPIDEKLPQLYDFHEYIFDPKYSTECGEKHYRDLMM  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             +  V++ FL+L K Y++ I DI  RMGAGMAKFI KEV  + D+DEYCHYVAGLVG+
Sbjct  120  NYPRVTSVFLKLKKPYRDVIADIARRMGAGMAKFIEKEVMDMSDFDEYCHYVAGLVGI  177



>ref|XP_007512409.1| squalene synthase [Bathycoccus prasinos]
 emb|CCO17009.1| squalene synthase [Bathycoccus prasinos]
Length=462

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG++  +L+HP DV+PL+++K  A +  K++P + +  FCY ML KVSRSFA+VIQQL  
Sbjct  1    MGAISVLLRHPFDVFPLLRVKKMADEA-KKLPKEENLAFCYDMLNKVSRSFAIVIQQLDE  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREW-HFLCGTKDYKVLM  471
            ELRDAVCIFYLVLRALDT+EDD +I    KVP L+ FH  IYD E+ H  CG K YK LM
Sbjct  60   ELRDAVCIFYLVLRALDTIEDDMAIDNAEKVPQLLKFHEDIYDPEYKHLTCGEKHYKTLM  119

Query  472  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             ++  V+  FL L K Y++ I DIT RMG GMA FI  EV T+ D+D YCHYVAGLVG+
Sbjct  120  VEYPKVTNVFLRLKKPYKDVIADITRRMGKGMADFIESEVNTLKDWDVYCHYVAGLVGI  178



>ref|XP_001773253.1| predicted protein [Physcomitrella patens]
 gb|EDQ61943.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG +  ++KHPD++ PL+KLK+ A + ++ IP  P+  FCY ML +VSRSF++VIQQL  
Sbjct  1    MGLMETLVKHPDEIRPLVKLKVDAMRAQRAIPKDPYLAFCYRMLMRVSRSFSIVIQQLRT  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYLVLR LDT+EDD +I  ++KVPIL  FH HIYD  W F+CG KDYK LM+
Sbjct  61   ELRDAVCVFYLVLRGLDTIEDDMAIPIDIKVPILKSFHEHIYDPSWKFVCGEKDYKELMN  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEV  591
            +F  VS AFL L + YQ  I ++T RMG GMAKFI  EV
Sbjct  121  KFECVSNAFLNLDEGYQRVIAEMTNRMGVGMAKFIETEV  159



>ref|XP_001756673.1| predicted protein [Physcomitrella patens]
 gb|EDQ78627.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 131/178 (74%), Gaps = 0/178 (0%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG +GA+LK+P+D++ L+KLK+A+    + IP  P+  FCY ML++VS SF++VI QL  
Sbjct  1    MGIIGAILKNPEDLHHLLKLKMASAAANRAIPSDPNLAFCYQMLRRVSGSFSIVILQLEP  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LR+AVC+FYLVLR L  VEDD +I  ++KV +L + H+ I+DR++HF CG  DYK+LMD
Sbjct  61   GLRNAVCVFYLVLRGLQAVEDDLTIPYDLKVELLRNLHKKIFDRDFHFPCGNNDYKLLMD  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +F+ V  AFL L   YQE I +IT RMG GM K++  E+ + +DY+EYCH+ AGL+GL
Sbjct  121  KFYLVILAFLGLTTGYQEVITEITERMGEGMVKYLNTEIISREDYNEYCHFSAGLMGL  178



>gb|ADP89473.1| squalene synthase [Betula platyphylla]
Length=148

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +1

Query  337  ALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGK  516
            ALDTVEDDTSI T+VKVPIL  FHRHIYD EWHF CGTK+YKVLMDQFHHVSTAFLEL K
Sbjct  1    ALDTVEDDTSIPTDVKVPILKAFHRHIYDCEWHFSCGTKEYKVLMDQFHHVSTAFLELEK  60

Query  517  NYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +YQEAIE+IT RMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  61   SYQEAIEEITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  104



>ref|XP_002946755.1| hypothetical protein VOLCADRAFT_79344 [Volvox carteri f. nagariensis]
 gb|EFJ51981.1| hypothetical protein VOLCADRAFT_79344 [Volvox carteri f. nagariensis]
Length=447

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 120/178 (67%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LG +L HPD+  PL+++  AA Q   ++P  P   FCY +L  VSRSFA+VIQQLP 
Sbjct  1    MGKLGEVLSHPDEFLPLVRMARAA-QKATRLPKDPDLAFCYGILNDVSRSFAIVIQQLPN  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LRDA+C+FYLVLR LDTVEDD ++    KVP L  FH  IYDR +   CG K YK LM 
Sbjct  60   PLRDAICVFYLVLRGLDTVEDDMALEVSFKVPQLRSFHERIYDRGFTMACGYKHYKRLMA  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QF  V   FL L   +Q+ I DIT RMG GMA FI KEVE + DYD YCHYVAGLVG+
Sbjct  120  QFGTVVNVFLSLEPAHQKVIADITRRMGHGMADFIEKEVEAVKDYDLYCHYVAGLVGI  177



>ref|XP_001703447.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
 gb|EDP06129.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
Length=378

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 123/178 (69%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG LG +L HP+++ PL+++  AA++  K +P  P   FCY ML  VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLSHPNEIMPLLRMYRAAKRATK-LPKDPDLAFCYGMLNDVSRSFAIVIQQLPN  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LRD++C+FYLVLR LDTVEDD ++  + K+P L  FH  IYDR +   CG   YK LM 
Sbjct  60   PLRDSICVFYLVLRGLDTVEDDMALDVDFKLPELRRFHERIYDRGFTMECGYNHYKRLMA  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            QF  V   FL L   +Q  I DIT RMG GMA+FI KEV T+ DYD+YCHYVAGLVG+
Sbjct  120  QFGVVVNVFLALPPPHQAVIADITRRMGYGMAEFIEKEVVTVADYDKYCHYVAGLVGI  177



>emb|CEF97547.1| Squalene/phytoene synthase, partial [Ostreococcus tauri]
Length=397

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 129/178 (72%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+LG +L HP DV  L+++ + A +  K++P   +  +CY +L KVSRSFA+VIQQL  
Sbjct  1    MGALGMILTHPGDVPSLLRVAMMANRA-KRLPRDANLAYCYDVLNKVSRSFAIVIQQLDE  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            ELRDAVC+FYL LRALDTVEDD SI  + K+P L DFH +I+D ++   CG K Y+ LM 
Sbjct  60   ELRDAVCVFYLALRALDTVEDDMSIPIDEKLPQLYDFHEYIFDPKYSTECGEKHYRDLMM  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             +  V++ FL+L K Y++ I DI  RMGAGMAKFI KEV  + D+DEYCHYVAGLVG+
Sbjct  120  NYPRVTSVFLKLKKPYRDVIADIARRMGAGMAKFIEKEVMDMSDFDEYCHYVAGLVGI  177



>gb|ABW37701.1| squalene synthase [Panax notoginseng]
Length=153

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  346  TVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQ  525
            TVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD+FHHVS AFL+LG  Y+
Sbjct  1    TVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMDEFHHVSNAFLDLGSGYK  60

Query  526  EAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            EAIEDITMRMGAGM+KFICKEVETIDDYDEYCHYVAGLVGL
Sbjct  61   EAIEDITMRMGAGMSKFICKEVETIDDYDEYCHYVAGLVGL  101



>gb|AEY76157.1| squalene synthase, partial [Dioscorea zingiberensis]
Length=132

 Score =   186 bits (471),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  337  ALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGK  516
            ALDTVEDDTSI  +VKVPIL  FH HIYD +WHF CG KDYKVLMD+FH+VSTAFLELGK
Sbjct  1    ALDTVEDDTSIPADVKVPILQAFHCHIYDLDWHFSCGAKDYKVLMDKFHYVSTAFLELGK  60

Query  517  NYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
             YQEAI+DIT RMGAGMAKFICKEVET+DDYDEYCHYVAGLVGL
Sbjct  61   GYQEAIDDITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  104



>ref|XP_002971951.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
 gb|EFJ26868.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
Length=392

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 128/179 (72%), Gaps = 1/179 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG + A+++HP ++  L+++K+AA +     P  PH  +CY +L  VSRSFA+V+Q L  
Sbjct  1    MGMVEALIRHPGELPALLQMKLAAARAAHAFPADPHMAYCYRILLLVSRSFAVVVQHLNQ  60

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
            E+RDAVCIFY+VLRALDTVEDD SI  E K  +L +F++H+ D  W F+C    Y VLM 
Sbjct  61   EIRDAVCIFYVVLRALDTVEDDMSIPVETKTTVLEEFYKHLEDPSWRFVCKWNFYIVLMK  120

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE-VETIDDYDEYCHYVAGLVGL  648
             F+H+S AFL+L K YQ  I DIT RMG GMA+FI KE V T+ DYD+YC+YVAGLVG+
Sbjct  121  NFNHLSLAFLQLSKEYQCVISDITKRMGYGMAEFIRKEVVVTVSDYDKYCYYVAGLVGV  179



>gb|KDD74507.1| squalene/phytoene synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=339

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 120/178 (67%), Gaps = 1/178 (1%)
 Frame = +1

Query  115  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  294
            MG+L   L+HPD++ P+  L ++++++ K++P  P   FCY  L +VSRSFA+VI QLP 
Sbjct  1    MGALKDALRHPDELLPMAALYLSSQRV-KRLPKNPDLAFCYDSLNRVSRSFAVVIAQLPP  59

Query  295  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  474
             LRD VC+FYLVLRALDT+EDD SI    KVP+L  FH HI D  +    G   Y+VLM 
Sbjct  60   ALRDGVCVFYLVLRALDTIEDDMSIPVAEKVPLLRSFHSHIGDESYSSSYGAGHYRVLMQ  119

Query  475  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  648
            +F HV+  +  L    ++ IE++  RMGAGMA F   EVET+  YD YCHYVAGLVG+
Sbjct  120  RFGHVARVYATLEPEARDVIEEMCARMGAGMADFAETEVETVAQYDLYCHYVAGLVGM  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1026237057824