BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5300

Length=757
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761121.1|  PREDICTED: transducin beta-like protein 2          152   1e-73   Nicotiana sylvestris
ref|XP_004229812.1|  PREDICTED: transducin beta-like protein 2          149   6e-68   Solanum lycopersicum
gb|EYU31993.1|  hypothetical protein MIMGU_mgv1a006802mg                147   6e-68   Erythranthe guttata [common monkey flower]
emb|CDO97686.1|  unnamed protein product                                147   6e-67   Coffea canephora [robusta coffee]
ref|XP_006396207.1|  hypothetical protein EUTSA_v10028676mg             152   3e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010426543.1|  PREDICTED: transducin beta-like protein 2          144   6e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010456324.1|  PREDICTED: transducin beta-like protein 2          144   1e-65   Camelina sativa [gold-of-pleasure]
gb|ACG24351.1|  hypothetical protein                                    145   1e-65   Zea mays [maize]
ref|XP_011090700.1|  PREDICTED: transducin beta-like protein 2          139   2e-65   Sesamum indicum [beniseed]
ref|NP_567150.1|  transducin/WD40 domain-containing protein             146   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419538.1|  PREDICTED: transducin beta-like protein 2          141   3e-65   Camelina sativa [gold-of-pleasure]
gb|KFK30587.1|  hypothetical protein AALP_AA6G001100                    140   7e-65   Arabis alpina [alpine rockcress]
ref|XP_002875046.1|  transducin family protein                          147   2e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_006287817.1|  hypothetical protein CARUB_v10001032mg             142   4e-64   Capsella rubella
ref|XP_007140006.1|  hypothetical protein PHAVU_008G076400g             141   1e-63   Phaseolus vulgaris [French bean]
gb|AAC19306.1|  contains similarity to WD domains, G-beta repeats...    144   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111520.1|  PREDICTED: transducin beta-like protein 2 is...    137   2e-63   Brassica rapa
ref|XP_009111521.1|  PREDICTED: transducin beta-like protein 2 is...    136   3e-63   Brassica rapa
ref|XP_003552339.1|  PREDICTED: uncharacterized LOC100306508            135   4e-63   Glycine max [soybeans]
ref|XP_006445262.1|  hypothetical protein CICLE_v10020183mg             133   2e-62   Citrus clementina [clementine]
gb|ACU14712.1|  unknown                                                 133   3e-62   Glycine max [soybeans]
ref|XP_002511720.1|  nucleotide binding protein, putative               139   4e-62   Ricinus communis
ref|XP_012083574.1|  PREDICTED: transducin beta-like protein 2          133   5e-62   Jatropha curcas
ref|XP_002301292.2|  hypothetical protein POPTR_0002s14900g             133   1e-61   
ref|XP_010092831.1|  Transducin beta-like protein 2                     136   1e-61   
ref|XP_011017492.1|  PREDICTED: transducin beta-like protein 2          135   2e-61   Populus euphratica
ref|XP_010053895.1|  PREDICTED: transducin beta-like protein 2          139   2e-61   Eucalyptus grandis [rose gum]
ref|XP_010544365.1|  PREDICTED: transducin beta-like protein 2          139   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_003534612.1|  PREDICTED: transducin beta-like protein 2-like     132   2e-61   Glycine max [soybeans]
ref|XP_002320061.2|  hypothetical protein POPTR_0014s06500g             135   8e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004492634.1|  PREDICTED: transducin beta-like protein 2-like     133   2e-60   Cicer arietinum [garbanzo]
ref|XP_011034318.1|  PREDICTED: transducin beta-like protein 2          134   2e-60   Populus euphratica
ref|XP_010692248.1|  PREDICTED: transducin beta-like protein 2          139   4e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010276529.1|  PREDICTED: transducin beta-like protein 2          130   1e-59   Nelumbo nucifera [Indian lotus]
ref|XP_007219028.1|  hypothetical protein PRUPE_ppa004482mg             136   2e-59   
ref|XP_008232654.1|  PREDICTED: transducin beta-like protein 2          137   6e-59   Prunus mume [ume]
ref|XP_008438164.1|  PREDICTED: transducin beta-like protein 2          136   8e-59   Cucumis melo [Oriental melon]
gb|KJB22316.1|  hypothetical protein B456_004G040800                    130   2e-58   Gossypium raimondii
gb|KJB22318.1|  hypothetical protein B456_004G040800                    129   2e-58   Gossypium raimondii
gb|KJB22317.1|  hypothetical protein B456_004G040800                    129   3e-58   Gossypium raimondii
ref|XP_004133912.1|  PREDICTED: transducin beta-like protein 2          138   3e-58   Cucumis sativus [cucumbers]
ref|XP_007052058.1|  Transducin/WD40 repeat-like superfamily protein    129   5e-58   Theobroma cacao [chocolate]
gb|KJB24807.1|  hypothetical protein B456_004G161700                    126   1e-57   Gossypium raimondii
ref|XP_008344385.1|  PREDICTED: transducin beta-like protein 2          135   2e-57   
gb|KHG13871.1|  Transducin beta-like protein 2                          125   2e-57   Gossypium arboreum [tree cotton]
ref|XP_002279016.1|  PREDICTED: transducin beta-like protein 2          134   4e-57   Vitis vinifera
emb|CBI38849.3|  unnamed protein product                                133   5e-57   Vitis vinifera
ref|XP_009368706.1|  PREDICTED: transducin beta-like protein 2          135   6e-57   Pyrus x bretschneideri [bai li]
ref|XP_009347289.1|  PREDICTED: transducin beta-like protein 2          135   7e-57   Pyrus x bretschneideri [bai li]
ref|XP_009588354.1|  PREDICTED: transducin beta-like protein 2          151   1e-56   Nicotiana tomentosiformis
ref|XP_004306923.1|  PREDICTED: transducin beta-like protein 2          134   1e-56   Fragaria vesca subsp. vesca
ref|XP_010277354.1|  PREDICTED: transducin beta-like protein 2 is...    130   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010277353.1|  PREDICTED: transducin beta-like protein 2 is...    130   6e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010277355.1|  PREDICTED: transducin beta-like protein 2 is...    130   7e-56   Nelumbo nucifera [Indian lotus]
ref|XP_008364463.1|  PREDICTED: transducin beta-like protein 2          133   2e-55   
gb|KHG09050.1|  Transducin beta-like protein 2                          130   7e-55   Gossypium arboreum [tree cotton]
ref|XP_006851845.1|  PREDICTED: transducin beta-like protein 2          120   1e-54   Amborella trichopoda
ref|XP_009382011.1|  PREDICTED: transducin beta-like protein 2          126   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67113.1|  hypothetical protein M569_07661                         119   2e-53   Genlisea aurea
ref|XP_006339768.1|  PREDICTED: transducin beta-like protein 2-like     137   4e-52   Solanum tuberosum [potatoes]
gb|KEH23318.1|  transducin/WD-like repeat-protein                       118   2e-51   Medicago truncatula
ref|XP_010918319.1|  PREDICTED: transducin beta-like protein 2          116   3e-50   Elaeis guineensis
ref|XP_008798526.1|  PREDICTED: transducin beta-like protein 2 is...    119   8e-48   Phoenix dactylifera
ref|XP_008798525.1|  PREDICTED: transducin beta-like protein 2 is...    119   1e-47   Phoenix dactylifera
gb|EAY92666.1|  hypothetical protein OsI_14418                          105   9e-40   Oryza sativa Indica Group [Indian rice]
ref|NP_001051961.1|  Os03g0858400                                       105   9e-40   
dbj|BAJ98066.1|  predicted protein                                    99.8    5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIN39802.1|  hypothetical protein                                    100   3e-38   Zoysia matrella [Japanese carpet grass]
ref|XP_004980970.1|  PREDICTED: transducin beta-like protein 2-li...  98.6    1e-37   
ref|XP_004980969.1|  PREDICTED: transducin beta-like protein 2-li...  98.6    2e-37   
ref|NP_001168942.1|  uncharacterized protein LOC100382756             95.9    2e-37   
ref|XP_008644215.1|  PREDICTED: uncharacterized protein LOC100382...  95.9    4e-37   
ref|XP_002466059.1|  hypothetical protein SORBIDRAFT_01g000460        99.4    5e-37   
gb|EMT23631.1|  hypothetical protein F775_32619                         100   5e-36   
gb|EMS57814.1|  Transducin beta-like protein 2                        99.4    2e-35   Triticum urartu
ref|XP_006652047.1|  PREDICTED: transducin beta-like protein 2-like     105   3e-35   
ref|XP_003559005.1|  PREDICTED: transducin beta-like protein 2          102   8e-34   Brachypodium distachyon [annual false brome]
ref|XP_002960338.1|  hypothetical protein SELMODRAFT_73782            76.6    7e-26   
ref|XP_001778191.1|  predicted protein                                75.5    9e-26   
ref|XP_002967374.1|  hypothetical protein SELMODRAFT_86701            75.5    2e-25   
ref|XP_002502168.1|  predicted protein                                58.5    2e-06   Micromonas commoda
gb|KIZ04798.1|  Transducin beta-like protein 2                        57.4    4e-06   Monoraphidium neglectum
ref|XP_002952513.1|  hypothetical protein VOLCADRAFT_105565           54.3    3e-05   Volvox carteri f. nagariensis
ref|XP_005851155.1|  hypothetical protein CHLNCDRAFT_137766           51.6    3e-04   Chlorella variabilis



>ref|XP_009761121.1| PREDICTED: transducin beta-like protein 2 [Nicotiana sylvestris]
Length=437

 Score =   152 bits (385),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFADE SS+VVAC AFSGSSLYMYGE K A   ++Q KLPLP
Sbjct  126  SFKFLRINLPAGGHPTAVAFADEASSVVVACDAFSGSSLYMYGEEKTAATDSKQAKLPLP  185

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            E+KWE HK+HD+RA+LTL  TKATYG+ADGS
Sbjct  186  EIKWEQHKVHDKRAILTLVGTKATYGSADGS  216


 Score =   152 bits (384),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 99/135 (73%), Gaps = 6/135 (4%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD+++P+AIVSVI+G +IAFL FGNYF+ RKSEVESI++ + +Q   KP  + +++ +  
Sbjct  1    MDSMLPIAIVSVIIGTVIAFLVFGNYFQKRKSEVESIAQPETIQKASKPQQSQKNTLKKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                 SH+  H  A      NKRHHPLDLNTLKGHGD VTG+CFS +  SLATAC DG+V
Sbjct  61   QAKSHSHTADHKDA------NKRHHPLDLNTLKGHGDIVTGVCFSPNAQSLATACGDGVV  114

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  115  RVFKLDDASSKSFKF  129



>ref|XP_004229812.1| PREDICTED: transducin beta-like protein 2 [Solanum lycopersicum]
Length=441

 Score =   149 bits (375),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD+++P+AI+S I+G +IAFL FGNYF+ RK+EVES++K + +Q NQK   T +  Q   
Sbjct  1    MDSVLPIAILSAIIGIVIAFLVFGNYFQKRKAEVESVAKPEIIQTNQK---TSKPQQSHK  57

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            +TSKKS  KSHSH    KD+NKRHHPLDLNTLKGHGD VTG+CF  +  SLATACADG+V
Sbjct  58   NTSKKSQPKSHSHTTDHKDANKRHHPLDLNTLKGHGDIVTGVCFLPNAQSLATACADGVV  117

Query  453  RVFKLDDATSKALSF  497
            R+FKLDDA SK+  F
Sbjct  118  RIFKLDDALSKSFKF  132


 Score =   136 bits (343),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 76/93 (82%), Gaps = 3/93 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLPAGGH  AVA ADE SS+ VAC A  GSSLYMYGE  PKA  D ++Q KLP
Sbjct  129  SFKFLRINLPAGGHPIAVAVADETSSVAVACHALFGSSLYMYGEDKPKADAD-SKQAKLP  187

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LP++KWE HK+HD+RA+LTL  TKATYG+ADGS
Sbjct  188  LPQIKWEQHKVHDKRAILTLVGTKATYGSADGS  220



>gb|EYU31993.1| hypothetical protein MIMGU_mgv1a006802mg [Erythranthe guttata]
Length=431

 Score =   147 bits (370),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 10/135 (7%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MDAI+P+   SVI+GA+IAFLAFG YF  RKSE +SI++ + + PN KP+  P       
Sbjct  1    MDAILPIIAFSVIVGALIAFLAFGAYFGKRKSETQSITRPETLNPNPKPASKP-------  53

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                 +    H   AADKD+NK+HH LDLNTLKGHGD+VTG+CFSSD  SLATAC DGI+
Sbjct  54   ---SAAKKPHHKSHAADKDANKKHHHLDLNTLKGHGDAVTGLCFSSDARSLATACGDGII  110

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  111  RVFKLDDASSKSFKF  125


 Score =   138 bits (348),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +A+A AD+ SS+VVA    SGSSLYMYGE K   D  Q++KLPLP
Sbjct  122  SFKFLRINLPAGGHPTALAIADDASSVVVASQTLSGSSLYMYGEEKPKADADQKSKLPLP  181

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            E+KWEHHK+HD++ ++TL  TKATYG+ADGS
Sbjct  182  EIKWEHHKVHDKKEIITLVGTKATYGSADGS  212



>emb|CDO97686.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   147 bits (372),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = +3

Query  93   MDAIVPVAI-VSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqs  269
            MD+++PV + VS+I+GA+IAFL FG+YFR RKSEVESI+K + +Q NQ  S      Q  
Sbjct  1    MDSVLPVTVAVSLIVGALIAFLIFGSYFRKRKSEVESIAKPEKLQANQNLS----QKQPL  56

Query  270  hhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGI  449
                K          AADK++NKRHHPLDLNTLKGHGD+VTG+CFS+DG +LATAC DG+
Sbjct  57   KTNKKSQSKIHSHSHAADKEANKRHHPLDLNTLKGHGDAVTGLCFSTDGRNLATACGDGV  116

Query  450  VRVFKLDDATSKALSF  497
            +RVFKLDD T+K+  F
Sbjct  117  LRVFKLDDVTNKSFKF  132


 Score =   134 bits (338),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 75/93 (81%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLPAG H +AVA+AD+ +S+VVA    SGSSL+MYGE  PKA  +  QQTKLP
Sbjct  129  SFKFLRINLPAGAHPTAVAYADDATSVVVATHTLSGSSLHMYGEEKPKATGESKQQTKLP  188

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEH K+HD+R +LTL  TKATYG ADGS
Sbjct  189  LPEIKWEHKKVHDKRVILTLVGTKATYGGADGS  221



>ref|XP_006396207.1| hypothetical protein EUTSA_v10028676mg [Eutrema salsugineum]
 gb|ESQ37660.1| hypothetical protein EUTSA_v10028676mg [Eutrema salsugineum]
Length=427

 Score =   152 bits (383),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 96/135 (71%), Gaps = 13/135 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD+++PVAI SVILGA+IA + FG YFR R SEV+S++KA+   P + P   P+ +    
Sbjct  1    MDSVLPVAIASVILGALIAVIFFGTYFRKRTSEVQSMAKAEPQDPIRNPKSNPKKNHPKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H S K+              NKRHHPLDLNTLKGHGDSVTG+CFSSDG SLATAC DG++
Sbjct  61   HASDKNQ-------------NKRHHPLDLNTLKGHGDSVTGLCFSSDGRSLATACGDGVI  107

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  108  RVFKLDDASSKSFKF  122


 Score =   128 bits (321),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAF D+ SSIVVAC   SGSSLYMYGE K       Q KLPLP
Sbjct  119  SFKFLRINLPAGGHPTAVAFGDDASSIVVACHNMSGSSLYMYGEEKQK---EPQAKLPLP  175

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KWE H IHD+RAVLT+    ATYGTADGS
Sbjct  176  GIKWERHNIHDKRAVLTISGATATYGTADGS  206



>ref|XP_010426543.1| PREDICTED: transducin beta-like protein 2 [Camelina sativa]
Length=427

 Score =   144 bits (364),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 13/135 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            M++++ V I SV+LGA+IA L FG+YFR R SEV+S++KAD ++  +   P P+ +    
Sbjct  1    MESVLVVGIASVVLGALIAVLFFGSYFRKRTSEVQSMAKADPIRDTKSIHPVPKKNHPKT  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H S K+              NKRHHPLDLNTLKGHGD+VTG+CFSSD  SLATACADG++
Sbjct  61   HASDKTQ-------------NKRHHPLDLNTLKGHGDAVTGLCFSSDARSLATACADGVI  107

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  108  RVFKLDDASSKSFKF  122


 Score =   134 bits (337),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFAD+ SSIVV+C   SGSSLYMYGE K      QQ KLPLP
Sbjct  119  SFKFLRINLPAGGHPTAVAFADDASSIVVSCHTMSGSSLYMYGEEKQK---DQQGKLPLP  175

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KW+HH IHDQRAVLT+    ATYGTADGS
Sbjct  176  GIKWDHHHIHDQRAVLTISGASATYGTADGS  206



>ref|XP_010456324.1| PREDICTED: transducin beta-like protein 2 [Camelina sativa]
Length=427

 Score =   144 bits (363),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 13/135 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            M++++ V I SV+LGA+IA L FG YFR R SEV+S++KAD ++  +   P P+ +    
Sbjct  1    MESVLVVGIASVVLGALIAVLFFGRYFRKRTSEVQSMAKADPIRDTKSIHPDPKKNHPKT  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H S K+              NKRHHPLDLNTLKGHGD+VTG+CFSSD  SLATACADG++
Sbjct  61   HASDKTQ-------------NKRHHPLDLNTLKGHGDAVTGLCFSSDARSLATACADGVI  107

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  108  RVFKLDDASSKSFKF  122


 Score =   134 bits (336),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFAD+ SSIVV+C   SGSSLYMYGE K      QQ KLPLP
Sbjct  119  SFKFLRINLPAGGHPTAVAFADDASSIVVSCHTMSGSSLYMYGEEKQK---DQQGKLPLP  175

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KW+HH IHDQRAVLT+    ATYGTADGS
Sbjct  176  GIKWDHHHIHDQRAVLTISGATATYGTADGS  206



>gb|ACG24351.1| hypothetical protein [Zea mays]
Length=403

 Score =   145 bits (366),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 96/138 (70%), Gaps = 16/138 (12%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPS---PTPRhsq  263
            MD+++ V I SVILGA+IA L FG+YFR R SEV+S++KA+   P + P    P P+ + 
Sbjct  1    MDSVLVVGIASVILGALIAVLFFGSYFRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNH  60

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
                 S K+              NKRHHPLDLNTLKGHGD+VTG+CFSSDG SLATACAD
Sbjct  61   PKSQASDKNQ-------------NKRHHPLDLNTLKGHGDAVTGLCFSSDGKSLATACAD  107

Query  444  GIVRVFKLDDATSKALSF  497
            G++RVFKLDDA+SK+  F
Sbjct  108  GLIRVFKLDDASSKSFKF  125


 Score =   132 bits (332),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 73/91 (80%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFAD+ SSIVVAC   SGSSLYMYGE K      QQ KLPLP
Sbjct  122  SFKFLRINLPAGGHPTAVAFADDASSIVVACHHMSGSSLYMYGEDKQK---DQQGKLPLP  178

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KW+HH IH++R+VLT+  T ATYGTADGS
Sbjct  179  SIKWDHHHIHEKRSVLTISGTTATYGTADGS  209



>ref|XP_011090700.1| PREDICTED: transducin beta-like protein 2 [Sesamum indicum]
Length=439

 Score =   139 bits (350),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFKFLRINLPAGGH +AVAFA + SS+VVA    +GSSLYMYGE K  T G   QQ+KLP
Sbjct  126  SFKFLRINLPAGGHPTAVAFAGDASSVVVATQVLAGSSLYMYGEEKPKTTGEQKQQSKLP  185

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHK+HD+RA++TL  TKATYG+ADGS
Sbjct  186  LPEIKWEHHKVHDKRAIITLVGTKATYGSADGS  218


 Score =   137 bits (346),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MDAI+P+   SVI+GA+IA + FG YFR RKSE+ESI++ + ++ N +P+  P       
Sbjct  1    MDAILPIIAFSVIVGAVIALVIFGTYFRKRKSEIESINRPETLKTNPRPALKP------S  54

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
               K  H       AADKD+NK+HHPLDLNTLKGHGD+VT + FS D  SLATAC DG+V
Sbjct  55   AAKKPHHKSHSHSHAADKDANKKHHPLDLNTLKGHGDAVTSVSFSPDARSLATACGDGVV  114

Query  453  RVFKLDDATSKALSF  497
            RVF+LDDA+SK+  F
Sbjct  115  RVFRLDDASSKSFKF  129



>ref|NP_567150.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AAL08292.1| AT4g00090/F6N15_8 [Arabidopsis thaliana]
 gb|AAN28910.1| At4g00090/F6N15_8 [Arabidopsis thaliana]
 gb|AEE81822.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=430

 Score =   146 bits (368),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 96/138 (70%), Gaps = 16/138 (12%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPS---PTPRhsq  263
            MD+++ V I SVILGA+IA L FG+YFR R SEV+S++KA+   P + P    P P+ + 
Sbjct  1    MDSVLVVGIASVILGALIAVLFFGSYFRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNH  60

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
                 S K+              NKRHHPLDLNTLKGHGD+VTG+CFSSDG SLATACAD
Sbjct  61   PKSQASDKNQ-------------NKRHHPLDLNTLKGHGDAVTGLCFSSDGKSLATACAD  107

Query  444  GIVRVFKLDDATSKALSF  497
            G++RVFKLDDA+SK+  F
Sbjct  108  GVIRVFKLDDASSKSFKF  125


 Score =   130 bits (327),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFAD+ SSIVVAC   SGSSLYMYGE K      QQ KLPLP
Sbjct  122  SFKFLRINLPAGGHPTAVAFADDASSIVVACHHMSGSSLYMYGEDKQK---DQQGKLPLP  178

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KW+HH IH++R+VLT+    ATYGTADGS
Sbjct  179  SIKWDHHHIHEKRSVLTISGATATYGTADGS  209



>ref|XP_010419538.1| PREDICTED: transducin beta-like protein 2 [Camelina sativa]
Length=427

 Score =   141 bits (355),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 13/135 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            M++++ V I SV+LG++IA L FG+YFR R SEV+S++KAD ++  +   P P+ +    
Sbjct  1    MESVLVVGIASVVLGSLIAVLFFGSYFRKRTSEVQSMAKADPIRDTKTIHPVPKKNHPKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H S K+              +KRHHPLDLNTLKGHGD+VTG+CFSSD  SLATACADG++
Sbjct  61   HASDKTQ-------------SKRHHPLDLNTLKGHGDAVTGLCFSSDARSLATACADGVI  107

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  108  RVFKLDDASSKSFKF  122


 Score =   135 bits (339),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFAD+ SSIVVAC   SGSSLYMYGE K      QQ KLPLP
Sbjct  119  SFKFLRINLPAGGHPTAVAFADDASSIVVACHTMSGSSLYMYGEEKQK---DQQGKLPLP  175

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KW+HH IHDQRAVLT+    ATYGTADGS
Sbjct  176  GIKWDHHHIHDQRAVLTISGATATYGTADGS  206



>gb|KFK30587.1| hypothetical protein AALP_AA6G001100 [Arabis alpina]
Length=424

 Score =   140 bits (352),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 93/135 (69%), Gaps = 16/135 (12%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD+++PVAI SVILGA+IA L FG+YFR R SEV+S++KAD   P + P    + +    
Sbjct  1    MDSVLPVAIASVILGALIAVLFFGSYFRKRTSEVQSMAKAD---PIRNPKSNHKKNHPKS  57

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H S K+               KRHHPLDLNTLKGHGDSVTG+CFS DG +LAT C DG++
Sbjct  58   HASDKNQI-------------KRHHPLDLNTLKGHGDSVTGLCFSPDGRTLATVCGDGVI  104

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  105  RVFKLDDASSKSFKF  119


 Score =   135 bits (340),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 71/91 (78%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFAD+ SSIVVAC   SGSSLYMY E K      QQ KLPLP
Sbjct  116  SFKFLRINLPAGGHPTAVAFADDASSIVVACQTMSGSSLYMYAEEKQK---DQQGKLPLP  172

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KWEHH IHD+RAVLTL    ATYGTADGS
Sbjct  173  SIKWEHHNIHDKRAVLTLSGATATYGTADGS  203



>ref|XP_002875046.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51305.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=430

 Score =   147 bits (371),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 96/138 (70%), Gaps = 16/138 (12%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPS---PTPRhsq  263
            M++++ VAI SVI GA+IA L FGNYFR R SEV+S++KA+   P + P    P P+ + 
Sbjct  1    MESVIVVAIASVIFGALIAVLFFGNYFRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNH  60

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
                 S K+              NKRHHPLDLNTLKGHGD+VTG+CFSSDG SLATACAD
Sbjct  61   PKSQASDKNQ-------------NKRHHPLDLNTLKGHGDAVTGLCFSSDGRSLATACAD  107

Query  444  GIVRVFKLDDATSKALSF  497
            G++RVFKLDDA+SK+  F
Sbjct  108  GVIRVFKLDDASSKSFKF  125


 Score =   127 bits (318),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AV FAD+ SSIVVAC   SGSSLYMYGE K       Q KLPLP
Sbjct  122  SFKFLRINLPAGGHPTAVTFADDASSIVVACHHMSGSSLYMYGEEKQK---DPQGKLPLP  178

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KW+HH IH++RAVLT+    ATYGTADGS
Sbjct  179  SIKWDHHHIHEKRAVLTISGATATYGTADGS  209



>ref|XP_006287817.1| hypothetical protein CARUB_v10001032mg [Capsella rubella]
 gb|EOA20715.1| hypothetical protein CARUB_v10001032mg [Capsella rubella]
Length=424

 Score =   142 bits (357),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 13/135 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD+++ V I SV LGA+IA L FG+YFR R SEV+S++KA+ ++  +   P P+ +    
Sbjct  1    MDSVLIVGIASVSLGALIAVLFFGSYFRKRTSEVQSMAKAEPIRNPKSIHPVPKKNHPKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H ++K+              NKRHHPLDLNTLKGHGD+VTG+CFSSD  SLATACADG++
Sbjct  61   HATEKTQ-------------NKRHHPLDLNTLKGHGDAVTGLCFSSDARSLATACADGVI  107

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  108  RVFKLDDASSKSFKF  122


 Score =   131 bits (329),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFAD+ SSIVVAC   SGSSLYMYGE +      QQ KLPLP
Sbjct  119  SFKFLRINLPAGGHPTAVAFADDASSIVVACHTMSGSSLYMYGEERQK---EQQGKLPLP  175

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KW+HH IH++RAVLT+    ATYGTADGS
Sbjct  176  GIKWDHHHIHEERAVLTISGATATYGTADGS  206



>ref|XP_007140006.1| hypothetical protein PHAVU_008G076400g [Phaseolus vulgaris]
 gb|ESW12000.1| hypothetical protein PHAVU_008G076400g [Phaseolus vulgaris]
Length=436

 Score =   141 bits (356),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADA-VQPNQKPSPTPRhsqqs  269
            MD  +P+ ++S++LGAIIA L F +YFR R+SEV SI+K ++   PN  P P  +   + 
Sbjct  1    MDPALPIVLLSLVLGAIIALLFFNSYFRKRQSEVRSIAKPNSDANPNPNPKPISKPLPKK  60

Query  270  hhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGI  449
              +   S  K           NKRHHPLDLNTLKGHGD+VTGICFS DG +LATACADG+
Sbjct  61   PLSKPHSSDKDQ---------NKRHHPLDLNTLKGHGDAVTGICFSHDGRNLATACADGV  111

Query  450  VRVFKLDDATSKALSF  497
            VRVFKLDDA+SK+  F
Sbjct  112  VRVFKLDDASSKSFKF  127


 Score =   130 bits (326),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA-ATDGTQQTKLPL  661
            SFKFLRINLPAGGH +AV F+D+ SSIVV+    SG SLYMYGE K  +++   QTKLPL
Sbjct  124  SFKFLRINLPAGGHPTAVTFSDDASSIVVSSYTLSGCSLYMYGEGKPDSSENKPQTKLPL  183

Query  662  PEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PE+KWEHHK+HD++++LT+F   ATYG+ADGS
Sbjct  184  PEIKWEHHKVHDKKSILTMFGASATYGSADGS  215



>gb|AAC19306.1| contains similarity to WD domains, G-beta repeats (Pfam: G-beta.hmm, 
score: 22.80 and 35.84) [Arabidopsis thaliana]
 emb|CAB80767.1| putative WD repeat membrane protein [Arabidopsis thaliana]
Length=454

 Score =   144 bits (362),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 96/137 (70%), Gaps = 16/137 (12%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPS---PTPRhsq  263
            MD+++ V I SVILGA+IA L FG+YFR R SEV+S++KA+   P + P    P P+ + 
Sbjct  1    MDSVLVVGIASVILGALIAVLFFGSYFRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNH  60

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
                 S K+              NKRHHPLDLNTLKGHGD+VTG+CFSSDG SLATACAD
Sbjct  61   PKSQASDKNQ-------------NKRHHPLDLNTLKGHGDAVTGLCFSSDGKSLATACAD  107

Query  444  GIVRVFKLDDATSKALS  494
            G++RVFKLDDA+SK+ +
Sbjct  108  GVIRVFKLDDASSKSFN  124


 Score =   127 bits (320),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  488  FKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLPE  667
            F+FLRINLPAGGH +AVAFAD+ SSIVVAC   SGSSLYMYGE K      QQ KLPLP 
Sbjct  147  FRFLRINLPAGGHPTAVAFADDASSIVVACHHMSGSSLYMYGEDKQK---DQQGKLPLPS  203

Query  668  MKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            +KW+HH IH++R+VLT+    ATYGTADGS
Sbjct  204  IKWDHHHIHEKRSVLTISGATATYGTADGS  233



>ref|XP_009111520.1| PREDICTED: transducin beta-like protein 2 isoform X1 [Brassica 
rapa]
Length=428

 Score =   137 bits (344),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 12/135 (9%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD+I+ V I SV+LGA+IA + F +Y R R SEV+S++KA+   P + P   P+ S    
Sbjct  1    MDSILTVGIASVVLGALIAVVFFSSYLRKRTSEVDSMAKAEPQDPIRIPKSNPKKSHPKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H + K +             NKRHHPLDLNTLKGHGDSV  +CFSSDG SLATAC DG++
Sbjct  61   HATDKQNQ------------NKRHHPLDLNTLKGHGDSVDALCFSSDGKSLATACGDGVI  108

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  109  RVFKLDDASSKSFKF  123


 Score =   133 bits (335),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH SAV+FAD+ SSIVVAC   SGSSLYMYGE K      QQ+KLPLP
Sbjct  120  SFKFLRINLPAGGHPSAVSFADDASSIVVACHTMSGSSLYMYGEEKQK---EQQSKLPLP  176

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KWE H IHD+R+VLTL    ATYGTADGS
Sbjct  177  SIKWERHHIHDKRSVLTLSGATATYGTADGS  207



>ref|XP_009111521.1| PREDICTED: transducin beta-like protein 2 isoform X2 [Brassica 
rapa]
 emb|CDY63066.1| BnaAnng18580D [Brassica napus]
Length=427

 Score =   136 bits (343),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 13/135 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD+I+ V I SV+LGA+IA + F +Y R R SEV+S++KA+   P + P   P+ S    
Sbjct  1    MDSILTVGIASVVLGALIAVVFFSSYLRKRTSEVDSMAKAEPQDPIRIPKSNPKKSHPKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H + K+              NKRHHPLDLNTLKGHGDSV  +CFSSDG SLATAC DG++
Sbjct  61   HATDKNQ-------------NKRHHPLDLNTLKGHGDSVDALCFSSDGKSLATACGDGVI  107

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  108  RVFKLDDASSKSFKF  122


 Score =   133 bits (335),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH SAV+FAD+ SSIVVAC   SGSSLYMYGE K      QQ+KLPLP
Sbjct  119  SFKFLRINLPAGGHPSAVSFADDASSIVVACHTMSGSSLYMYGEEKQK---EQQSKLPLP  175

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             +KWE H IHD+R+VLTL    ATYGTADGS
Sbjct  176  SIKWERHHIHDKRSVLTLSGATATYGTADGS  206



>ref|XP_003552339.1| PREDICTED: uncharacterized LOC100306508 [Glycine max]
 gb|KHN40570.1| Transducin beta-like protein 2 [Glycine soja]
Length=429

 Score =   135 bits (341),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 91/135 (67%), Gaps = 15/135 (11%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD  +P+  +S++LGAIIAFL F  Y+R R+SE++SI+      PN KP           
Sbjct  1    MDPALPIVALSLLLGAIIAFLFFSTYYRKRQSEIQSIA-----DPNPKP----------L  45

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
             +            ++DKD NKRHHPLDLNTLKGHGD+VTGICFS DG +LATACADG+V
Sbjct  46   SSKAPPKKPLSKPHSSDKDQNKRHHPLDLNTLKGHGDAVTGICFSPDGRNLATACADGVV  105

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  106  RVFKLDDASSKSFKF  120


 Score =   134 bits (336),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAAT-DGTQQTKLPL  661
            SFKFLRINLPAGGH +AVAF+D+ SSIVVA    SG SLYMYGE K  T +   QTKLPL
Sbjct  117  SFKFLRINLPAGGHPTAVAFSDDASSIVVASYTLSGCSLYMYGEEKPKTSEDKPQTKLPL  176

Query  662  PEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PE+KWEHHK+HD+++++T+F   ATYGTADGS
Sbjct  177  PEIKWEHHKVHDKKSIITMFGASATYGTADGS  208



>ref|XP_006445262.1| hypothetical protein CICLE_v10020183mg [Citrus clementina]
 ref|XP_006490920.1| PREDICTED: transducin beta-like protein 2-like [Citrus sinensis]
 gb|ESR58502.1| hypothetical protein CICLE_v10020183mg [Citrus clementina]
 gb|KDO85823.1| hypothetical protein CISIN_1g013578mg [Citrus sinensis]
Length=440

 Score =   133 bits (335),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 5/135 (4%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++ + +VSV+LGA+IA + F +YF  R+SE++SI+K + ++P+ +  PT    + S 
Sbjct  1    MDPVLSITVVSVVLGALIAIIFFKSYFTKRRSEIKSIAKTE-LEPDHQKKPT----KPSQ  55

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
              SKKSHSK HSH+  DKD NKRHHPLD+NTLKGHGDSVTG+CFSSDG  LATACADG++
Sbjct  56   PISKKSHSKPHSHSHGDKDQNKRHHPLDVNTLKGHGDSVTGLCFSSDGKCLATACADGVI  115

Query  453  RVFKLDDATSKALSF  497
            RV KLDDA+SK+  F
Sbjct  116  RVHKLDDASSKSFKF  130


 Score =   133 bits (335),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAAT--DGTQQTKLP  658
            SFKFLRINLP GG  +AVAFAD  +SIVVA    SG SLYMYGE KA +  +G QQ+KLP
Sbjct  127  SFKFLRINLPPGGPPTAVAFADNATSIVVATHNLSGCSLYMYGEEKAISTNEGKQQSKLP  186

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KWEHHK+HD+RA+LTLF   ATYGTADGS
Sbjct  187  GPEIKWEHHKVHDKRAILTLFGASATYGTADGS  219



>gb|ACU14712.1| unknown [Glycine max]
Length=211

 Score =   133 bits (335),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAAT-DGTQQTKLPL  661
            SFKFLRINLPAGGH +AVAF+D+ SSIVVA    SG SLYMYGE K  T +   QTKLPL
Sbjct  117  SFKFLRINLPAGGHPTAVAFSDDASSIVVASYTLSGCSLYMYGEEKPKTSEDKPQTKLPL  176

Query  662  PEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PE+KWEHHK+HD+++++T+F   ATYGTADGS
Sbjct  177  PEIKWEHHKVHDKKSIITMFGASATYGTADGS  208


 Score =   133 bits (334),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 90/135 (67%), Gaps = 15/135 (11%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD  +P+  +S++LGAIIAFL F  Y+R R+SE++SI+      PN KP           
Sbjct  1    MDPALPIVALSLLLGAIIAFLFFSTYYRKRQSEIQSIA-----DPNPKP----------L  45

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
             +            ++DKD NKRHHPLDLNTLKGHG +VTGICFS DG +LATACADG+V
Sbjct  46   SSKAPPKKPLSKPHSSDKDQNKRHHPLDLNTLKGHGGAVTGICFSPDGRNLATACADGVV  105

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  106  RVFKLDDASSKSFKF  120



>ref|XP_002511720.1| nucleotide binding protein, putative [Ricinus communis]
 gb|EEF50389.1| nucleotide binding protein, putative [Ricinus communis]
Length=438

 Score =   139 bits (350),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 96/139 (69%), Gaps = 15/139 (11%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESIS----KADAVQPNQKPSPTPRhs  260
            MD ++P+AIVS++LGA+IA L F +YF  RKSE++SI+    ++D  +P +   P  + S
Sbjct  1    MDPVLPIAIVSILLGALIAILFFKSYFLKRKSEIKSIAPPELRSDPKKPTKHSQPVTKKS  60

Query  261  qqshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACA  440
                H+      +           N+RHHPLDLNTLKGHGD+VTG+CFS+DG SLATACA
Sbjct  61   HSKPHSHAADKEQ-----------NRRHHPLDLNTLKGHGDAVTGLCFSNDGRSLATACA  109

Query  441  DGIVRVFKLDDATSKALSF  497
            DG+VRVFKLDDA+S++  F
Sbjct  110  DGVVRVFKLDDASSRSFKF  128


 Score =   127 bits (318),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLPAGG   AV F+D+ SS+VVA    SG+SLY+YGE  PK + D  QQ KLP
Sbjct  125  SFKFLRINLPAGGIPVAVTFSDDASSVVVASQTLSGASLYLYGEENPKPSNDSKQQPKLP  184

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEH KIH+ +AV+TL  T ATYG+ADGS
Sbjct  185  LPEIKWEHRKIHENKAVITLVGTVATYGSADGS  217



>ref|XP_012083574.1| PREDICTED: transducin beta-like protein 2 [Jatropha curcas]
Length=440

 Score =   133 bits (335),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 4/135 (3%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++P+A++SV+LGA+IAFL F +Y   R+SE++SI+K +     +KP+   +   +  
Sbjct  1    MDPVLPIAVLSVLLGALIAFLFFKSYSHKRESEIKSITKPELDSAPKKPTKPAQPVTKKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H    SH    S         KRHHPLDLNTLKGHGDSV G+CFS+DG SLATAC DG+V
Sbjct  61   HPKPHSHHSHASDKDQI----KRHHPLDLNTLKGHGDSVNGLCFSNDGRSLATACGDGVV  116

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  117  RVFKLDDASSKSFKF  131


 Score =   132 bits (332),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAA-TDGTQQTKLPL  661
            SFKFLRI++PAGGH  AVAFAD+ SS+VVA    SG+SLYM+GE K    +  QQ+KLPL
Sbjct  128  SFKFLRISVPAGGHPVAVAFADDASSVVVASQTLSGASLYMFGEEKVKPNESKQQSKLPL  187

Query  662  PEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PE+KWEHHKIHD+ AVLTL  T ATYGTADGS
Sbjct  188  PEVKWEHHKIHDKNAVLTLVGTAATYGTADGS  219



>ref|XP_002301292.2| hypothetical protein POPTR_0002s14900g [Populus trichocarpa]
 gb|EEE80565.2| hypothetical protein POPTR_0002s14900g [Populus trichocarpa]
Length=515

 Score =   133 bits (335),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 6/135 (4%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++P+A++S++LG  IA + F NYF  RKSE+ SIS+        K  P P       
Sbjct  78   MDQVLPIALISLLLGTAIALIFFKNYFLKRKSEIGSISEPGLHPDLHKKPPKP------T  131

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H S+K HSK HSHA++DKD NK+HHPLDLNTLKGHGDSV+G+CFS DG SLATACADG+V
Sbjct  132  HQSRKPHSKPHSHASSDKDHNKKHHPLDLNTLKGHGDSVSGLCFSYDGRSLATACADGVV  191

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  192  RVFKLDDASSKSFKF  206


 Score =   131 bits (329),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPK--AATDGTQQTKLP  658
            SFKFLRIN+PAGGH  AVAF+D+ SS+VVA    SGSSLYM+GE K  A  D  QQ KLP
Sbjct  203  SFKFLRINVPAGGHPVAVAFSDDASSVVVASQTLSGSSLYMWGEEKVKATDDSKQQPKLP  262

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LP++KWEHHKIH++RAVLTL  T +TYG+ DGS
Sbjct  263  LPDIKWEHHKIHEKRAVLTLVGTASTYGSGDGS  295



>ref|XP_010092831.1| Transducin beta-like protein 2 [Morus notabilis]
 gb|EXB52649.1| Transducin beta-like protein 2 [Morus notabilis]
Length=498

 Score =   136 bits (342),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            M   +P+AI SV+LGA +A + FG YFR R+SEV+SISK     P  +  P  R S +  
Sbjct  59   MGPAIPIAIFSVVLGAFLAIVFFGCYFRKRRSEVQSISK-----PELQSDPKIR-SSKPS  112

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                K H       A+DKD NKRHHPLD+NTLKGHGDSVTG+CFSSDG SLATACADG++
Sbjct  113  QPITKKHHSKPHSHASDKDQNKRHHPLDVNTLKGHGDSVTGLCFSSDGRSLATACADGVI  172

Query  453  RVFKLDDATSKALSF  497
            R+FKLDDA+SK+  F
Sbjct  173  RIFKLDDASSKSFKF  187


 Score =   128 bits (321),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSG-SSLYMYGE--PKAATDGTQQTKL  655
            SFKFLRINLPAGG+  AVAF+D+ SS+VVA    +G  SLYMYGE  PK +    QQ KL
Sbjct  184  SFKFLRINLPAGGNPVAVAFSDDASSVVVASQTVAGGCSLYMYGEEKPKTSEGNKQQNKL  243

Query  656  PLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PLPE+KWE HK+HD+RA+LTLF T ATYG+ADGS
Sbjct  244  PLPEIKWERHKVHDKRAILTLFGTAATYGSADGS  277



>ref|XP_011017492.1| PREDICTED: transducin beta-like protein 2 [Populus euphratica]
Length=439

 Score =   135 bits (340),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 6/135 (4%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++P+A++S++LG  IA + F NYF  RKSE+ SIS+        K  P P       
Sbjct  1    MDQVLPIALISLLLGTAIALIFFKNYFLKRKSEIGSISEPGLHSDLHKKPPKP------T  54

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H S+K H+K HSHA++DKD NK+HHPLDLNTLKGHGDSVTG+CFS DG SLATACADG+V
Sbjct  55   HQSRKPHTKPHSHASSDKDHNKKHHPLDLNTLKGHGDSVTGLCFSYDGRSLATACADGVV  114

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  115  RVFKLDDASSKSFKF  129


 Score =   128 bits (322),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEP--KAATDGTQQTKLP  658
            SFKFLRIN+PAGGH  AVAF+D+ SS+VVA    SGSSLYM+GE   KA  D  QQ KLP
Sbjct  126  SFKFLRINVPAGGHPVAVAFSDDASSVVVASQTLSGSSLYMWGEEKVKATDDSKQQPKLP  185

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LP++KWE HKIH++RAVLTL  T +TYG+ DGS
Sbjct  186  LPDIKWEQHKIHEKRAVLTLVGTASTYGSGDGS  218



>ref|XP_010053895.1| PREDICTED: transducin beta-like protein 2 [Eucalyptus grandis]
 gb|KCW78269.1| hypothetical protein EUGRSUZ_D02453 [Eucalyptus grandis]
Length=438

 Score =   139 bits (351),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 94/136 (69%), Gaps = 8/136 (6%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKAD-AVQPNQKPSPTPRhsqqs  269
            MD+ V +A +S+++GA IA L FGNYFR R+SEV ++++AD    P     P P+ + + 
Sbjct  1    MDSAVAIAALSLVVGAAIALLFFGNYFRKRRSEVVAMAEADLQTHPKNPSRPPPQPAAKK  60

Query  270  hhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGI  449
             H    +H             NKRHHPLDLNTLKGHGDSVTG+CF+SDG SLATACADG+
Sbjct  61   VHAKSHAHGADKDK-------NKRHHPLDLNTLKGHGDSVTGLCFASDGRSLATACADGV  113

Query  450  VRVFKLDDATSKALSF  497
            VRVFKLDDA++K+  F
Sbjct  114  VRVFKLDDASNKSFKF  129


 Score =   124 bits (311),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLPAGGH +AVAF D+ SS++VA    SG SLYMYGE  P       QQTKLP
Sbjct  126  SFKFLRINLPAGGHPTAVAFGDDVSSVIVASQHLSGCSLYMYGEEKPTNLDSNKQQTKLP  185

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            +PE+KWEHHK+H+Q+A+LTL    A Y + DGS
Sbjct  186  MPEIKWEHHKVHEQKAILTLSGAAANYDSGDGS  218



>ref|XP_010544365.1| PREDICTED: transducin beta-like protein 2 [Tarenaya hassleriana]
Length=438

 Score =   139 bits (351),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLP+G H +AVAFAD+ SS+VVAC A SGSS+YMYGE  PKA+ +G QQ KLP
Sbjct  125  SFKFLRINLPSGSHPTAVAFADDASSVVVACHAMSGSSVYMYGEEKPKASNEGKQQAKLP  184

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KW+HH +H++RA+LTL    ATYGTADGS
Sbjct  185  LPEIKWKHHSVHERRAILTLSGATATYGTADGS  217


 Score =   124 bits (311),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 98/135 (73%), Gaps = 7/135 (5%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD+++ VA+ SV++GA+IA + FG+YFR R+SEV+SI+K D       P P P  +Q+S+
Sbjct  1    MDSVLLVAVASVVVGALIAVVFFGSYFRKRRSEVQSIAKVD-------PRPDPTRNQKSN  53

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                K         ++DKD  KR HPLDLNTLKGHGD+VTG+CFSSDG +LATAC DG++
Sbjct  54   QPLSKKAHPKLHSHSSDKDQPKRRHPLDLNTLKGHGDTVTGLCFSSDGRNLATACGDGVI  113

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  114  RVFKLDDASSKSFKF  128



>ref|XP_003534612.1| PREDICTED: transducin beta-like protein 2-like [Glycine max]
 gb|KHN29451.1| Transducin beta-like protein 2 [Glycine soja]
Length=435

 Score =   132 bits (331),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAAT-DGTQQTKLPL  661
            SFKFLRINLPAGGH +AVAF+D+ SSIVVA    SG SLYMYGE K  T +   Q KLPL
Sbjct  123  SFKFLRINLPAGGHPTAVAFSDDASSIVVASYTLSGCSLYMYGEEKPKTSEDKPQAKLPL  182

Query  662  PEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PE+KWEHHK+HD+++++T+F   ATYGTADGS
Sbjct  183  PEIKWEHHKVHDKKSIITMFGASATYGTADGS  214


 Score =   131 bits (330),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 90/135 (67%), Gaps = 9/135 (7%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD  +P+  +S++LGAIIAFL F  YF  R+SE+ SI+          P+P    + +  
Sbjct  1    MDPALPIVALSLLLGAIIAFLIFNTYFCKRQSEIRSIAD---------PNPNSNSNPKLV  51

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
             +            ++DKD NKRHHPLDLNTLKGHGD+VTG+CFS DG +LATACADG+V
Sbjct  52   SSKPPPKKPLSKPHSSDKDQNKRHHPLDLNTLKGHGDAVTGVCFSRDGRNLATACADGVV  111

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  112  RVFKLDDASSKSFKF  126



>ref|XP_002320061.2| hypothetical protein POPTR_0014s06500g [Populus trichocarpa]
 gb|EEE98376.2| hypothetical protein POPTR_0014s06500g [Populus trichocarpa]
Length=435

 Score =   135 bits (339),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 92/138 (67%), Gaps = 16/138 (12%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPN---QKPSPTPRhsq  263
            MD ++P+A++SV+LG   A + F NYF  RKSE+ SI+K + + P+   + P PT +  +
Sbjct  1    MDQVLPIALISVLLGTAFALIFFKNYFLKRKSEIGSIAKPE-IHPDPLRKPPKPTHQSKK  59

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
               H S                 NK+HHPLDLNTLKGHGDSVTG+CFS DG SLATACAD
Sbjct  60   SHSHASSDKDH------------NKKHHPLDLNTLKGHGDSVTGLCFSYDGRSLATACAD  107

Query  444  GIVRVFKLDDATSKALSF  497
            G+VRVFKLDDA+SK+  F
Sbjct  108  GVVRVFKLDDASSKSFKF  125


 Score =   127 bits (318),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFKFLRIN+PAGGH  AVAF+D+ SS+V+A    SGSSLYM+GE K   + D  QQ KLP
Sbjct  122  SFKFLRINVPAGGHPVAVAFSDDASSVVLASHTLSGSSLYMWGEEKVKDSNDSKQQPKLP  181

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHKIH+++ VLTL  T +TYG  DGS
Sbjct  182  LPEIKWEHHKIHEKKVVLTLVGTASTYGNGDGS  214



>ref|XP_004492634.1| PREDICTED: transducin beta-like protein 2-like [Cicer arietinum]
Length=432

 Score =   133 bits (335),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPK-AATDGTQQTKLPL  661
            SFKFLRINLPAGGH +AVAF+++ SSIVV+    SG SLYMYGE K  A++   QTKLPL
Sbjct  124  SFKFLRINLPAGGHPTAVAFSNDASSIVVSSHTLSGCSLYMYGEEKPKASENMPQTKLPL  183

Query  662  PEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PE+KWE+HK+HD++A++TLF T ATYGTADGS
Sbjct  184  PEIKWENHKVHDKKAIITLFGTSATYGTADGS  215


 Score =   127 bits (319),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 88/147 (60%), Gaps = 32/147 (22%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQ------------PNQK  236
            MD ++P+  +S++LGAIIAF+ F  YFR RKSEV SI+  +               PN+K
Sbjct  1    MDEVLPIVALSLLLGAIIAFIFFNTYFRQRKSEVRSITNPNPNPNPNPISSSSKPLPNKK  60

Query  237  PSPTPRhsqqshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDG  416
              P    S +                      +KRHHPLDLNTLKGHGD+VTGICFS DG
Sbjct  61   SHPKHHSSDKDQ--------------------SKRHHPLDLNTLKGHGDAVTGICFSPDG  100

Query  417  CSLATACADGIVRVFKLDDATSKALSF  497
             +LATAC DG+VRVFKLDDA+SK+  F
Sbjct  101  RNLATACGDGVVRVFKLDDASSKSFKF  127



>ref|XP_011034318.1| PREDICTED: transducin beta-like protein 2 [Populus euphratica]
Length=435

 Score =   134 bits (338),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 93/138 (67%), Gaps = 16/138 (12%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPN---QKPSPTPRhsq  263
            MD ++P+A++SV+LG  IA + F NYF  RKSE+ SI+K + + P+   + P PT +  +
Sbjct  1    MDQVLPIALISVLLGTAIALIFFKNYFLQRKSEIGSIAKPE-IHPDPLRKPPKPTHQSKK  59

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
               H S                 N++HHPLDLNTLKGHGDSVTG+CFS DG +LATACAD
Sbjct  60   SHSHASSDKDH------------NRKHHPLDLNTLKGHGDSVTGLCFSYDGRNLATACAD  107

Query  444  GIVRVFKLDDATSKALSF  497
            G+VRVFKLDDA+SK+  F
Sbjct  108  GVVRVFKLDDASSKSFKF  125


 Score =   125 bits (315),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFKFLRIN+PAGGH   VAF+D+ SS+V+A    SGSSLYM+GE K   + D  QQ KLP
Sbjct  122  SFKFLRINVPAGGHPVGVAFSDDASSVVLASHTLSGSSLYMWGEEKVKDSNDSKQQPKLP  181

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHKIH+++ VLTL  T +TYG  DGS
Sbjct  182  LPEIKWEHHKIHEKKVVLTLVGTASTYGNGDGS  214



>ref|XP_010692248.1| PREDICTED: transducin beta-like protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=439

 Score =   139 bits (351),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 98/137 (72%), Gaps = 10/137 (7%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQP--NQKPSPTPRhsqq  266
            MD ++P+ + S ILGAII FL FGNYFR +KSEVES++KA+ +    ++KPS +      
Sbjct  1    MDPLLPIVLFSTILGAIIVFLIFGNYFRKQKSEVESLAKAEPMNDAISKKPSKS------  54

Query  267  shhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADG  446
                + K     H   AADK+ NK+HHPLDLNTLKGHGDSV G+CFSSDG +L TACADG
Sbjct  55   --IPNSKKSQFKHHSHAADKELNKKHHPLDLNTLKGHGDSVGGLCFSSDGKNLVTACADG  112

Query  447  IVRVFKLDDATSKALSF  497
            +VRVF+LDD ++K+  F
Sbjct  113  VVRVFRLDDVSNKSFKF  129


 Score =   120 bits (300),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAA-TDGT-QQTKLP  658
            SFKFLRIN+PAG H  AV+F ++ SSIVVA  A  G+SLYMY E KA  +DG+ QQ KLP
Sbjct  126  SFKFLRINMPAGNHPVAVSFLEDDSSIVVATQALLGTSLYMYAEEKAKPSDGSKQQAKLP  185

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHKIH++ A+L L    A YGT DGS
Sbjct  186  LPEIKWEHHKIHEKNAILNLVGATARYGTGDGS  218



>ref|XP_010276529.1| PREDICTED: transducin beta-like protein 2 [Nelumbo nucifera]
Length=448

 Score =   130 bits (326),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEP--KAATDGTQQTKLP  658
            SFKFLRINLPAG H +AV F+D  S +VVA  + SGSSLYMYGE   K  ++  QQ KLP
Sbjct  135  SFKFLRINLPAGSHPTAVVFSDGVSDLVVAAQSLSGSSLYMYGEANTKTTSETKQQPKLP  194

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHK+HD+RA+LTL  T A+YGTADGS
Sbjct  195  LPEIKWEHHKVHDKRAILTLVGTSASYGTADGS  227


 Score =   128 bits (321),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +3

Query  99   AIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKAD---AVQPNQKPSPTPRhsqqs  269
            +++P++I SV++G  +  L FG+YFR ++SEV++I+  +   A  P + P  TPR  +  
Sbjct  14   SVLPISIFSVLVGGSLVLLFFGDYFRKKRSEVQTIANPEPTAAQIPLKSPQSTPRKLRSK  73

Query  270  hhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGI  449
             H+      +            KRHHPLD NTLKGHGDSVTG+CFSSDG +LAT CADG+
Sbjct  74   SHSHATEKDQI-----------KRHHPLDANTLKGHGDSVTGLCFSSDGRNLATVCADGV  122

Query  450  VRVFKLDDATSKALSF  497
            VRVFKLDD +SK+  F
Sbjct  123  VRVFKLDDVSSKSFKF  138



>ref|XP_007219028.1| hypothetical protein PRUPE_ppa004482mg [Prunus persica]
 gb|EMJ20227.1| hypothetical protein PRUPE_ppa004482mg [Prunus persica]
Length=507

 Score =   136 bits (343),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 8/135 (6%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++ +A++S+++GA+IA   FGNYFR R SE++SIS+ + +Q + K  P+        
Sbjct  72   MDPVLLIAVLSILIGAVIALAFFGNYFRKRSSEIQSISQPE-LQSDPKKQPS-------K  123

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                K          +DKD NK+HHPLD+NTLKGHGD+VTG+CFSSDG SLATACADG++
Sbjct  124  PHQTKKSHAKPHSHTSDKDQNKKHHPLDVNTLKGHGDAVTGLCFSSDGRSLATACADGVL  183

Query  453  RVFKLDDATSKALSF  497
            R+FKLDDA+SK+  F
Sbjct  184  RIFKLDDASSKSFKF  198


 Score =   120 bits (301),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYG--EPKAATDGTQQTKLP  658
            SFKFLRINLP GGH  AV+F+D+  S+V A  + SGSSLYMYG  +PK + +  QQ KLP
Sbjct  195  SFKFLRINLPVGGHPVAVSFSDDGLSLVAASQSLSGSSLYMYGVEKPKPSEEVKQQPKLP  254

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHK+H++  +LTL  T A+YG+ADGS
Sbjct  255  LPEIKWEHHKVHEKLGILTLSGTTASYGSADGS  287



>ref|XP_008232654.1| PREDICTED: transducin beta-like protein 2 [Prunus mume]
Length=436

 Score =   137 bits (345),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 8/135 (6%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++ +A++S+++GA+IA   FGNYFR R SE++SIS+ + +Q + K  P+        
Sbjct  1    MDPVLLIAVLSILIGAVIALAFFGNYFRKRSSEIQSISQPE-LQSDPKKQPS-------K  52

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                K          +DKD NK+HHPLD+NTLKGHGD+VTG+CFSSDG SLATACADG++
Sbjct  53   PHQTKKSHAKPHSHTSDKDQNKKHHPLDVNTLKGHGDAVTGLCFSSDGRSLATACADGVL  112

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  113  RVFKLDDASSKSFKF  127


 Score =   118 bits (295),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYG--EPKAATDGTQQTKLP  658
            SFKFLRINLP GGH  AV+F+D+  S+V A  + SGSSLYMYG  +PK + +  QQ KLP
Sbjct  124  SFKFLRINLPVGGHPVAVSFSDDGLSLVAASQSLSGSSLYMYGVEKPKPSEEVKQQPKLP  183

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWE+HK+H++  +LTL  T A+YG+ADGS
Sbjct  184  LPEIKWENHKVHEKLGILTLSGTTASYGSADGS  216



>ref|XP_008438164.1| PREDICTED: transducin beta-like protein 2 [Cucumis melo]
Length=434

 Score =   136 bits (343),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 97/138 (70%), Gaps = 15/138 (11%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAV---QPNQKPSPTPRhsq  263
            MD+ + + +VSVILGA+IA + FG+YFR R+SEV++IS  +     + +QKPS T     
Sbjct  1    MDSTLLIPVVSVILGALIAVIFFGSYFRKRRSEVQTISHPELPSDPKKHQKPSQT-----  55

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
                   K         ++DKD NK+HH LDLNTLKGHGDSVTG+CFSSDG +LATACAD
Sbjct  56   -------KKSHSKPHSHSSDKDQNKKHHTLDLNTLKGHGDSVTGLCFSSDGSNLATACAD  108

Query  444  GIVRVFKLDDATSKALSF  497
            G++RVFKLDDA+SK+  F
Sbjct  109  GVIRVFKLDDASSKSFKF  126


 Score =   118 bits (296),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (81%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLPAGGH +AVAF D+ +SI+V+    SGSSLYMYGE  PK +++  QQ KLP
Sbjct  123  SFKFLRINLPAGGHPTAVAFGDDATSIIVSSQGLSGSSLYMYGEEKPKPSSENKQQAKLP  182

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWE HK+HD+++V+TL    A+YG+ADGS
Sbjct  183  LPEIKWEQHKVHDKKSVITLVGATASYGSADGS  215



>gb|KJB22316.1| hypothetical protein B456_004G040800 [Gossypium raimondii]
Length=437

 Score =   130 bits (326),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEP---KAATDGTQQTKL  655
            SFKFLRIN+P GGH  AVAFAD+ SS+VVA    +G SLYMYGE    K +TD  QQ+KL
Sbjct  124  SFKFLRINVPLGGHAVAVAFADDSSSVVVASQTVTGCSLYMYGEENPKKGSTDSNQQSKL  183

Query  656  PLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PLP++KWEHHKIHD++A+LTL    A+YGT DGS
Sbjct  184  PLPQVKWEHHKIHDKQAILTLTRATASYGTGDGS  217


 Score =   124 bits (311),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 88/138 (64%), Gaps = 14/138 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADA---VQPNQKPSPTPRhsq  263
            MD I+  A +SV+LGA+IAF+ F +Y    +S V++IS+ +     +   KP   P+   
Sbjct  1    MDPILAAAALSVVLGAVIAFVFFKSYLLKERSNVQAISEPELHSDPKKTSKPQHVPKKYH  60

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
               H+      +           +KRHHPLDLNTLKGH DSVTG+CFSSDG +LATACAD
Sbjct  61   SKPHSHASDKEQ-----------SKRHHPLDLNTLKGHADSVTGMCFSSDGRNLATACAD  109

Query  444  GIVRVFKLDDATSKALSF  497
            G+VRVFKLDDA+SK+  F
Sbjct  110  GVVRVFKLDDASSKSFKF  127



>gb|KJB22318.1| hypothetical protein B456_004G040800 [Gossypium raimondii]
Length=435

 Score =   129 bits (325),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEP---KAATDGTQQTKL  655
            SFKFLRIN+P GGH  AVAFAD+ SS+VVA    +G SLYMYGE    K +TD  QQ+KL
Sbjct  124  SFKFLRINVPLGGHAVAVAFADDSSSVVVASQTVTGCSLYMYGEENPKKGSTDSNQQSKL  183

Query  656  PLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PLP++KWEHHKIHD++A+LTL    A+YGT DGS
Sbjct  184  PLPQVKWEHHKIHDKQAILTLTRATASYGTGDGS  217


 Score =   124 bits (311),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 88/138 (64%), Gaps = 14/138 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADA---VQPNQKPSPTPRhsq  263
            MD I+  A +SV+LGA+IAF+ F +Y    +S V++IS+ +     +   KP   P+   
Sbjct  1    MDPILAAAALSVVLGAVIAFVFFKSYLLKERSNVQAISEPELHSDPKKTSKPQHVPKKYH  60

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
               H+      +           +KRHHPLDLNTLKGH DSVTG+CFSSDG +LATACAD
Sbjct  61   SKPHSHASDKEQ-----------SKRHHPLDLNTLKGHADSVTGMCFSSDGRNLATACAD  109

Query  444  GIVRVFKLDDATSKALSF  497
            G+VRVFKLDDA+SK+  F
Sbjct  110  GVVRVFKLDDASSKSFKF  127



>gb|KJB22317.1| hypothetical protein B456_004G040800 [Gossypium raimondii]
Length=483

 Score =   129 bits (324),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEP---KAATDGTQQTKL  655
            SFKFLRIN+P GGH  AVAFAD+ SS+VVA    +G SLYMYGE    K +TD  QQ+KL
Sbjct  124  SFKFLRINVPLGGHAVAVAFADDSSSVVVASQTVTGCSLYMYGEENPKKGSTDSNQQSKL  183

Query  656  PLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PLP++KWEHHKIHD++A+LTL    A+YGT DGS
Sbjct  184  PLPQVKWEHHKIHDKQAILTLTRATASYGTGDGS  217


 Score =   124 bits (311),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 88/138 (64%), Gaps = 14/138 (10%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADA---VQPNQKPSPTPRhsq  263
            MD I+  A +SV+LGA+IAF+ F +Y    +S V++IS+ +     +   KP   P+   
Sbjct  1    MDPILAAAALSVVLGAVIAFVFFKSYLLKERSNVQAISEPELHSDPKKTSKPQHVPKKYH  60

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
               H+      +           +KRHHPLDLNTLKGH DSVTG+CFSSDG +LATACAD
Sbjct  61   SKPHSHASDKEQ-----------SKRHHPLDLNTLKGHADSVTGMCFSSDGRNLATACAD  109

Query  444  GIVRVFKLDDATSKALSF  497
            G+VRVFKLDDA+SK+  F
Sbjct  110  GVVRVFKLDDASSKSFKF  127



>ref|XP_004133912.1| PREDICTED: transducin beta-like protein 2 [Cucumis sativus]
 gb|KGN56600.1| hypothetical protein Csa_3G126150 [Cucumis sativus]
Length=434

 Score =   138 bits (348),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 97/138 (70%), Gaps = 15/138 (11%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAV---QPNQKPSPTPRhsq  263
            MD  + + +VSVILGA+IA + FG+YFR R+SEV++IS  +     + +QKPS T     
Sbjct  1    MDFALLIPVVSVILGALIAVIFFGSYFRKRRSEVQTISHPELPSDPKKHQKPSQT-----  55

Query  264  qshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACAD  443
                   K         +++KD NK+HHPLDLNTLKGHGDSVTG+CFSSDG +LATACAD
Sbjct  56   -------KKSHSKPHSHSSEKDQNKKHHPLDLNTLKGHGDSVTGLCFSSDGSNLATACAD  108

Query  444  GIVRVFKLDDATSKALSF  497
            G++RVFKLDDA+SK+  F
Sbjct  109  GVIRVFKLDDASSKSFKF  126


 Score =   114 bits (286),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFKFLRINLPAGGH +AV F D+ +SI+V+    SGSSLYMYGE KA   G   QQ KLP
Sbjct  123  SFKFLRINLPAGGHPTAVMFGDDATSIIVSSQGLSGSSLYMYGEEKAKPSGETKQQAKLP  182

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWE HK+HD+++V+TL    A+YG+ADGS
Sbjct  183  LPEIKWEQHKVHDKKSVITLVGATASYGSADGS  215



>ref|XP_007052058.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOX96215.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=434

 Score =   129 bits (324),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPK--AATDGTQQTKLP  658
            SFKFLRI +PAGGH  AV F+++ SSIVVA    +G SLYMYGE K  A  D  QQTKLP
Sbjct  121  SFKFLRITVPAGGHPMAVVFSEDASSIVVASQTLTGCSLYMYGEEKQKATNDSKQQTKLP  180

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHKIH++RA+LTL    A+YGTADGS
Sbjct  181  LPEIKWEHHKIHEKRAILTLTGATASYGTADGS  213


 Score =   123 bits (308),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 86/135 (64%), Gaps = 11/135 (8%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD I+ V  +SV+LGA+I F+ F +YF  ++SEV++I+K           P      +  
Sbjct  1    MDPILSVVALSVVLGAVIVFVFFKSYFLKQRSEVQTIAK-----------PELHSDPKKP  49

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                +   +        KD NKRHHPLDLNTLKGH DSV G+CFSSDG +LATACADG+V
Sbjct  50   SKPPQPIFRKSHAKHHSKDQNKRHHPLDLNTLKGHADSVAGLCFSSDGRNLATACADGVV  109

Query  453  RVFKLDDATSKALSF  497
            RVFKL+DA+SK+  F
Sbjct  110  RVFKLEDASSKSFKF  124



>gb|KJB24807.1| hypothetical protein B456_004G161700 [Gossypium raimondii]
Length=437

 Score =   126 bits (316),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 3/93 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLPAGGH  AVAF+D+ SSIVVA  A +G SLYMY E  PK A    QQTKLP
Sbjct  125  SFKFLRINLPAGGHPIAVAFSDDASSIVVASQAMTGCSLYMYEEEKPKTANGPKQQTKLP  184

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             P++KWEHHKIH+++A+LTL  + ATYGTADGS
Sbjct  185  -PQIKWEHHKIHEKQAILTLTGSTATYGTADGS  216


 Score =   125 bits (314),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 93/135 (69%), Gaps = 7/135 (5%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD I+  A++S+++GA+IAF+ F +Y   ++SEV++I+K D     +K S  P+H  +  
Sbjct  1    MDPILSTAVLSLVIGAVIAFVFFRSYLLKQRSEVQTIAKPDLHSDPKKHSKPPQHVSRKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H+   +H+            NKRHHPLDLNTLKGH DSVTG+CFS D  +LATAC+DG+V
Sbjct  61   HSKSHAHASDKDS-------NKRHHPLDLNTLKGHADSVTGLCFSPDARNLATACSDGVV  113

Query  453  RVFKLDDATSKALSF  497
            R+FKL+DA+SK+  F
Sbjct  114  RIFKLEDASSKSFKF  128



>ref|XP_008344385.1| PREDICTED: transducin beta-like protein 2 [Malus domestica]
Length=385

 Score =   135 bits (340),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 8/135 (6%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++P+A +S+++GA+IA   FG+YFR R SE++SISK +     +K    P  +++SH
Sbjct  1    MDPLLPIAALSILIGAVIALAFFGSYFRKRSSEIQSISKPELQSDQKKHQSKPHQTKKSH  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                   S            NK+HHPLD+NTLKGHGD+VT +CFSSDG SLATACADG++
Sbjct  61   ARPHSHASDKDQ--------NKKHHPLDVNTLKGHGDAVTDLCFSSDGRSLATACADGVL  112

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  113  RVFKLDDASSKSFKF  127


 Score =   115 bits (288),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +2

Query  485  SFKFLRINLPAG-GHTSAVAFADEKSSIVVACPAFSGSSLYMYG---EPKAATDGTQQTK  652
            SFKFLRI+LP G GH  AV+F+D+  SIVVA  + +GSSLYMYG   +PK + +  QQ K
Sbjct  124  SFKFLRISLPPGAGHPVAVSFSDDGLSIVVASQSLTGSSLYMYGGVEKPKPSEEARQQPK  183

Query  653  LPLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPLPE+KW HHK+HD+  +LTL  T A+YGTADGS
Sbjct  184  LPLPEVKWGHHKVHDKLGILTLSGTTASYGTADGS  218



>gb|KHG13871.1| Transducin beta-like protein 2 [Gossypium arboreum]
Length=426

 Score =   125 bits (315),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 3/93 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLPAGGH  AVAF+D+ SSIVVA  A +G SLYMY E  PK A    QQTKLP
Sbjct  125  SFKFLRINLPAGGHPIAVAFSDDASSIVVASQAMTGCSLYMYEEEKPKTANGPKQQTKLP  184

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             P++KWEHHKIH+++A+LTL  + ATYGTADGS
Sbjct  185  -PQIKWEHHKIHEKQAILTLTGSTATYGTADGS  216


 Score =   124 bits (312),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 93/135 (69%), Gaps = 7/135 (5%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD I+  A++S+++GA+IAF+ F +Y   ++SEV++I+K D     +K S  P+H  +  
Sbjct  1    MDPILSTAVLSLVIGAVIAFVFFRSYLLKQRSEVQTIAKPDLHSDPKKHSKPPQHVSRKS  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H+   +H+            NKRHHPLDLNTLKGH DSVTG+CFS D  +LATAC+DG+V
Sbjct  61   HSKSHAHAPDKDS-------NKRHHPLDLNTLKGHADSVTGLCFSPDARNLATACSDGVV  113

Query  453  RVFKLDDATSKALSF  497
            R+FKL+DA+SK+  F
Sbjct  114  RIFKLEDASSKSFKF  128



>ref|XP_002279016.1| PREDICTED: transducin beta-like protein 2 [Vitis vinifera]
 ref|XP_010661631.1| PREDICTED: transducin beta-like protein 2 [Vitis vinifera]
Length=439

 Score =   134 bits (336),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 6/135 (4%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++  A+VS++LGA+IA +  GNYF  R+SEVESI K + +Q ++ P P      +  
Sbjct  1    MDPVLLAAVVSILLGALIALVFLGNYFLKRRSEVESIFKPE-LQSDKNPKPA-----KPP  54

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
             +  K     H   AADKD NKRHHPLD+NTLKGHGDSV G+CFS DG +LATACADG+V
Sbjct  55   QSFSKKSQFKHHSHAADKDQNKRHHPLDINTLKGHGDSVNGLCFSPDGRNLATACADGVV  114

Query  453  RVFKLDDATSKALSF  497
            RV+KLDDA+SK+  F
Sbjct  115  RVYKLDDASSKSFKF  129


 Score =   115 bits (289),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFKFLRIN+P GGH +AV F D+ SS+VVA    SG SL+M+G+ +A  A +  Q  K P
Sbjct  126  SFKFLRINVPLGGHPTAVTFGDDSSSVVVASQTLSGCSLFMFGDERAKTANETKQPAKPP  185

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            +PE+KWE  K+HD+RA+LTLF T A+YG+ADGS
Sbjct  186  VPEIKWERLKVHDKRAILTLFGTTASYGSADGS  218



>emb|CBI38849.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   133 bits (335),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 6/135 (4%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++  A+VS++LGA+IA +  GNYF  R+SEVESI K + +Q ++ P P      +  
Sbjct  1    MDPVLLAAVVSILLGALIALVFLGNYFLKRRSEVESIFKPE-LQSDKNPKPA-----KPP  54

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
             +  K     H   AADKD NKRHHPLD+NTLKGHGDSV G+CFS DG +LATACADG+V
Sbjct  55   QSFSKKSQFKHHSHAADKDQNKRHHPLDINTLKGHGDSVNGLCFSPDGRNLATACADGVV  114

Query  453  RVFKLDDATSKALSF  497
            RV+KLDDA+SK+  F
Sbjct  115  RVYKLDDASSKSFKF  129


 Score =   115 bits (289),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFKFLRIN+P GGH +AV F D+ SS+VVA    SG SL+M+G+ +A  A +  Q  K P
Sbjct  126  SFKFLRINVPLGGHPTAVTFGDDSSSVVVASQTLSGCSLFMFGDERAKTANETKQPAKPP  185

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            +PE+KWE  K+HD+RA+LTLF T A+YG+ADGS
Sbjct  186  VPEIKWERLKVHDKRAILTLFGTTASYGSADGS  218



>ref|XP_009368706.1| PREDICTED: transducin beta-like protein 2 [Pyrus x bretschneideri]
Length=438

 Score =   135 bits (340),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 16/139 (12%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISK----ADAVQPNQKPSPTPRhs  260
            MD ++PVA++S+++GA+IA   F +YFR R SE++SISK    +D  +   KP  T +  
Sbjct  1    MDPVLPVAVLSILVGAVIALAFFTSYFRKRSSEIQSISKPELQSDPKRHQSKPHQTKKSH  60

Query  261  qqshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACA  440
             ++H  +                 NK+HHPLD+NTLKGHGD+V G+CFSSDG SLATACA
Sbjct  61   ARAHSHASDKDQ------------NKKHHPLDVNTLKGHGDAVNGVCFSSDGRSLATACA  108

Query  441  DGIVRVFKLDDATSKALSF  497
            DG++RVFKLDDA+SK+  F
Sbjct  109  DGVLRVFKLDDASSKSFKF  127


 Score =   113 bits (282),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 4/95 (4%)
 Frame = +2

Query  485  SFKFLRINLPAG-GHTSAVAFADEKSSIVVACPAFSGSSLYMYG---EPKAATDGTQQTK  652
            SFKFLRI+LP G G   AV+F+D+  SIVVA  + +GSSLYMYG   +PK +    QQ K
Sbjct  124  SFKFLRISLPPGAGQPVAVSFSDDGLSIVVASQSLTGSSLYMYGGVEKPKPSEGAKQQPK  183

Query  653  LPLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPLPE+KW+HHK+HD+  +LTL  T A+YGTADGS
Sbjct  184  LPLPEVKWDHHKVHDKLGILTLSGTTASYGTADGS  218



>ref|XP_009347289.1| PREDICTED: transducin beta-like protein 2 [Pyrus x bretschneideri]
Length=442

 Score =   135 bits (339),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 8/135 (6%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++P+A +S+I+GA+IA   FG+YFR R SE++SISK +     +K    P  +++SH
Sbjct  1    MDPLLPIAALSIIIGAVIALAFFGSYFRKRSSEIQSISKPELQSDQKKHQSKPHQTKKSH  60

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
                   S            NK+HHPLD+NTLKGHGD+VT +CFSSDG SLAT CADG++
Sbjct  61   ARPHSHASDKDQ--------NKKHHPLDVNTLKGHGDAVTDLCFSSDGRSLATTCADGVL  112

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  113  RVFKLDDASSKSFKF  127


 Score =   113 bits (283),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 4/95 (4%)
 Frame = +2

Query  485  SFKFLRINLPAG-GHTSAVAFADEKSSIVVACPAFSGSSLYMYG---EPKAATDGTQQTK  652
            SFKFLRI+LP G GH  AV+F+D+  SIVVA  + +GSSLYMYG   +PK + +  QQ K
Sbjct  124  SFKFLRISLPPGAGHPVAVSFSDDGLSIVVASQSLTGSSLYMYGGVEKPKPSEEARQQPK  183

Query  653  LPLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPLPE+KW HHK HD+  +LTL  T A+YGTADGS
Sbjct  184  LPLPEVKWGHHKAHDKLGILTLSGTTASYGTADGS  218



>ref|XP_009588354.1| PREDICTED: transducin beta-like protein 2 [Nicotiana tomentosiformis]
Length=381

 Score =   151 bits (381),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLPAGGH +AVAFADE SS+VVAC AFSGSSLYMYGE K A   ++Q KLPLP
Sbjct  70   SFKFLRINLPAGGHPTAVAFADEASSVVVACDAFSGSSLYMYGEEKTAATDSKQAKLPLP  129

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            E+KWE HK+HD+RA+LT+  TKATYG+ADGS
Sbjct  130  EIKWEQHKVHDKRAILTVVGTKATYGSADGS  160


 Score = 97.1 bits (240),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  333  NKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKALSF  497
            NKRHHPLDLNTLKGHGD VTG+CFS +  SLATAC DG+VRVFKLDDA+SK+  F
Sbjct  19   NKRHHPLDLNTLKGHGDIVTGVCFSPNAQSLATACGDGVVRVFKLDDASSKSFKF  73



>ref|XP_004306923.1| PREDICTED: transducin beta-like protein 2 [Fragaria vesca subsp. 
vesca]
Length=435

 Score =   134 bits (336),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 8/135 (6%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD ++P+A +SV++GA+IA   FG+YFR R SEV+SIS+ + +   +K    P       
Sbjct  1    MDPVLPLAALSVLIGAVIALAFFGSYFRKRSSEVQSISQPELLSDQKKQPAKP-------  53

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
             +  K         A+DKD NK+HHPLD+NTLKGH DSV G+CFS DG SLATACADGI+
Sbjct  54   -SQHKKSHAKPHSHASDKDHNKKHHPLDVNTLKGHADSVDGLCFSPDGRSLATACADGII  112

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  113  RVFKLDDASSKSFKF  127


 Score =   114 bits (285),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYG---EPKAATDGTQQTKL  655
            SFKFL+I+ P GG   AV+F+D+ SS+VVA    +G+SLYMYG   +PK + +  Q  K+
Sbjct  124  SFKFLKISTPVGGPPVAVSFSDDASSLVVASQNLTGASLYMYGGVEKPKVSNESGQPAKV  183

Query  656  PLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PLPE+KWE HKIH++  +LTLF TKA+YGTADGS
Sbjct  184  PLPEIKWEQHKIHEKLGILTLFGTKASYGTADGS  217



>ref|XP_010277354.1| PREDICTED: transducin beta-like protein 2 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   130 bits (326),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMY--GEPKAATDGTQQTKLP  658
            SFKFLRINLP G H +AV F++  SS+VVA    SGSSLYMY  G  K A++  QQ+KLP
Sbjct  135  SFKFLRINLPVGSHPTAVVFSNGASSLVVAAQTLSGSSLYMYEEGNVKTASETKQQSKLP  194

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHK+HD+RA+LTL  T ATYGTADGS
Sbjct  195  LPEIKWEHHKVHDKRAILTLVGTSATYGTADGS  227


 Score =   115 bits (289),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 97/136 (71%), Gaps = 14/136 (10%)
 Frame = +3

Query  99   AIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPN--QKPS-PTPRhsqqs  269
            +++P++I+S++LG ++  L FG+YF+ ++SEV++I+K    +PN  QKPS PT       
Sbjct  14   SVLPISILSIVLGGLLVLLFFGDYFKRKRSEVQTIAKP---EPNAAQKPSKPT-------  63

Query  270  hhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGI  449
                 K         A +KD +KRHHPLD+NTLKGHGDSVTG+CFSSDG +LAT CADG+
Sbjct  64   -QPISKKLHSKSHSHATEKDQSKRHHPLDVNTLKGHGDSVTGLCFSSDGRNLATVCADGV  122

Query  450  VRVFKLDDATSKALSF  497
            VRVFKLDDA+SK+  F
Sbjct  123  VRVFKLDDASSKSFKF  138



>ref|XP_010277353.1| PREDICTED: transducin beta-like protein 2 isoform X1 [Nelumbo 
nucifera]
Length=450

 Score =   130 bits (326),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMY--GEPKAATDGTQQTKLP  658
            SFKFLRINLP G H +AV F++  SS+VVA    SGSSLYMY  G  K A++  QQ+KLP
Sbjct  137  SFKFLRINLPVGSHPTAVVFSNGASSLVVAAQTLSGSSLYMYEEGNVKTASETKQQSKLP  196

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHK+HD+RA+LTL  T ATYGTADGS
Sbjct  197  LPEIKWEHHKVHDKRAILTLVGTSATYGTADGS  229


 Score =   115 bits (288),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 96/136 (71%), Gaps = 12/136 (9%)
 Frame = +3

Query  99   AIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPN--QKPS-PTPRhsqqs  269
            +++P++I+S++LG ++  L FG+YF+ ++SEV++I+K    +PN  QKPS PT       
Sbjct  14   SVLPISILSIVLGGLLVLLFFGDYFKRKRSEVQTIAKP---EPNAAQKPSKPT------Q  64

Query  270  hhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGI  449
              + K             +D +KRHHPLD+NTLKGHGDSVTG+CFSSDG +LAT CADG+
Sbjct  65   PISKKLHSKSHSHATEKFQDQSKRHHPLDVNTLKGHGDSVTGLCFSSDGRNLATVCADGV  124

Query  450  VRVFKLDDATSKALSF  497
            VRVFKLDDA+SK+  F
Sbjct  125  VRVFKLDDASSKSFKF  140



>ref|XP_010277355.1| PREDICTED: transducin beta-like protein 2 isoform X3 [Nelumbo 
nucifera]
Length=442

 Score =   130 bits (326),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMY--GEPKAATDGTQQTKLP  658
            SFKFLRINLP G H +AV F++  SS+VVA    SGSSLYMY  G  K A++  QQ+KLP
Sbjct  137  SFKFLRINLPVGSHPTAVVFSNGASSLVVAAQTLSGSSLYMYEEGNVKTASETKQQSKLP  196

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEHHK+HD+RA+LTL  T ATYGTADGS
Sbjct  197  LPEIKWEHHKVHDKRAILTLVGTSATYGTADGS  229


 Score =   115 bits (288),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 96/136 (71%), Gaps = 12/136 (9%)
 Frame = +3

Query  99   AIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPN--QKPS-PTPRhsqqs  269
            +++P++I+S++LG ++  L FG+YF+ ++SEV++I+K    +PN  QKPS PT       
Sbjct  14   SVLPISILSIVLGGLLVLLFFGDYFKRKRSEVQTIAKP---EPNAAQKPSKPT------Q  64

Query  270  hhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGI  449
              + K             +D +KRHHPLD+NTLKGHGDSVTG+CFSSDG +LAT CADG+
Sbjct  65   PISKKLHSKSHSHATEKFQDQSKRHHPLDVNTLKGHGDSVTGLCFSSDGRNLATVCADGV  124

Query  450  VRVFKLDDATSKALSF  497
            VRVFKLDDA+SK+  F
Sbjct  125  VRVFKLDDASSKSFKF  140



>ref|XP_008364463.1| PREDICTED: transducin beta-like protein 2 [Malus domestica]
Length=419

 Score =   133 bits (335),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 90/139 (65%), Gaps = 22/139 (16%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISK----ADAVQPNQKPSPTPRhs  260
            MD ++PVA++S+++GA+IA   F +YFR R SE++SISK    +D  +   KP  T +  
Sbjct  1    MDPVLPVAVLSILVGAVIALAFFTSYFRKRSSEIQSISKPELQSDPKKHQSKPHQTKKSH  60

Query  261  qqshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACA  440
                                    +K+HHPLD+NTLKGHGD+V G+CFSSDG SLATACA
Sbjct  61   ASDKDQ------------------HKKHHPLDVNTLKGHGDAVNGLCFSSDGRSLATACA  102

Query  441  DGIVRVFKLDDATSKALSF  497
            DG++RVFKLDDA+SK+  F
Sbjct  103  DGVLRVFKLDDASSKSFKF  121


 Score =   110 bits (275),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 4/95 (4%)
 Frame = +2

Query  485  SFKFLRINLPAG-GHTSAVAFADEKSSIVVACPAFSGSSLYMYG---EPKAATDGTQQTK  652
            SFKFLR++LP G G   AV+F+D+  SIVVA  + +GSSLYMYG   +PK + +  QQ K
Sbjct  118  SFKFLRVSLPPGAGQPVAVSFSDDGLSIVVASQSLTGSSLYMYGGVEKPKPSEEAKQQPK  177

Query  653  LPLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            L LPE+KW+HHK+HD+  +LTL  T A+YGTADGS
Sbjct  178  LSLPEVKWDHHKVHDKLGILTLSGTTASYGTADGS  212



>gb|KHG09050.1| Transducin beta-like protein 2 [Gossypium arboreum]
 gb|KHG10142.1| Transducin beta-like protein 2 [Gossypium arboreum]
Length=426

 Score =   130 bits (328),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEP---KAATDGTQQTKL  655
            SFKFLRIN+P GGH  AVAFAD+ SSIVVA    +G SLYMYGE    K +TD  QQ+KL
Sbjct  124  SFKFLRINVPLGGHAVAVAFADDSSSIVVASQTLTGCSLYMYGEENPKKGSTDSNQQSKL  183

Query  656  PLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            PLP++KWEHHKIHD++A+LTL    A+YGT DGS
Sbjct  184  PLPQVKWEHHKIHDKQAILTLTGATASYGTGDGS  217


 Score =   111 bits (278),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 8/135 (6%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqsh  272
            MD I+  A +S +LGA+IAF+ F +Y   ++S V++IS+ + + P+ K +  P+H  + +
Sbjct  1    MDPILAAAALSAVLGAVIAFVFFKSYILKQRSNVQAISEPE-LHPDPKKTSKPQHVPKKY  59

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
            H+   SH+            +KRHHPLDLNTLKGH DSVTG+CFSSDG +LATACADG+V
Sbjct  60   HSKPHSHASDKDQ-------SKRHHPLDLNTLKGHADSVTGMCFSSDGRNLATACADGVV  112

Query  453  RVFKLDDATSKALSF  497
            RVFKLDDA+SK+  F
Sbjct  113  RVFKLDDASSKSFKF  127



>ref|XP_006851845.1| PREDICTED: transducin beta-like protein 2 [Amborella trichopoda]
 gb|ERN13312.1| hypothetical protein AMTR_s00041p00081370 [Amborella trichopoda]
Length=448

 Score =   120 bits (302),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAAT-DGT-QQTKLP  658
            SFK L++NLP GGH +AVAF ++ SS VVA    SGS+LYMYGE    T +GT QQ KLP
Sbjct  135  SFKSLKVNLPTGGHPTAVAFCEDASSFVVAAQTISGSALYMYGEANTKTENGTKQQPKLP  194

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+ WEHHK+HDQRA+LTL    A+YGT DGS
Sbjct  195  LPEINWEHHKVHDQRAILTLSGATASYGTGDGS  227


 Score =   120 bits (301),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 7/130 (5%)
 Frame = +3

Query  102  IVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqshhts  281
            +VP++I+S I+G ++    F +Y+R R++EV+ I++      N+KP        + H  S
Sbjct  14   LVPLSIISAIVGGLLVLFIFSDYYRRRRNEVKFIAQISPETSNRKP-------LKPHIQS  66

Query  282  kkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVF  461
             K        +AADKD +KRHHPLD+NTLKGHGDSV G+CFS DG SLATACADG+VRVF
Sbjct  67   SKKSHAKPQSSAADKDHHKRHHPLDVNTLKGHGDSVPGLCFSRDGRSLATACADGVVRVF  126

Query  462  KLDDATSKAL  491
            KLDDA+SK+ 
Sbjct  127  KLDDASSKSF  136



>ref|XP_009382011.1| PREDICTED: transducin beta-like protein 2 [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   126 bits (316),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLR+NLPAG H +A+AF++  SS+VVA    SGSSL+MYG+  PK + +G QQ KLP
Sbjct  136  SFKFLRLNLPAGAHPTAIAFSEGSSSVVVAAQMLSGSSLFMYGDVGPKPSAEGKQQAKLP  195

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEH KIHDQ +VL L +  ATYGTADGS
Sbjct  196  LPEIKWEHQKIHDQGSVLNLSAVPATYGTADGS  228


 Score =   112 bits (280),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqshhtskks  290
            V ++S I+G ++  L F +YFR +++E+ +I+ A + Q      P P  S  +  + K  
Sbjct  11   VPLLSTIVGGVLILLFFADYFRRKRAEISTIAAAQSPQQPDATKPPPSSSSSAVASKKTH  70

Query  291  hskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLD  470
              + HSH+A DKD N++HH LD+NTLKGHGDSVT ICFSSDG SLATACADG +RVF+LD
Sbjct  71   RQRHHSHSATDKDQNRKHHHLDVNTLKGHGDSVTAICFSSDGHSLATACADGAIRVFRLD  130

Query  471  DATSKALSF  497
            DA+SK+  F
Sbjct  131  DASSKSFKF  139



>gb|EPS67113.1| hypothetical protein M569_07661, partial [Genlisea aurea]
Length=426

 Score =   119 bits (298),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 82/131 (63%), Gaps = 11/131 (8%)
 Frame = +3

Query  108  PVAIVSVILGAIIAFLAFGNYFRNRKSEVESIS-KADAVQPNQKPSPTPRhsqqshhtsk  284
            P+ + S I+GA+IAF  FG Y  NRKSE++SI+ K   V+   K  P P           
Sbjct  1    PIVVFSAIVGALIAFCFFGIYLGNRKSEIQSITGKPPTVELISKSGPKP----------S  50

Query  285  kshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFK  464
                  H   +    ++K HHPLD+NTLKGHGDSV+G+CFS DG SLATAC DG+VRVF+
Sbjct  51   APKKSQHKSHSHSHAADKHHHPLDVNTLKGHGDSVSGLCFSPDGRSLATACGDGVVRVFR  110

Query  465  LDDATSKALSF  497
            LDD +SK+  F
Sbjct  111  LDDVSSKSFKF  121


 Score =   117 bits (294),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGTQQTKLPLP  664
            SFKFLRINLP G    AV+F+D+ S IVVA    SGSSL+MYGE K  +  T   KLPLP
Sbjct  118  SFKFLRINLPGGHQPVAVSFSDDDSCIVVASQTLSGSSLFMYGEEKPKS-STGDAKLPLP  176

Query  665  EMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            ++KWEHHK+HD++A+LTL  +K+TYG+ DGS
Sbjct  177  QIKWEHHKVHDKKAILTLIGSKSTYGSGDGS  207



>ref|XP_006339768.1| PREDICTED: transducin beta-like protein 2-like, partial [Solanum 
tuberosum]
Length=376

 Score =   137 bits (346),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 76/93 (82%), Gaps = 3/93 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKFLRINLPAGGH  AVA ADE SS+ VAC A  GSSLYMYGE  PKA  D ++Q KLP
Sbjct  64   SFKFLRINLPAGGHPIAVAVADEASSVAVACHALFGSSLYMYGEEKPKADAD-SKQAKLP  122

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LP++KWE HK+HD+RA+LTL  TKATYGTADGS
Sbjct  123  LPQIKWEQHKVHDKRAILTLVGTKATYGTADGS  155


 Score = 95.1 bits (235),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  333  NKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKALSF  497
            NKRHHPLDLNTLKGHGD VTG+CF  +  SLATACADG+VR+FKLDDA SK+  F
Sbjct  13   NKRHHPLDLNTLKGHGDIVTGVCFLPNAQSLATACADGVVRIFKLDDALSKSFKF  67



>gb|KEH23318.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=432

 Score =   118 bits (296),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 3/93 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE--PKAATDGTQQTKLP  658
            SFKF RINLP GG  +AVAFAD+ SSIVV+  + +G SLYMYGE  PK + D +Q  KLP
Sbjct  124  SFKFHRINLPPGGPPTAVAFADDASSIVVSSHSLTGCSLYMYGEEKPKVSEDKSQ-AKLP  182

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEH ++HD++A++T+F   ATYG+ADGS
Sbjct  183  LPEIKWEHRQVHDKKAIITMFGASATYGSADGS  215


 Score =   112 bits (279),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 90/141 (64%), Gaps = 20/141 (14%)
 Frame = +3

Query  93   MDAIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESISK------ADAVQPNQKPSPTPR  254
            MD + P+   S++LGAIIA L F  Y+R R+SEV SI+        + + P+ KP P  +
Sbjct  1    MDELFPIVAFSLLLGAIIALLFFNTYYRKRQSEVRSIANLNPNPNPNPIVPSSKPLPNKK  60

Query  255  hsqqshhtskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATA  434
             + + H + K                 KRHHPLDLNTLKGHGD+VTGICFS DG +LATA
Sbjct  61   SNPKHHSSDKDQI--------------KRHHPLDLNTLKGHGDAVTGICFSPDGRNLATA  106

Query  435  CADGIVRVFKLDDATSKALSF  497
            CADG+VRVFKL+DA+SK+  F
Sbjct  107  CADGVVRVFKLEDASSKSFKF  127



>ref|XP_010918319.1| PREDICTED: transducin beta-like protein 2 [Elaeis guineensis]
Length=450

 Score =   116 bits (291),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK LRINLPAG H +A+AF++E SS+VVA    SG+SLYMYG+  A  +G   QQ KLP
Sbjct  137  SFKLLRINLPAGAHPTAIAFSEEASSVVVAAQLLSGASLYMYGDVFAKPNGESKQQAKLP  196

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEH KIH + +VLTL    ATYG+ DGS
Sbjct  197  LPEIKWEHQKIHHKSSVLTLVGVCATYGSGDGS  229


 Score =   110 bits (275),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESISKA----DAVQPNQKPSPTPRhsqqshht  278
            V ++S I+G ++A L F +YFR +++EV  I+ A     +   ++ P P P        +
Sbjct  16   VPLLSAIVGGVLALLLFADYFRRKRAEVAMIAPAAVPDRSAADHKAPKPAP--------S  67

Query  279  skkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRV  458
            + K           DKD NK+HH LD+NTLKGHGD+VT +CFSSDG +LATACADG+VRV
Sbjct  68   AAKKSHPRSHSHHTDKDQNKKHHALDVNTLKGHGDAVTALCFSSDGRNLATACADGVVRV  127

Query  459  FKLDDATSKALSF  497
            F++DDA+SK+   
Sbjct  128  FRIDDASSKSFKL  140



>ref|XP_008798526.1| PREDICTED: transducin beta-like protein 2 isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   119 bits (299),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK LRINLPAG H +A+AF++E SS+VVA    SG+SLYMYG+  A  +G   QQ KLP
Sbjct  138  SFKLLRINLPAGAHPTAIAFSEEASSVVVAAQLLSGASLYMYGDVFAKPNGESKQQAKLP  197

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEH KIHD+ +VLTL    ATYG  DGS
Sbjct  198  LPEIKWEHQKIHDKSSVLTLVGVCATYGNGDGS  230


 Score = 99.0 bits (245),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 82/129 (64%), Gaps = 3/129 (2%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPTPRhsqqshhtskks  290
            V ++S I+G ++A L F +YFR RK    +   A A  P++  S     + +   ++ K 
Sbjct  16   VPLLSAIVGGVLALLLFADYFR-RKRAEVATIAAAAAAPDR--STADHKAPKPALSAAKK  72

Query  291  hskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLD  470
                      +KD NK+HH LD+NTLKGHGD+VT +CFSS+G +LATACADG+VRVF++D
Sbjct  73   SQPRSLSHHTNKDQNKKHHALDVNTLKGHGDAVTALCFSSNGRNLATACADGVVRVFRID  132

Query  471  DATSKALSF  497
            DA+SK+   
Sbjct  133  DASSKSFKL  141



>ref|XP_008798525.1| PREDICTED: transducin beta-like protein 2 isoform X1 [Phoenix 
dactylifera]
Length=454

 Score =   119 bits (299),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK LRINLPAG H +A+AF++E SS+VVA    SG+SLYMYG+  A  +G   QQ KLP
Sbjct  141  SFKLLRINLPAGAHPTAIAFSEEASSVVVAAQLLSGASLYMYGDVFAKPNGESKQQAKLP  200

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            LPE+KWEH KIHD+ +VLTL    ATYG  DGS
Sbjct  201  LPEIKWEHQKIHDKSSVLTLVGVCATYGNGDGS  233


 Score = 98.6 bits (244),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 83/133 (62%), Gaps = 8/133 (6%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQK----PSPTPRhsqqshht  278
            V ++S I+G ++A L F +YFR RK    +   A A  P++      +P P     S   
Sbjct  16   VPLLSAIVGGVLALLLFADYFR-RKRAEVATIAAAAAAPDRSTADHKAPKP---ALSAAK  71

Query  279  skkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRV  458
              +  S SH      +D NK+HH LD+NTLKGHGD+VT +CFSS+G +LATACADG+VRV
Sbjct  72   KSQPRSLSHHTNKKFQDQNKKHHALDVNTLKGHGDAVTALCFSSNGRNLATACADGVVRV  131

Query  459  FKLDDATSKALSF  497
            F++DDA+SK+   
Sbjct  132  FRIDDASSKSFKL  144



>gb|EAY92666.1| hypothetical protein OsI_14418 [Oryza sativa Indica Group]
Length=448

 Score =   105 bits (261),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK LRINLPAG H +A+AF+   SS+VVA  A  GSSLYMY +  A   G   QQ KL 
Sbjct  135  SFKILRINLPAGAHPTAIAFSQGASSVVVAAQALLGSSLYMYADVGAPPAGGNKQQGKLS  194

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KWEH KIH + +VL L + +ATYGT DGS
Sbjct  195  PPEIKWEHRKIHGKESVLNLAAARATYGTGDGS  227


 Score = 86.3 bits (212),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 76/132 (58%), Gaps = 7/132 (5%)
 Frame = +3

Query  99   AIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESIS-KADAVQPNQKPSPTPRhsqqshh  275
            ++V + ++S I GA IA L    Y R +++ +  +   A A  P+Q     P +  Q   
Sbjct  11   SLVSLPLLSAIFGAAIALLFLSGYLRRKRAAIAHLPPSATAAAPDQPKQVRPSNQNQPKK  70

Query  276  tskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVR  455
              ++SH      AA      K+HH LD+NTL+GH DSVT + FS D C+LAT CADG VR
Sbjct  71   GHQRSHHAVDKDAA------KKHHHLDVNTLRGHTDSVTALHFSDDACNLATVCADGAVR  124

Query  456  VFKLDDATSKAL  491
            VF++DD +SK+ 
Sbjct  125  VFRVDDVSSKSF  136



>ref|NP_001051961.1| Os03g0858400 [Oryza sativa Japonica Group]
 gb|AAP21400.1| putative WD repeat protein [Oryza sativa Japonica Group]
 gb|ABG00002.1| WD domains, G-beta repeats containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13875.1| Os03g0858400 [Oryza sativa Japonica Group]
 gb|EAZ29371.1| hypothetical protein OsJ_13442 [Oryza sativa Japonica Group]
 dbj|BAG95809.1| unnamed protein product [Oryza sativa Japonica Group]
Length=444

 Score =   105 bits (261),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK LRINLPAG H +A+AF+   SS+VVA  A  GSSLYMY +  A   G   QQ KL 
Sbjct  131  SFKILRINLPAGAHPTAIAFSQGASSVVVAAQALLGSSLYMYADVGAPPAGGNKQQGKLS  190

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KWEH KIH + +VL L + +ATYGT DGS
Sbjct  191  PPEIKWEHRKIHGKESVLNLAAARATYGTGDGS  223


 Score = 86.3 bits (212),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 76/132 (58%), Gaps = 7/132 (5%)
 Frame = +3

Query  99   AIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESIS-KADAVQPNQKPSPTPRhsqqshh  275
            ++V + ++S I GA IA L    Y R +++ +  +   A A  P+Q     P +  Q   
Sbjct  7    SLVSLPLLSAIFGAAIALLFLSGYLRRKRAAIAHLPPSATAAAPDQPKQVRPSNQNQPKK  66

Query  276  tskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVR  455
              ++SH      AA      K+HH LD+NTL+GH DSVT + FS D C+LAT CADG VR
Sbjct  67   GHQRSHHAVDKDAA------KKHHHLDVNTLRGHTDSVTALHFSDDACNLATVCADGAVR  120

Query  456  VFKLDDATSKAL  491
            VF++DD +SK+ 
Sbjct  121  VFRVDDVSSKSF  132



>dbj|BAJ98066.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score = 99.8 bits (247),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK L+INLPAG H +A+A+++  SS+VVA  A  GSSLYMY +  A   G   QQ KL 
Sbjct  132  SFKILKINLPAGAHPTAIAYSEGASSVVVAAQALLGSSLYMYADVGAPPTGGNKQQGKLS  191

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW+H KIH + +VL L + +AT+GT DGS
Sbjct  192  PPEIKWDHKKIHGKESVLNLAAARATHGTGDGS  224


 Score = 89.4 bits (220),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESI-SKADAVQPNQKPSPTPRhsqqshhtskk  287
            V I+SV+LG  +AF+    Y R +++++  +   A A  P+      P    +       
Sbjct  12   VPILSVLLGGAVAFVFLAGYLRRKRADIAHVPPSAVAAAPDLPKQVRPAAQNKKGRPQHH  71

Query  288  shskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKL  467
              S +   AA      K+HH LDLNTL+GH D VT + FSSD C+LAT CADG+VRVF++
Sbjct  72   HASAADKEAA------KKHHHLDLNTLRGHTDCVTALDFSSDACNLATVCADGVVRVFRI  125

Query  468  DDATSKALSF  497
            DDA+SK+   
Sbjct  126  DDASSKSFKI  135



>gb|AIN39802.1| hypothetical protein [Zoysia matrella]
Length=253

 Score =   100 bits (248),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 63/95 (66%), Gaps = 6/95 (6%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGE----PKAATDGTQQTK  652
            SFK LRINLPAG H +AVAF++  SS+VVA  A  GSSLYMY +    P AA    QQ K
Sbjct  131  SFKILRINLPAGAHPTAVAFSEGSSSVVVAAQALLGSSLYMYADVSAPPTAANK--QQGK  188

Query  653  LPLPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
            L  PE+KW H KIH + +VL L +  ATYG  DGS
Sbjct  189  LSPPEIKWSHSKIHGKESVLNLAAACATYGCGDGS  223


 Score = 86.7 bits (213),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 72/126 (57%), Gaps = 8/126 (6%)
 Frame = +3

Query  117  IVSVILGAIIAFLAFGNYFRNRKSEVESIS-KADAVQPNQKPSPTPRhsqqshhtskksh  293
            +VS +LG  IA L    Y R +++ +  I   A A  P++     P +  +     +  H
Sbjct  14   LVSAVLGGAIAILFLAGYLRRKRAAIAHIPPSATAAAPSKPKHVRPSNQTKKGSLRQHHH  73

Query  294  skshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDD  473
            +     A       K+HH LD+NTL+GH DSVT + FS+DGC+LAT CADG VR+F++DD
Sbjct  74   AADKDAA-------KKHHHLDVNTLRGHTDSVTALHFSNDGCNLATVCADGAVRIFRIDD  126

Query  474  ATSKAL  491
             +SK+ 
Sbjct  127  TSSKSF  132



>ref|XP_004980970.1| PREDICTED: transducin beta-like protein 2-like isoform X2 [Setaria 
italica]
Length=561

 Score = 98.6 bits (244),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFK LRINLPAG H + VAF++  SS+VVA  A  GSSLYMY +  A       QQ KL 
Sbjct  248  SFKILRINLPAGAHPTGVAFSEGSSSVVVAAQALLGSSLYMYADVSAPPTAQNKQQGKLS  307

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW H KIH + +VL L + +AT+G  DGS
Sbjct  308  PPEIKWSHQKIHGKESVLNLAAARATHGPGDGS  340


 Score = 85.9 bits (211),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 6/132 (5%)
 Frame = +3

Query  99   AIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESIS-KADAVQPNQKPSPTPRhsqqshh  275
            +++   ++S +LG  IA +    Y R +++ +  I   A A  P+Q     P+H + S+ 
Sbjct  123  SLLTAPLISAVLGGAIALVFLAGYLRRKRAAIAHIPPSATAAAPDQ-----PKHVRPSNQ  177

Query  276  tskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVR  455
               K       H AADKD+ K+HH LD+NTL+GH DSVT + FS+DG +LAT CADG VR
Sbjct  178  AHHKKGHARPHHNAADKDAAKKHHHLDVNTLRGHTDSVTALHFSNDGANLATVCADGAVR  237

Query  456  VFKLDDATSKAL  491
            VF++DD +SK+ 
Sbjct  238  VFRIDDTSSKSF  249



>ref|XP_004980969.1| PREDICTED: transducin beta-like protein 2-like isoform X1 [Setaria 
italica]
Length=578

 Score = 98.6 bits (244),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFK LRINLPAG H + VAF++  SS+VVA  A  GSSLYMY +  A       QQ KL 
Sbjct  248  SFKILRINLPAGAHPTGVAFSEGSSSVVVAAQALLGSSLYMYADVSAPPTAQNKQQGKLS  307

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW H KIH + +VL L + +AT+G  DGS
Sbjct  308  PPEIKWSHQKIHGKESVLNLAAARATHGPGDGS  340


 Score = 85.5 bits (210),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 6/132 (5%)
 Frame = +3

Query  99   AIVPVAIVSVILGAIIAFLAFGNYFRNRKSEVESIS-KADAVQPNQKPSPTPRhsqqshh  275
            +++   ++S +LG  IA +    Y R +++ +  I   A A  P+Q     P+H + S+ 
Sbjct  123  SLLTAPLISAVLGGAIALVFLAGYLRRKRAAIAHIPPSATAAAPDQ-----PKHVRPSNQ  177

Query  276  tskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVR  455
               K       H AADKD+ K+HH LD+NTL+GH DSVT + FS+DG +LAT CADG VR
Sbjct  178  AHHKKGHARPHHNAADKDAAKKHHHLDVNTLRGHTDSVTALHFSNDGANLATVCADGAVR  237

Query  456  VFKLDDATSKAL  491
            VF++DD +SK+ 
Sbjct  238  VFRIDDTSSKSF  249



>ref|NP_001168942.1| uncharacterized protein LOC100382756 [Zea mays]
 gb|ACN31128.1| unknown [Zea mays]
 tpg|DAA52593.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_637388, 
partial [Zea mays]
Length=334

 Score = 95.9 bits (237),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFK LRINLPAG H +AV F++  SS+VVA  A  GSSLYMY +  A    +   Q KL 
Sbjct  132  SFKILRINLPAGAHPTAVTFSEGSSSVVVAAQALLGSSLYMYADVSAPPTAENKLQGKLS  191

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW H KIH + +VL L + +AT+G+ DGS
Sbjct  192  PPEIKWSHPKIHGKESVLNLAAARATHGSGDGS  224


 Score = 87.8 bits (216),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESISKAD-AVQPNQKPSPTPRhsqqshhtskk  287
            V +VS +LGA IA +    Y R +++ +  I   + A  P+Q     P+H + S+    K
Sbjct  11   VPLVSAVLGAAIALVFLAGYLRRKRAAIAHIPPTETAAAPDQ-----PKHVRPSNQAQYK  65

Query  288  shskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKL  467
                   H AADKD+ K+HH LD+NTL+GH DSVT + FS+D C+L T CADG +RVF++
Sbjct  66   KGHLRPHHHAADKDAAKKHHHLDVNTLRGHTDSVTALAFSNDACNLVTVCADGAIRVFRI  125

Query  468  DDATSKAL  491
            DD +SK+ 
Sbjct  126  DDTSSKSF  133



>ref|XP_008644215.1| PREDICTED: uncharacterized protein LOC100382756 isoform X1 [Zea 
mays]
 gb|ACN30939.1| unknown [Zea mays]
 tpg|DAA52594.1| TPA: hypothetical protein ZEAMMB73_637388 [Zea mays]
 tpg|DAA52595.1| TPA: hypothetical protein ZEAMMB73_637388 [Zea mays]
Length=445

 Score = 95.9 bits (237),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFK LRINLPAG H +AV F++  SS+VVA  A  GSSLYMY +  A    +   Q KL 
Sbjct  132  SFKILRINLPAGAHPTAVTFSEGSSSVVVAAQALLGSSLYMYADVSAPPTAENKLQGKLS  191

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW H KIH + +VL L + +AT+G+ DGS
Sbjct  192  PPEIKWSHPKIHGKESVLNLAAARATHGSGDGS  224


 Score = 87.4 bits (215),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESISKAD-AVQPNQKPSPTPRhsqqshhtskk  287
            V +VS +LGA IA +    Y R +++ +  I   + A  P+Q     P+H + S+    K
Sbjct  11   VPLVSAVLGAAIALVFLAGYLRRKRAAIAHIPPTETAAAPDQ-----PKHVRPSNQAQYK  65

Query  288  shskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKL  467
                   H AADKD+ K+HH LD+NTL+GH DSVT + FS+D C+L T CADG +RVF++
Sbjct  66   KGHLRPHHHAADKDAAKKHHHLDVNTLRGHTDSVTALAFSNDACNLVTVCADGAIRVFRI  125

Query  468  DDATSKAL  491
            DD +SK+ 
Sbjct  126  DDTSSKSF  133



>ref|XP_002466059.1| hypothetical protein SORBIDRAFT_01g000460 [Sorghum bicolor]
 gb|EER93057.1| hypothetical protein SORBIDRAFT_01g000460 [Sorghum bicolor]
Length=445

 Score = 99.4 bits (246),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFK LRINLPAG H +AVAF++  SS+VVA  A  GSSLYMY +  A    +  QQ KL 
Sbjct  132  SFKILRINLPAGAHPTAVAFSEGSSSVVVAAQALLGSSLYMYADVSAPPTAENKQQGKLS  191

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW H KIH + +VL + + +AT+G+ DGS
Sbjct  192  PPEIKWSHPKIHGKESVLNVAAARATHGSGDGS  224


 Score = 83.2 bits (204),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 78/130 (60%), Gaps = 6/130 (5%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESIS-KADAVQPNQKPSPTPRhsqqshhtskk  287
            V +VS +LGA IA +    Y   +++ +  I   A A  P+Q     P+H + S+    K
Sbjct  11   VPLVSAVLGAAIALVFLAGYLSRKRAAIAHIPPTATAAAPDQ-----PKHVRPSNQAQNK  65

Query  288  shskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKL  467
                   H AADKD+ K+HH LD+NTL+GH DSVT + FS+D  +LAT CADG +RVF++
Sbjct  66   KGHLRAHHHAADKDAAKKHHHLDVNTLRGHTDSVTALAFSNDAGNLATVCADGAIRVFRI  125

Query  468  DDATSKALSF  497
            DD +SK+   
Sbjct  126  DDTSSKSFKI  135



>gb|EMT23631.1| hypothetical protein F775_32619 [Aegilops tauschii]
Length=217

 Score =   100 bits (249),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK L+INLPAG H +A+A+++  SS+VVA  A  GSSLYMY +  A   G   QQ KL 
Sbjct  110  SFKILKINLPAGAHPTAIAYSEGSSSVVVAAQALLGSSLYMYADVGAPPTGGNKQQGKLS  169

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW+H KIH + +VL L + +AT+GT DGS
Sbjct  170  PPEIKWDHKKIHGKESVLNLAAARATHGTGDGS  202


 Score = 78.6 bits (192),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  333  NKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKAL  491
             K+HH LD+NTL+GH D VT + FSSD C+LAT CADG+VRVF++DDA+SK+ 
Sbjct  59   GKKHHHLDVNTLRGHTDCVTALDFSSDACNLATVCADGVVRVFRIDDASSKSF  111



>gb|EMS57814.1| Transducin beta-like protein 2 [Triticum urartu]
Length=407

 Score = 99.4 bits (246),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK L+INLPAG H +A+A+++  SS+VVA  A  GSSLYMY +  A   G   QQ KL 
Sbjct  93   SFKILKINLPAGAHPTAIAYSEGSSSVVVAAQALLGSSLYMYADVGAPPTGGNKQQGKLS  152

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW+H KIH + +VL L + +AT+GT DGS
Sbjct  153  PPEIKWDHKKIHGKESVLNLAAARATHGTGDGS  185


 Score = 78.2 bits (191),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  336  KRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKAL  491
            K+HH LD+NTL+GH D VT + FS+D C+LAT CADG+VRVF++DDA+SK+ 
Sbjct  43   KKHHHLDVNTLRGHTDCVTALDFSTDACNLATVCADGVVRVFRIDDASSKSF  94



>ref|XP_006652047.1| PREDICTED: transducin beta-like protein 2-like, partial [Oryza 
brachyantha]
Length=397

 Score =   105 bits (262),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDG--TQQTKLP  658
            SFK LRINLPAG H +A+AF++  SS+VVA  A  GSSLYMY +  A   G   QQ KL 
Sbjct  84   SFKILRINLPAGAHPTAIAFSEGASSVVVAAQALLGSSLYMYADVGAPPAGGSKQQGKLS  143

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KWEHHKIH + +VL L + +ATYGT D S
Sbjct  144  PPEIKWEHHKIHGKESVLNLAAARATYGTGDRS  176


 Score = 70.9 bits (172),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  342  HHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKALSF  497
             H L +NTL+GH DSVT + FS DGC+LATACADG VRVF++DD +SK+   
Sbjct  36   QHHLVVNTLRGHTDSVTTLHFSDDGCNLATACADGAVRVFRVDDVSSKSFKI  87



>ref|XP_003559005.1| PREDICTED: transducin beta-like protein 2 [Brachypodium distachyon]
Length=447

 Score =   102 bits (253),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEKSSIVVACPAFSGSSLYMYGEPKA--ATDGTQQTKLP  658
            SFK LRINLPAG H +A+AF++  SS+VVA  A  GSSLYMY +  A       QQ KL 
Sbjct  134  SFKILRINLPAGAHPTAIAFSEGSSSVVVAAQALLGSSLYMYADVSAPPTAGNKQQGKLS  193

Query  659  LPEMKWEHHKIHDQRAVLTLFSTKATYGTADGS  757
             PE+KW+H KIH + +VL L + +AT+GT DGS
Sbjct  194  PPEIKWDHKKIHGKESVLNLAAARATHGTGDGS  226


 Score = 70.1 bits (170),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 16/133 (12%)
 Frame = +3

Query  111  VAIVSVILGAIIAFLAFGNYFRNRKSEVESISKADAVQPNQKPSPT------PRhsqqsh  272
            V ++S +LG  +A +    Y R +++++  +           PS T      P+  + S+
Sbjct  13   VPLLSALLGGAVALVFLAGYLRRKRADIAHV----------PPSATAAAADLPKQVRLSN  62

Query  273  htskkshskshshaaadkdsNKRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIV  452
               K  H++ H HAAADKD+ K+HH  DLNTL+GH D VT + FSSDG +LAT CADG V
Sbjct  63   QHKKGGHARPHHHAAADKDAAKKHHHFDLNTLRGHTDGVTALDFSSDGSNLATVCADGAV  122

Query  453  RVFKLDDATSKAL  491
            RVF++DDA+SK+ 
Sbjct  123  RVFRIDDASSKSF  135



>ref|XP_002960338.1| hypothetical protein SELMODRAFT_73782, partial [Selaginella moellendorffii]
 gb|EFJ37877.1| hypothetical protein SELMODRAFT_73782, partial [Selaginella moellendorffii]
Length=356

 Score = 76.6 bits (187),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 4/94 (4%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADEK--SSIVVACPAFSGSSLYMYGEP--KAATDGTQQTK  652
            +   LR+N+P G   + VAF D +  + IVVA    +GS L M+G P  K A    +Q K
Sbjct  48   NLHVLRLNVPLGTVPTGVAFGDGQGAAQIVVATQDINGSGLLMFGAPEGKGAAQAREQGK  107

Query  653  LPLPEMKWEHHKIHDQRAVLTLFSTKATYGTADG  754
            +P PE+KW   +IHD+R VLT    +  YG+ DG
Sbjct  108  VPPPEIKWRKTQIHDRRNVLTCVGARCEYGSGDG  141


 Score = 68.2 bits (165),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  345  HPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKAL  491
            H L+LN +KGH D++TGI FSS+   LATACAD +VR+FKLDD TSK L
Sbjct  1    HRLELNAIKGHVDAITGIAFSSNSRGLATACADRVVRIFKLDDPTSKNL  49



>ref|XP_001778191.1| predicted protein [Physcomitrella patens]
 gb|EDQ56973.1| predicted protein [Physcomitrella patens]
Length=437

 Score = 75.5 bits (184),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  336  KRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKALSF  497
            +RHH L++N LKGH D+VTGI FSS+G  +A+ACAD ++RVFKLDD ++K+  F
Sbjct  76   QRHHHLEINMLKGHTDAVTGIAFSSNGRGIASACADRVIRVFKLDDISAKSFKF  129


 Score = 69.3 bits (168),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = +2

Query  485  SFKFLRINLPAGGHT-SAVAFADEKSSIVVACPAFSGSSLYMYGEPKAATDGT--QQTKL  655
            SFKFLR+NLP+G +  + + F    S +V+A    SG+ L MY    +       +Q K 
Sbjct  126  SFKFLRLNLPSGSNCPTKITFGHGSSQLVIATEGMSGTGLCMYSSASSEAATAAKEQGKP  185

Query  656  PLPEMKWEHHKIHDQRAVLTLFSTKATYGTADG  754
              PEMKWE   +HD++ +++L S+ AT+G+ +G
Sbjct  186  AQPEMKWELKNVHDKKGLVSLVSSPATFGSGNG  218



>ref|XP_002967374.1| hypothetical protein SELMODRAFT_86701, partial [Selaginella moellendorffii]
 gb|EFJ31973.1| hypothetical protein SELMODRAFT_86701, partial [Selaginella moellendorffii]
Length=356

 Score = 75.5 bits (184),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 4/94 (4%)
 Frame = +2

Query  485  SFKFLRINLPAGGHTSAVAFADE--KSSIVVACPAFSGSSLYMYGEP--KAATDGTQQTK  652
            +   LR+N+P G   + VAF D    + IVVA    +GS L M+G P  K A    +Q K
Sbjct  48   NLHVLRLNVPLGTVPTGVAFGDGPGAAQIVVATQDINGSGLLMFGAPEGKGAAQAREQGK  107

Query  653  LPLPEMKWEHHKIHDQRAVLTLFSTKATYGTADG  754
            +P PE+KW   +IHD+R VLT    +  YG+ DG
Sbjct  108  VPPPEIKWRKTQIHDRRNVLTCVGARCEYGSGDG  141


 Score = 68.2 bits (165),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  345  HPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKAL  491
            H L+LN +KGH D++TGI FSS+   LATACAD +VR+FKLDD TSK L
Sbjct  1    HRLELNAIKGHVDAITGIAFSSNSRGLATACADRVVRIFKLDDPTSKNL  49



>ref|XP_002502168.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63426.1| predicted protein [Micromonas sp. RCC299]
Length=505

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  336  KRHHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLD  470
            +++HPL +NTLKGH D+V  + FS +G ++ TAC D  VRVF+LD
Sbjct  134  EKNHPLHINTLKGHTDAVNMVSFSGNGSTVVTACDDATVRVFRLD  178



>gb|KIZ04798.1| Transducin beta-like protein 2 [Monoraphidium neglectum]
Length=514

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  342  HHPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKALSF  497
            HH L L TLKGH D++ G+ +S DG  LA+AC D  +RVF + D TSK   F
Sbjct  168  HHALFLTTLKGHADAINGVAWSPDGRLLASACDDLTLRVFDMHDVTSKDPKF  219



>ref|XP_002952513.1| hypothetical protein VOLCADRAFT_105565 [Volvox carteri f. nagariensis]
 gb|EFJ46360.1| hypothetical protein VOLCADRAFT_105565 [Volvox carteri f. nagariensis]
Length=476

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  345  HPLDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKALSF  497
            H L +NTLK H D+V G+ +S DG  LATAC D  +R+F + D +SK   F
Sbjct  112  HELWVNTLKDHADTVHGLAWSRDGQLLATACEDMTLRIFDMSDVSSKNPKF  162



>ref|XP_005851155.1| hypothetical protein CHLNCDRAFT_137766 [Chlorella variabilis]
 gb|EFN59053.1| hypothetical protein CHLNCDRAFT_137766 [Chlorella variabilis]
Length=439

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  351  LDLNTLKGHGDSVTGICFSSDGCSLATACADGIVRVFKLDDATSKALSF  497
            L +  LKGH   VTG+ +S DG +LATAC D  VR+F L D T+K++ F
Sbjct  103  LAIMGLKGHTAEVTGLSWSPDGTALATACDDRTVRIFNLADPTAKSIPF  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1469386858550