BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5253

Length=722
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616503.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       345   3e-112   Nicotiana tomentosiformis
ref|XP_009800688.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       344   2e-111   Nicotiana sylvestris
ref|XP_006492150.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    342   9e-111   Citrus sinensis [apfelsine]
ref|XP_006340914.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    339   1e-109   Solanum tuberosum [potatoes]
ref|XP_004247810.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       337   6e-109   Solanum lycopersicum
ref|XP_009599981.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    336   2e-108   Nicotiana tomentosiformis
ref|XP_007034509.1|  Heat shock protein 60 isoform 6                    332   2e-108   
ref|XP_006355738.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    335   3e-108   Solanum tuberosum [potatoes]
ref|XP_010264000.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       335   3e-108   Nelumbo nucifera [Indian lotus]
ref|XP_004239874.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       335   4e-108   Solanum lycopersicum
ref|XP_011091383.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       335   5e-108   Sesamum indicum [beniseed]
ref|XP_007034510.1|  Heat shock protein 60 isoform 7                    331   5e-108   
ref|XP_012085173.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    335   5e-108   Jatropha curcas
gb|EYU43803.1|  hypothetical protein MIMGU_mgv1a003536mg                335   6e-108   Erythranthe guttata [common monkey flower]
ref|XP_009758421.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    335   6e-108   Nicotiana sylvestris
ref|XP_012077667.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       334   8e-108   Jatropha curcas
ref|XP_007034507.1|  Heat shock protein 60 isoform 4                    331   1e-107   
ref|XP_007034508.1|  Heat shock protein 60 isoform 5                    332   1e-107   
ref|XP_002518171.1|  chaperonin-60kD, ch60, putative                    333   1e-107   Ricinus communis
ref|XP_007034505.1|  Heat shock protein 60 isoform 2                    332   2e-107   
ref|XP_007049893.1|  Chaperonin CPN60-like 1, mitochondrial isofo...    328   2e-107   
ref|XP_010097982.1|  Chaperonin CPN60-2                                 327   3e-107   
ref|XP_010527490.1|  PREDICTED: chaperonin CPN60, mitochondrial         333   3e-107   Tarenaya hassleriana [spider flower]
ref|XP_007049892.1|  Heat shock protein 60 isoform 3                    329   5e-107   
ref|XP_007034504.1|  Heat shock protein 60 isoform 1                    332   6e-107   
ref|XP_003535967.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    332   7e-107   Glycine max [soybeans]
gb|KHG24292.1|  Chaperonin CPN60-2, mitochondrial                       332   8e-107   Gossypium arboreum [tree cotton]
emb|CDO99385.1|  unnamed protein product                                332   9e-107   Coffea canephora [robusta coffee]
ref|XP_007225634.1|  hypothetical protein PRUPE_ppa003391mg             332   1e-106   Prunus persica
gb|ABX76300.1|  heat shock protein 60                                   330   1e-106   Ageratina adenophora
gb|KJB37765.1|  hypothetical protein B456_006G219200                    331   2e-106   Gossypium raimondii
ref|XP_002285608.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       330   2e-106   Vitis vinifera
ref|XP_010109672.1|  Chaperonin CPN60-2                                 330   2e-106   Morus notabilis
gb|KHG09711.1|  Chaperonin CPN60-2, mitochondrial                       330   3e-106   Gossypium arboreum [tree cotton]
ref|XP_003555721.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    330   4e-106   Glycine max [soybeans]
ref|XP_003536270.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    330   5e-106   Glycine max [soybeans]
ref|XP_007049890.1|  Heat shock protein 60 isoform 1                    329   7e-106   
ref|XP_004290029.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    329   1e-105   Fragaria vesca subsp. vesca
ref|XP_006385911.1|  hypothetical protein POPTR_0003s17250g             327   1e-105   
ref|XP_007049891.1|  Heat shock protein 60 isoform 2                    326   1e-105   
ref|XP_010918836.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       328   1e-105   Elaeis guineensis
ref|XP_003556325.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    328   2e-105   Glycine max [soybeans]
ref|XP_010243653.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    328   2e-105   Nelumbo nucifera [Indian lotus]
gb|KHN00995.1|  Chaperonin CPN60-2, mitochondrial                       328   3e-105   Glycine soja [wild soybean]
emb|CDY72107.1|  BnaCnng76000D                                          319   3e-105   Brassica napus [oilseed rape]
ref|XP_010023772.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       328   3e-105   Eucalyptus grandis [rose gum]
ref|XP_002521151.1|  chaperonin-60kD, ch60, putative                    328   3e-105   Ricinus communis
ref|XP_007144180.1|  hypothetical protein PHAVU_007G135100g             327   4e-105   Phaseolus vulgaris [French bean]
ref|XP_007145430.1|  hypothetical protein PHAVU_007G238500g             327   6e-105   Phaseolus vulgaris [French bean]
ref|XP_008224072.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       327   6e-105   Prunus mume [ume]
ref|XP_010513304.1|  PREDICTED: chaperonin CPN60, mitochondrial-like    326   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_008235753.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    325   1e-104   Prunus mume [ume]
ref|XP_010550847.1|  PREDICTED: chaperonin CPN60, mitochondrial-like    326   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_002885624.1|  hypothetical protein ARALYDRAFT_898985             326   1e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_008810807.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       326   2e-104   Phoenix dactylifera
ref|XP_006297236.1|  hypothetical protein CARUB_v10013241mg             327   2e-104   
ref|NP_189041.1|  heat shock protein 60                                 325   4e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CAA77646.1|  chaperonin hsp60                                       325   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002299295.2|  Chaperonin CPN60-2 family protein                  325   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_009362047.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    325   4e-104   Pyrus x bretschneideri [bai li]
ref|XP_010466805.1|  PREDICTED: chaperonin CPN60, mitochondrial         325   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_009377449.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       325   5e-104   Pyrus x bretschneideri [bai li]
ref|XP_010933209.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    324   8e-104   Elaeis guineensis
ref|XP_004496079.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    324   8e-104   
ref|XP_010556941.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    323   1e-103   Tarenaya hassleriana [spider flower]
ref|XP_004299212.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       323   3e-103   Fragaria vesca subsp. vesca
ref|XP_008460701.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       322   4e-103   Cucumis melo [Oriental melon]
emb|CDX84697.1|  BnaA03g15330D                                          322   6e-103   
ref|XP_003591643.1|  Chaperonin CPN60-like protein                      322   7e-103   Medicago truncatula
ref|XP_009420744.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       321   9e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132917.1|  PREDICTED: chaperonin CPN60, mitochondrial         322   9e-103   Brassica rapa
gb|KFK31072.1|  hypothetical protein AALP_AA6G064600                    321   1e-102   Arabis alpina [alpine rockcress]
ref|XP_008812917.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    322   2e-102   Phoenix dactylifera
ref|XP_004147171.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       320   2e-102   Cucumis sativus [cucumbers]
ref|XP_008346198.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       320   2e-102   
ref|XP_008372428.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin C...    320   2e-102   
ref|XP_009371099.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    320   3e-102   Pyrus x bretschneideri [bai li]
ref|XP_006293894.1|  hypothetical protein CARUB_v10022887mg             320   3e-102   Capsella rubella
ref|XP_009405691.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    320   4e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006410461.1|  hypothetical protein EUTSA_v10016427mg             320   5e-102   Eutrema salsugineum [saltwater cress]
ref|XP_011002149.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       319   5e-102   Populus euphratica
ref|XP_002881268.1|  hypothetical protein ARALYDRAFT_902390             320   5e-102   Arabidopsis lyrata subsp. lyrata
emb|CDY17152.1|  BnaA05g10360D                                          319   6e-102   Brassica napus [oilseed rape]
emb|CDP03832.1|  unnamed protein product                                319   8e-102   Coffea canephora [robusta coffee]
ref|XP_006410460.1|  hypothetical protein EUTSA_v10016425mg             319   9e-102   Eutrema salsugineum [saltwater cress]
emb|CDX94835.1|  BnaC03g43530D                                          318   1e-101   
ref|XP_009143882.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    319   1e-101   Brassica rapa
ref|XP_003591642.1|  Chaperonin CPN60-2                                 318   1e-101   Medicago truncatula
gb|AFW68651.1|  chaperonin 1                                            312   1e-101   
ref|XP_009135882.1|  PREDICTED: chaperonin CPN60, mitochondrial         318   1e-101   Brassica rapa
sp|Q05046.1|CH62_CUCMA  RecName: Full=Chaperonin CPN60-2, mitocho...    318   1e-101   Cucurbita maxima [Boston marrow]
ref|XP_008358471.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       318   2e-101   
ref|XP_006841664.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       318   2e-101   Amborella trichopoda
emb|CDY19471.1|  BnaC04g11280D                                          318   2e-101   Brassica napus [oilseed rape]
ref|NP_001189665.1|  heat shock protein 60-2                            317   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020718.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    317   3e-101   Populus euphratica
gb|KFK31073.1|  hypothetical protein AALP_AA6G064700                    317   3e-101   Arabis alpina [alpine rockcress]
ref|XP_011024539.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    317   4e-101   Populus euphratica
ref|NP_850203.1|  heat shock protein 60-2                               317   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002303091.1|  Chaperonin CPN60-2 family protein                  317   4e-101   Populus trichocarpa [western balsam poplar]
ref|XP_004496080.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    317   5e-101   Cicer arietinum [garbanzo]
ref|XP_010522438.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    317   6e-101   Tarenaya hassleriana [spider flower]
ref|XP_010509916.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    316   1e-100   Camelina sativa [gold-of-pleasure]
gb|KJB42388.1|  hypothetical protein B456_007G151700                    313   2e-100   Gossypium raimondii
ref|XP_010413901.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    315   3e-100   Camelina sativa [gold-of-pleasure]
gb|KJB42386.1|  hypothetical protein B456_007G151700                    314   6e-100   Gossypium raimondii
gb|KJB42387.1|  hypothetical protein B456_007G151700                    312   6e-100   Gossypium raimondii
ref|XP_006662418.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    314   7e-100   Oryza brachyantha
gb|AAA33450.1|  chaperonin 60                                           313   9e-100   Zea mays [maize]
ref|XP_010469503.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    314   1e-99    Camelina sativa [gold-of-pleasure]
sp|P29185.2|CH61_MAIZE  RecName: Full=Chaperonin CPN60-1, mitocho...    313   1e-99    Zea mays [maize]
ref|XP_008644293.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    313   1e-99    
gb|ACL52466.1|  unknown                                                 307   2e-99    Zea mays [maize]
ref|NP_001105716.1|  chaperonin CPN60-1, mitochondrial precursor        311   8e-99    Zea mays [maize]
sp|Q05045.1|CH61_CUCMA  RecName: Full=Chaperonin CPN60-1, mitocho...    311   1e-98    Cucurbita maxima [Boston marrow]
ref|XP_003558831.1|  PREDICTED: chaperonin CPN60-1, mitochondrial       310   1e-98    Brachypodium distachyon [annual false brome]
ref|NP_001048938.1|  Os03g0143400                                       310   2e-98    
ref|XP_004139642.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    310   2e-98    Cucumis sativus [cucumbers]
gb|EMS57340.1|  Chaperonin CPN60-2, mitochondrial                       310   2e-98    Triticum urartu
ref|NP_001105690.1|  chaperonin CPN60-2, mitochondrial precursor        310   2e-98    Zea mays [maize]
ref|NP_001064784.1|  Os10g0462900                                       310   3e-98    
ref|XP_002467123.1|  hypothetical protein SORBIDRAFT_01g020010          310   3e-98    Sorghum bicolor [broomcorn]
ref|XP_004982955.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    310   3e-98    Setaria italica
ref|XP_011622760.1|  PREDICTED: chaperonin CPN60, mitochondrial         309   4e-98    Amborella trichopoda
dbj|BAK05600.1|  predicted protein                                      308   7e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985740.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    308   1e-97    Setaria italica
gb|EMT05673.1|  Chaperonin CPN60-2, mitochondrial                       308   1e-97    
gb|EPS59136.1|  hypothetical protein M569_15674                         300   1e-97    Genlisea aurea
gb|AAP54159.2|  Chaperonin CPN60-1, mitochondrial precursor, puta...    310   1e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574012.1|  PREDICTED: chaperonin CPN60-1, mitochondrial       308   1e-97    Brachypodium distachyon [annual false brome]
emb|CAA78101.1|  mitochondrial chaperonin-60                            308   1e-97    Zea mays [maize]
emb|CAA77645.1|  chaperonin hsp60                                       304   3e-96    Zea mays [maize]
sp|P35480.1|CH60_BRANA  RecName: Full=Chaperonin CPN60, mitochond...    296   5e-93    Brassica napus [oilseed rape]
ref|XP_002465871.1|  hypothetical protein SORBIDRAFT_01g047360          281   1e-92    
gb|ERN04382.1|  hypothetical protein AMTR_s00147p00091670               290   7e-91    Amborella trichopoda
gb|EMT21164.1|  Chaperonin CPN60-2, mitochondrial                       291   1e-90    
ref|XP_006651029.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    287   1e-89    Oryza brachyantha
gb|EYU46365.1|  hypothetical protein MIMGU_mgv1a026299mg                283   2e-88    Erythranthe guttata [common monkey flower]
gb|AAN63805.1|  heat shock protein 60                                   282   6e-88    Prunus dulcis [sweet almond]
gb|EMS53265.1|  Chaperonin CPN60-2, mitochondrial                       283   2e-87    Triticum urartu
ref|XP_001772410.1|  predicted protein                                  271   4e-83    
ref|XP_001783814.1|  predicted protein                                  270   4e-83    
ref|XP_001762115.1|  predicted protein                                  269   2e-82    
ref|XP_002978237.1|  hypothetical protein SELMODRAFT_108429             268   3e-82    
ref|XP_002966324.1|  hypothetical protein SELMODRAFT_85251              267   4e-82    
ref|XP_010666478.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       265   6e-81    Beta vulgaris subsp. vulgaris [field beet]
emb|CDX93002.1|  BnaA03g37240D                                          258   2e-78    
ref|XP_001760735.1|  predicted protein                                  258   3e-78    
gb|ACR37371.1|  unknown                                                 240   1e-76    Zea mays [maize]
ref|XP_007201704.1|  hypothetical protein PRUPE_ppa004110mg             250   7e-76    
ref|XP_004235594.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    243   8e-73    Solanum lycopersicum
ref|XP_006342978.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin C...    243   9e-73    
ref|XP_010242227.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    243   1e-72    Nelumbo nucifera [Indian lotus]
ref|XP_005848352.1|  hypothetical protein CHLNCDRAFT_51922              239   7e-72    Chlorella variabilis
ref|XP_010654528.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    241   8e-72    Vitis vinifera
ref|XP_010501368.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    240   1e-71    Camelina sativa [gold-of-pleasure]
ref|XP_009629888.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    240   1e-71    Nicotiana tomentosiformis
ref|XP_007024506.1|  Chaperonin-60 kDa protein isoform 2                235   2e-71    
gb|KJB56919.1|  hypothetical protein B456_009G141700                    239   3e-71    Gossypium raimondii
ref|XP_010534892.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    239   4e-71    Tarenaya hassleriana [spider flower]
ref|XP_002946991.1|  hypothetical protein VOLCADRAFT_79395              238   9e-71    Volvox carteri f. nagariensis
emb|CAN78641.1|  hypothetical protein VITISV_031740                     238   9e-71    Vitis vinifera
ref|XP_009135334.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    238   1e-70    Brassica rapa
emb|CDX82514.1|  BnaA03g33070D                                          238   1e-70    
ref|XP_011072524.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    238   1e-70    Sesamum indicum [beniseed]
ref|XP_006466018.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    238   1e-70    Citrus sinensis [apfelsine]
ref|XP_009796310.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    237   2e-70    Nicotiana sylvestris
ref|XP_006426562.1|  hypothetical protein CICLE_v10025257mg             237   2e-70    Citrus clementina [clementine]
ref|XP_011659644.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    237   2e-70    Cucumis sativus [cucumbers]
emb|CDX75733.1|  BnaC03g38160D                                          237   3e-70    
gb|AAL09728.1|  AT3g13860/MCP4_7                                        233   3e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011401079.1|  Chaperonin CPN60, mitochondrial                    236   4e-70    Auxenochlorella protothecoides
ref|XP_003064760.1|  predicted protein                                  235   9e-70    Micromonas pusilla CCMP1545
ref|XP_010685392.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    235   1e-69    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007024507.1|  Heat shock protein 60-3A isoform 3                 234   1e-69    
ref|XP_006296696.1|  hypothetical protein CARUB_v10013333mg             235   1e-69    Capsella rubella
ref|XP_002527401.1|  chaperonin-60kD, ch60, putative                    235   2e-69    Ricinus communis
emb|CDO97909.1|  unnamed protein product                                235   2e-69    Coffea canephora [robusta coffee]
ref|XP_004297534.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    235   2e-69    Fragaria vesca subsp. vesca
ref|XP_010487162.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    234   2e-69    Camelina sativa [gold-of-pleasure]
ref|XP_010465258.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    234   2e-69    Camelina sativa [gold-of-pleasure]
ref|XP_007024505.1|  Heat shock protein 60-3A isoform 1                 234   2e-69    
emb|CBL93634.1|  mitochondrial chaperonin 60 precursor                  234   3e-69    Chlamydomonas reinhardtii
ref|XP_005646765.1|  mitochondrial chaperonin 60                        234   3e-69    Coccomyxa subellipsoidea C-169
ref|XP_007135549.1|  hypothetical protein PHAVU_010G138700g             234   4e-69    Phaseolus vulgaris [French bean]
ref|XP_002884993.1|  hypothetical protein ARALYDRAFT_478789             233   5e-69    Arabidopsis lyrata subsp. lyrata
ref|XP_006407158.1|  hypothetical protein EUTSA_v10020386mg             233   5e-69    Eutrema salsugineum [saltwater cress]
ref|XP_012068975.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    233   7e-69    Jatropha curcas
ref|XP_012068973.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    233   8e-69    Jatropha curcas
gb|EYU21369.1|  hypothetical protein MIMGU_mgv1a003594mg                233   1e-68    Erythranthe guttata [common monkey flower]
ref|NP_566466.1|  heat shock protein 60-3A                              232   1e-68    Arabidopsis thaliana [mouse-ear cress]
gb|KFK38736.1|  hypothetical protein AALP_AA3G153700                    232   2e-68    Arabis alpina [alpine rockcress]
ref|XP_007510337.1|  chaperonin GroEL                                   233   2e-68    Bathycoccus prasinos
ref|XP_001691353.1|  chaperonin 60C                                     231   2e-68    Chlamydomonas reinhardtii
ref|XP_010925013.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    231   3e-68    Elaeis guineensis
ref|XP_009341038.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    231   3e-68    Pyrus x bretschneideri [bai li]
ref|XP_008807997.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    231   4e-68    Phoenix dactylifera
gb|KDD77186.1|  TCP-1/cpn60 chaperonin                                  231   4e-68    Helicosporidium sp. ATCC 50920
ref|XP_008228292.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    231   5e-68    Prunus mume [ume]
ref|XP_008391328.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    231   7e-68    Malus domestica [apple tree]
ref|XP_010062630.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    230   9e-68    Eucalyptus grandis [rose gum]
ref|XP_006583012.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    229   3e-67    Glycine max [soybeans]
gb|KHN39306.1|  Chaperonin CPN60-like 2, mitochondrial                  229   3e-67    Glycine soja [wild soybean]
gb|KCW69759.1|  hypothetical protein EUGRSUZ_F03134                     230   4e-67    Eucalyptus grandis [rose gum]
ref|XP_009410784.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    228   8e-67    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003531614.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    227   1e-66    Glycine max [soybeans]
ref|XP_001419890.1|  chaperonin 60, mitochondrial                       226   3e-66    Ostreococcus lucimarinus CCE9901
ref|XP_008462350.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    226   3e-66    Cucumis melo [Oriental melon]
emb|CEF99267.1|  Chaperonin Cpn60                                       226   6e-66    Ostreococcus tauri
gb|AAC04902.1|  mitochondrial chaperonin (HSP60)                        223   1e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003627097.1|  Chaperonin CPN60-like protein                      224   1e-65    Medicago truncatula
ref|XP_003081465.1|  chaperonin-60, mitochondrial precursor (IC)        225   2e-65    
gb|KDP40768.1|  hypothetical protein JCGZ_24767                         231   2e-65    Jatropha curcas
ref|XP_002988181.1|  hypothetical protein SELMODRAFT_159265             222   5e-65    
ref|XP_007215308.1|  hypothetical protein PRUPE_ppa003440mg             223   7e-65    Prunus persica
gb|EEC79614.1|  hypothetical protein OsI_20809                          222   2e-64    Oryza sativa Indica Group [Indian rice]
ref|NP_001056181.1|  Os05g0540300                                       222   2e-64    
ref|XP_011000813.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    219   4e-64    Populus euphratica
gb|ADN34111.1|  chaperonin-60 kDa protein                               225   5e-64    Cucumis melo subsp. melo
ref|XP_006655538.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    220   5e-64    Oryza brachyantha
ref|XP_002960969.1|  hypothetical protein SELMODRAFT_74977              219   6e-64    
ref|XP_002967038.1|  hypothetical protein SELMODRAFT_87823              219   7e-64    
ref|XP_004510380.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    219   2e-63    Cicer arietinum [garbanzo]
ref|XP_006385443.1|  hypothetical protein POPTR_0003s04550g             207   7e-63    
emb|CBI35954.3|  unnamed protein product                                215   3e-62    Vitis vinifera
ref|XP_004961365.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    216   3e-62    Setaria italica
gb|KJB42389.1|  hypothetical protein B456_007G151700                    214   4e-62    Gossypium raimondii
ref|XP_008862081.1|  chaperonin GroL                                    214   1e-61    Aphanomyces invadans
dbj|BAJ88210.1|  predicted protein                                      214   1e-61    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009842908.1|  chaperonin GroL                                    213   2e-61    Aphanomyces astaci
ref|XP_008862079.1|  chaperonin GroL                                    214   2e-61    Aphanomyces invadans
ref|XP_008604447.1|  chaperonin GroL                                    213   3e-61    Saprolegnia diclina VS20
gb|EFA83887.1|  chaperonin 60                                           212   4e-61    Heterostelium album PN500
ref|XP_004359903.1|  chaperonin 60                                      211   8e-61    Cavenderia fasciculata
ref|XP_001017291.2|  TCP-1/cpn60 chaperonin family protein              211   1e-60    Tetrahymena thermophila SB210
ref|XP_011270172.1|  hypothetical protein CAOG_08572                    206   3e-60    Capsaspora owczarzaki ATCC 30864
emb|CBJ29791.1|  conserved unknown protein                              210   4e-60    Ectocarpus siliculosus
gb|KJB56920.1|  hypothetical protein B456_009G141700                    208   7e-60    Gossypium raimondii
emb|CCI46088.1|  unnamed protein product                                209   7e-60    Albugo candida
ref|WP_038387615.1|  molecular chaperone GroEL                          208   9e-60    Bradyrhizobium elkanii
emb|CCA20827.1|  mitochondriatargeted chaperonin putative               209   1e-59    Albugo laibachii Nc14
ref|XP_003567994.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    209   1e-59    Brachypodium distachyon [annual false brome]
dbj|GAM20525.1|  hypothetical protein SAMD00019534_037000               205   1e-59    Acytostelium subglobosum LB1
ref|XP_009535382.1|  hypothetical protein PHYSODRAFT_549587             207   3e-59    Phytophthora sojae
ref|XP_008894090.1|  chaperonin GroL                                    208   3e-59    Phytophthora parasitica INRA-310
ref|XP_002963470.1|  hypothetical protein SELMODRAFT_405358             206   3e-59    
ref|XP_005708137.1|  chaperonin GroEL                                   208   4e-59    Galdieria sulphuraria
ref|WP_016843172.1|  molecular chaperone GroEL                          206   4e-59    Bradyrhizobium elkanii
ref|XP_004035017.1|  hypothetical protein IMG5_107510                   207   6e-59    Ichthyophthirius multifiliis
ref|XP_003286221.1|  chaperonin 60                                      206   6e-59    Dictyostelium purpureum
emb|CDY66712.1|  BnaCnng52030D                                          206   1e-58    Brassica napus [oilseed rape]
gb|AIU47034.1|  heat shock protein                                      197   2e-58    Phenacoccus solenopsis
gb|ABE02806.1|  heat shock protein 60                                   206   2e-58    Rhizophagus intraradices
ref|WP_028139167.1|  molecular chaperone GroEL                          205   2e-58    Bradyrhizobium japonicum
gb|ESA22226.1|  hypothetical protein GLOINDRAFT_115691                  205   2e-58    
ref|WP_024342336.1|  molecular chaperone GroEL                          205   2e-58    Bradyrhizobium japonicum
ref|XP_002901426.1|  chaperonin CPN60-1, mitochondrial precursor        206   2e-58    Phytophthora infestans T30-4
ref|XP_008647480.1|  PREDICTED: uncharacterized protein LOC100272...    205   2e-58    
gb|ABE02805.1|  heat shock protein 60                                   205   3e-58    Rhizophagus intraradices
ref|WP_038383531.1|  molecular chaperone GroEL                          196   3e-58    
emb|CDY37741.1|  BnaA04g19270D                                          206   3e-58    Brassica napus [oilseed rape]
gb|KFB45447.1|  AGAP004002-PA-like protein                              197   5e-58    Anopheles sinensis
ref|WP_016844149.1|  hypothetical protein                               196   6e-58    
emb|CDW80090.1|  chaperonin cpn60-mitochondrial-like                    204   6e-58    Stylonychia lemnae
gb|AAM34755.1|  heat shock protein 60                                   204   8e-58    Trichinella spiralis
ref|XP_002441451.1|  hypothetical protein SORBIDRAFT_09g026970          204   8e-58    Sorghum bicolor [broomcorn]
gb|AFW78925.1|  putative TCP-1/cpn60 chaperonin family protein          205   8e-58    
gb|AFM73647.1|  heat shock protein 60                                   194   9e-58    Bicyclus anynana
gb|AHF22058.1|  HSP60                                                   204   9e-58    Macrobrachium nipponense [oriental river prawn]
gb|ACO09552.1|  60 kDa heat shock protein, mitochondrial precursor      192   1e-57    Osmerus mordax
emb|CBK24112.2|  unnamed protein product                                203   1e-57    Blastocystis hominis
gb|AAX93145.1|  unknown                                                 194   1e-57    Homo sapiens [man]
ref|WP_038375647.1|  molecular chaperone GroEL                          191   1e-57    
ref|XP_009141297.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    202   2e-57    
gb|AAH41192.1|  Hspd1 protein                                           202   2e-57    Xenopus laevis [clawed frog]
ref|XP_009873382.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    192   2e-57    Apaloderma vittatum
ref|XP_636839.1|  chaperonin 60                                         202   2e-57    Dictyostelium discoideum AX4
ref|WP_020811995.1|  molecular chaperone GroEL                          193   2e-57    
dbj|BAE88218.1|  unnamed protein product                                194   2e-57    Macaca fascicularis [crab eating macaque]
ref|NP_001083970.1|  heat shock 60kDa protein 1 (chaperonin)            202   3e-57    
gb|AAG60328.1|  heat shock protein 60                                   198   3e-57    
gb|EWM24609.1|  Chaperonin Cpn60/TCP-1                                  202   3e-57    
ref|XP_003886122.1|  KLLA0F09449p, related                              202   3e-57    
ref|NP_001096355.1|  heat shock 60kDa protein 1 (chaperonin)            202   3e-57    
ref|WP_032112406.1|  molecular chaperone GroEL                          201   4e-57    
gb|EWM24608.1|  Chaperonin Cpn60/TCP-1                                  202   4e-57    
gb|AHA85006.1|  heat shock protein 60                                   202   4e-57    
gb|AAK49534.1|AF359268_1  chaperonin 60                                 201   4e-57    
gb|EJY67525.1|  hypothetical protein OXYTRI_11964                       202   5e-57    
ref|WP_022005890.1|  molecular chaperone GroEL                          201   5e-57    
ref|WP_037115983.1|  molecular chaperone GroEL                          193   5e-57    
ref|NP_001079654.1|  60 kDa heat shock protein, mitochondrial-like      199   6e-57    
ref|XP_010106240.1|  hypothetical protein L484_005105                   201   6e-57    
ref|WP_024507567.1|  molecular chaperone GroEL                          201   7e-57    
ref|WP_025034695.1|  molecular chaperone GroEL                          201   7e-57    
gb|KDR14060.1|  60 kDa heat shock protein, mitochondrial                201   7e-57    
ref|XP_003371438.1|  putative chaperonin GroL                           204   9e-57    
ref|WP_027562102.1|  MULTISPECIES: molecular chaperone GroEL            200   9e-57    
ref|WP_007565400.1|  chaperonin GroEL                                   189   1e-56    
ref|WP_018270274.1|  molecular chaperone GroEL                          200   1e-56    
ref|WP_036002039.1|  molecular chaperone GroEL                          196   1e-56    
ref|XP_005324457.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-56    
ref|WP_008600762.1|  Heat shock protein 60 family chaperone GroEL       200   2e-56    
ref|WP_010299656.1|  molecular chaperone GroEL                          200   2e-56    
ref|XP_002106653.1|  GD17003                                            200   2e-56    
ref|XP_002100912.1|  GE15908                                            200   2e-56    
gb|EIZ82248.1|  chaperonin GroEL                                        188   2e-56    
ref|XP_001977170.1|  GG18391                                            200   2e-56    
ref|WP_028163046.1|  molecular chaperone GroEL                          199   3e-56    
emb|CDW59388.1|  chaperonin protein heat shock protein60                200   3e-56    
ref|XP_008883792.1|  heat shock protein HSP60                           200   3e-56    
gb|EFX84424.1|  hypothetical protein DAPPUDRAFT_301074                  199   3e-56    
ref|XP_003796211.1|  PREDICTED: LOW QUALITY PROTEIN: 60 kDa heat ...    196   3e-56    
emb|CAA67720.1|  heat shock protein 60                                  199   4e-56    
ref|WP_024340222.1|  molecular chaperone GroEL                          199   4e-56    
gb|AAM76713.1|  chaperonin Cpn60                                        193   4e-56    
ref|XP_004628722.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    197   4e-56    
ref|WP_022079109.1|  molecular chaperone GroEL                          199   4e-56    
gb|AAI02078.1|  HSPD1 protein                                           195   5e-56    
ref|WP_028831782.1|  molecular chaperone GroEL                          199   5e-56    
ref|WP_037087615.1|  molecular chaperone GroEL                          194   5e-56    
gb|AAQ23524.1|  SD06594p                                                199   5e-56    
ref|XP_001995750.1|  GH17925                                            199   5e-56    
ref|WP_029029272.1|  molecular chaperone GroEL                          198   5e-56    
ref|NP_511115.2|  heat shock protein 60, isoform A                      199   5e-56    
gb|ACT52824.1|  heat shock protein 60                                   199   5e-56    
ref|XP_004653790.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   6e-56    
gb|ABO09590.1|  heat shock protein 60                                   199   6e-56    
ref|XP_002765682.1|  heat shock protein 60, putative                    198   6e-56    
ref|XP_004652685.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    191   7e-56    
gb|KFD69477.1|  hypothetical protein M514_07906                         199   7e-56    
ref|WP_040427150.1|  molecular chaperone GroEL                          198   7e-56    
ref|XP_002778119.1|  heat shock protein 60, putative                    198   8e-56    
ref|XP_002783469.1|  heat shock protein 60, putative                    198   8e-56    
ref|XP_002785716.1|  heat shock protein 60, putative                    198   8e-56    
ref|XP_002067348.1|  GK16370                                            198   8e-56    
ref|XP_011197697.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    198   8e-56    
ref|WP_031194276.1|  molecular chaperone GroEL                          187   9e-56    
ref|XP_002367122.1|  heat shock protein 60                              198   1e-55    
tpg|DAA34093.1|  TPA: mitochondrial chaperonin Cpn60/Hsp60p             194   1e-55    
ref|WP_022196717.1|  molecular chaperone GroEL                          197   1e-55    
gb|AAD38419.1|  heat shock protein 60                                   198   1e-55    
ref|WP_029349472.1|  molecular chaperone GroEL                          197   1e-55    
ref|XP_002041940.1|  GM11458                                            201   1e-55    
ref|WP_038464988.1|  molecular chaperone GroEL                          197   1e-55    
ref|XP_005179400.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    198   1e-55    
gb|ELK27738.1|  60 kDa heat shock protein, mitochondrial                197   2e-55    
ref|WP_043948430.1|  molecular chaperone GroEL                          186   2e-55    
gb|EJZ31189.1|  chaperonin GroEL                                        197   2e-55    
ref|WP_037105868.1|  molecular chaperone GroEL                          192   2e-55    
ref|XP_001988201.1|  GH11038                                            197   2e-55    
ref|NP_608948.2|  Hsp60C, isoform C                                     197   2e-55    
gb|EIE82168.1|  hsp60-like protein                                      197   2e-55    
ref|WP_029356467.1|  molecular chaperone GroEL                          197   2e-55    
ref|XP_004529412.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    197   2e-55    
ref|WP_028337190.1|  molecular chaperone GroEL                          196   2e-55    
ref|XP_006779634.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 6...    197   2e-55    
ref|WP_021077014.1|  chaperonin 3                                       196   2e-55    
ref|XP_002433722.1|  chaperonin subunit, putative                       197   3e-55    
ref|XP_011187050.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    197   3e-55    
ref|XP_010156395.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    197   3e-55    
ref|WP_043383185.1|  molecular chaperone GroEL                          189   3e-55    
ref|XP_002176830.1|  mitochondria-targeted chaperonin                   197   3e-55    
ref|XP_008144715.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    197   3e-55    
gb|ACO57619.1|  heat shock protein 60                                   197   3e-55    
ref|XP_001600045.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    197   3e-55    
gb|KFM69423.1|  heat shock protein, mitochondrial                       197   3e-55    
gb|KFB45446.1|  hypothetical protein ZHAS_00013381                      197   3e-55    
ref|XP_006082433.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    197   3e-55    
gb|AFN65687.1|  heat shock protein 60                                   197   3e-55    
ref|XP_002058167.1|  GJ15640                                            197   3e-55    
gb|ESX16963.1|  hypothetical protein X766_19560                         187   3e-55    
ref|WP_015687379.1|  molecular chaperone GroEL                          196   3e-55    
ref|XP_005366474.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    194   3e-55    
ref|WP_026604996.1|  molecular chaperone GroEL                          189   3e-55    
ref|XP_005873621.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 6...    197   3e-55    
ref|WP_027168856.1|  molecular chaperone GroEL                          191   4e-55    
ref|XP_002428684.1|  Hsp60 protein, putative                            197   4e-55    
ref|XP_007465759.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    197   4e-55    
ref|XP_005715325.1|  Chaperonine 60                                     197   4e-55    
ref|XP_011553544.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   4e-55    
ref|XP_011456445.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   4e-55    
ref|XP_006636350.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   4e-55    
ref|WP_023685576.1|  hypothetical protein                               186   4e-55    
ref|WP_045024057.1|  molecular chaperone GroEL                          196   4e-55    
gb|ESX86245.1|  hypothetical protein X755_30205                         186   4e-55    
gb|AAV31663.1|  predicted chaperonin GroEL                              196   4e-55    
gb|EKC31862.1|  60 kDa heat shock protein, mitochondrial                196   4e-55    
ref|XP_007534479.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   5e-55    
ref|WP_045229731.1|  molecular chaperone GroEL                          196   5e-55    
ref|WP_018272797.1|  molecular chaperone GroEL                          196   5e-55    
ref|XP_001902773.1|  chaperonine protein HSP60                          191   5e-55    
gb|ELW62727.1|  60 kDa heat shock protein, mitochondrial                195   6e-55    
ref|WP_023694884.1|  hypothetical protein                               186   6e-55    
ref|WP_046022245.1|  molecular chaperone GroEL                          196   6e-55    
ref|WP_037115811.1|  molecular chaperone GroEL                          187   6e-55    
ref|XP_008846516.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   6e-55    
ref|WP_027575248.1|  molecular chaperone GroEL                          196   6e-55    
ref|XP_011903307.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   6e-55    
ref|WP_026014975.1|  molecular chaperone GroEL                          195   6e-55    
ref|WP_031206368.1|  molecular chaperone GroEL                          186   7e-55    
ref|XP_008486008.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    192   7e-55    
sp|P31081.2|CH60_BOVIN  RecName: Full=60 kDa heat shock protein, ...    196   7e-55    
ref|WP_037200815.1|  molecular chaperone GroEL                          195   7e-55    
ref|XP_005373324.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   7e-55    
ref|WP_027994200.1|  molecular chaperone GroEL                          189   8e-55    
ref|WP_027038658.1|  hypothetical protein                               187   8e-55    
gb|EPY88147.1|  heat shock protein, mitochondrial precursor (Hsp6...    195   8e-55    
ref|WP_023835589.1|  hypothetical protein                               186   8e-55    
ref|XP_010630268.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   8e-55    
ref|WP_028736765.1|  molecular chaperone GroEL                          195   8e-55    
gb|EDL09898.1|  mCG1033306                                              185   8e-55    
ref|XP_009441967.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   9e-55    
gb|AAW30392.2|  heat shock protein 60                                   196   9e-55    
dbj|BAL45642.1|  heat shock protein 60                                  196   9e-55    
ref|WP_031202246.1|  molecular chaperone GroEL                          187   9e-55    
ref|XP_004426818.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   1e-54    
ref|XP_011301697.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   1e-54    
ref|XP_008846515.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   1e-54    
ref|XP_001963430.1|  GF20294                                            195   1e-54    
gb|ESZ08542.1|  hypothetical protein X735_30020                         186   1e-54    
gb|AAM29278.1|  AT16985p                                                195   1e-54    
dbj|BAQ48841.1|  molecular chaperone GroEL                              195   1e-54    
gb|KHN88593.1|  Chaperonin -like protein Hsp-60, mitochondrial          197   1e-54    
ref|XP_007449173.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
gb|ETN58825.1|  60 kDa heat shock protein, mitochondrial                195   1e-54    
ref|WP_011415794.1|  molecular chaperone GroEL                          195   1e-54    
ref|WP_044562587.1|  molecular chaperone GroEL                          195   1e-54    
ref|WP_014188117.1|  molecular chaperone GroEL                          195   1e-54    
dbj|BAL45644.1|  heat shock protein 60                                  195   1e-54    
ref|XP_002133668.1|  GA22684                                            195   1e-54    
ref|XP_004315003.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_004262942.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
emb|CAB58441.1|  Hsp60 protein                                          195   1e-54    
gb|AAI06113.1|  Hspd1 protein                                           195   1e-54    
ref|WP_034488331.1|  molecular chaperone GroEL                          195   1e-54    
ref|XP_008061272.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
emb|CAA37653.1|  unnamed protein product                                195   1e-54    
ref|XP_006728211.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_001502715.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|WP_039844100.1|  molecular chaperone GroEL                          194   1e-54    
ref|XP_006862107.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_007190530.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_007190531.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_004601301.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|WP_023836321.1|  molecular chaperone GroEL                          195   1e-54    
ref|NP_001160080.1|  60 kDa heat shock protein, mitochondrial           195   1e-54    
ref|XP_006175276.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_004393550.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_005373323.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    196   1e-54    
ref|WP_022718644.1|  molecular chaperone GroEL                          187   1e-54    
ref|XP_011367527.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_004910255.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|WP_012331671.1|  molecular chaperone GroEL                          194   1e-54    
ref|XP_009679766.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|WP_042618089.1|  molecular chaperone GroEL                          194   1e-54    
ref|XP_003991044.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_008685530.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_003406201.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_004701572.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|WP_018261978.1|  molecular chaperone GroEL                          194   1e-54    
ref|XP_004338977.1|  chaperonin GroL, putative                          195   1e-54    
ref|XP_006153036.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_004674470.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|XP_006903338.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   1e-54    
ref|WP_012567757.1|  molecular chaperone GroEL                          194   2e-54    
ref|WP_006614577.1|  molecular chaperone GroEL                          194   2e-54    
gb|ADR79280.1|  Hsp60                                                   195   2e-54    
gb|ACE06961.1|  mitochondrial heat shock 60kD protein 1 variant 1       195   2e-54    
ref|XP_011844504.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|WP_015927410.1|  molecular chaperone GroEL                          194   2e-54    
ref|XP_005676360.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|XP_005008680.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 6...    195   2e-54    
emb|CAA38762.1|  heat shock protein 65                                  195   2e-54    
ref|WP_044425354.1|  molecular chaperone GroEL                          194   2e-54    
ref|XP_008566753.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|XP_009654996.1|  heat shock protein                                 195   2e-54    
ref|XP_004577013.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|XP_005676359.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|WP_029617220.1|  MULTISPECIES: molecular chaperone GroEL            194   2e-54    
ref|NP_034607.3|  60 kDa heat shock protein, mitochondrial              195   2e-54    
ref|WP_024080866.1|  molecular chaperone GroEL                          194   2e-54    
ref|XP_010379929.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|WP_023756094.1|  hypothetical protein                               186   2e-54    
gb|KFO30002.1|  60 kDa heat shock protein, mitochondrial                195   2e-54    
gb|ABB01006.1|  heat shock protein 60                                   195   2e-54    
ref|XP_010210566.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
emb|CAA38564.1|  heat shock protein (hsp60) precursor                   195   2e-54    
ref|WP_003503181.1|  molecular chaperone GroEL                          194   2e-54    
gb|EJW83481.1|  chaperonin GroL                                         195   2e-54    
ref|XP_008494176.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|XP_004772226.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|XP_003253931.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
gb|AGD79959.1|  heat shock protein 60                                   195   2e-54    
ref|XP_002712414.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|XP_004004841.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|NP_001182445.1|  60 kDa heat shock protein, mitochondrial           195   2e-54    
ref|WP_006313163.1|  MULTISPECIES: molecular chaperone GroEL            194   2e-54    
ref|XP_005640553.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    195   2e-54    
ref|WP_027580822.1|  molecular chaperone GroEL                          194   2e-54    



>ref|XP_009616503.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nicotiana tomentosiformis]
Length=575

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAANLASKARVA+ STQQIG  L+WSRNYAAKDIRFGVEARA+MLQGVEELADAVKV
Sbjct  1    MYRFAANLASKARVARTSTQQIGGRLNWSRNYAAKDIRFGVEARAMMLQGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_009800688.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nicotiana sylvestris]
Length=575

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAA+LASKARVA+ STQQIG  L+WSRNYAAKDIRFGVEARA+MLQGVEELADAVKV
Sbjct  1    MYRFAASLASKARVARTSTQQIGGRLNWSRNYAAKDIRFGVEARAMMLQGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_006492150.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Citrus sinensis]
Length=578

 Score =   342 bits (877),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+NSTQQIG+ LSWSRNYAAKDIRFGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASSLASKARIARNSTQQIGNRLSWSRNYAAKDIRFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_006340914.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Solanum tuberosum]
Length=575

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAANLASKARVA+ S+QQIG   +WSRNYAAKDIRFGVEARALMLQGVE+LADAVKV
Sbjct  1    MYRFAANLASKARVARISSQQIGGRFNWSRNYAAKDIRFGVEARALMLQGVEQLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K++NVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIQNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_004247810.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Solanum lycopersicum]
Length=579

 Score =   337 bits (865),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAANLASKA VA+ S+Q+IG  L+WSRNYAAKDIRFGVEARALMLQGVE+LADAVKV
Sbjct  1    MYRFAANLASKASVARTSSQKIGGRLNWSRNYAAKDIRFGVEARALMLQGVEQLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K++NVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIQNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_009599981.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=573

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAA LASKA VA+NST Q+GS L+WSRNYAAKDI+FGVEAR LMLQGVE+LADAVKV
Sbjct  1    MYRFAAKLASKASVARNSTNQVGSRLNWSRNYAAKDIKFGVEARGLMLQGVEQLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFQDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_007034509.1| Heat shock protein 60 isoform 6 [Theobroma cacao]
 gb|EOY05435.1| Heat shock protein 60 isoform 6 [Theobroma cacao]
Length=448

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASSLASKARIARNTTHQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS++F +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIDFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATLLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDDVVTNLKSRARMISTSEEIAQ  177



>ref|XP_006355738.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Solanum tuberosum]
Length=573

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAA LASK+RVA+ STQQ+GS L+WSRNYAAKDI+FGVEAR LMLQGVE+LADAVKV
Sbjct  1    MYRFAAKLASKSRVARRSTQQVGSRLNWSRNYAAKDIKFGVEARGLMLQGVEQLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010264000.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nelumbo nucifera]
Length=575

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AANLASKAR+A+N+TQQ+GS LSW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRVAANLASKARIARNTTQQVGSRLSWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNMGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF+EGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFSEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_004239874.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Solanum lycopersicum]
Length=573

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAA LASK+RVA++STQQ+GS L+WSRNYAAKDI+FGVEAR +MLQGVE+LADAVKV
Sbjct  1    MYRFAAKLASKSRVARSSTQQVGSRLNWSRNYAAKDIKFGVEARGIMLQGVEQLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_011091383.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Sesamum indicum]
Length=575

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA NLA KAR+A+NS+QQ+GS   WSRNYAAKDIRFGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATNLAGKARLARNSSQQVGSRWGWSRNYAAKDIRFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFMEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_007034510.1| Heat shock protein 60 isoform 7 [Theobroma cacao]
 gb|EOY05436.1| Heat shock protein 60 isoform 7 [Theobroma cacao]
Length=452

 Score =   331 bits (848),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASSLASKARIARNTTHQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS++F +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIDFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATLLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDDVVTNLKSRARMISTSEEIAQ  177



>ref|XP_012085173.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Jatropha curcas]
 gb|KDP26429.1| hypothetical protein JCGZ_17587 [Jatropha curcas]
Length=574

 Score =   335 bits (858),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RFA+ LASKAR+AKNSTQQIGS L+WSRNYAAKDI+FGVEARALML+GVE+LADAVKV
Sbjct  1    MHRFASGLASKARLAKNSTQQIGSRLAWSRNYAAKDIKFGVEARALMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQSWG PKVTKDGVTVAKS+EF++KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSWGDPKVTKDGVTVAKSIEFHDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIFAEGCKSVAAGMNAMDLRRGI+MAVD+V+TNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIFAEGCKSVAAGMNAMDLRRGISMAVDAVITNLKSRARMISTSEEIAQ  177



>gb|EYU43803.1| hypothetical protein MIMGU_mgv1a003536mg [Erythranthe guttata]
Length=579

 Score =   335 bits (858),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAANLASKARVA+NS+QQIG  L   RNYAAKDIRFGVEARALML+GVEELADAVKV
Sbjct  1    MYRFAANLASKARVARNSSQQIGGRLGGLRNYAAKDIRFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_009758421.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nicotiana 
sylvestris]
Length=573

 Score =   335 bits (858),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAA LASKA VA+NS+ Q+GS L+WSRNYAAKD++FGVEAR LMLQGVE+LADAVKV
Sbjct  1    MYRFAAKLASKASVARNSSHQVGSRLNWSRNYAAKDVKFGVEARGLMLQGVEQLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_012077667.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Jatropha curcas]
 gb|KDP33373.1| hypothetical protein JCGZ_12922 [Jatropha curcas]
Length=574

 Score =   334 bits (857),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+NS+ QIGS LSWSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASSLASKARIARNSSHQIGSRLSWSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_007034507.1| Heat shock protein 60 isoform 4 [Theobroma cacao]
 gb|EOY05433.1| Heat shock protein 60 isoform 4 [Theobroma cacao]
Length=475

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASSLASKARIARNTTHQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS++F +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIDFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATLLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDDVVTNLKSRARMISTSEEIAQ  177



>ref|XP_007034508.1| Heat shock protein 60 isoform 5 [Theobroma cacao]
 gb|EOY05434.1| Heat shock protein 60 isoform 5 [Theobroma cacao]
Length=499

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASSLASKARIARNTTHQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS++F +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIDFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATLLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDDVVTNLKSRARMISTSEEIAQ  177



>ref|XP_002518171.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF44304.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=574

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+NST QIGS LSWSRNYAAKDI+FGVEARALML+GVEELA+AVKV
Sbjct  1    MYRFASSLASKARIARNSTHQIGSRLSWSRNYAAKDIKFGVEARALMLKGVEELAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +K+KN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKIKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_007034505.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 ref|XP_007034506.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 gb|EOY05431.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 gb|EOY05432.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
Length=516

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASSLASKARIARNTTHQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS++F +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIDFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATLLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDDVVTNLKSRARMISTSEEIAQ  177



>ref|XP_007049893.1| Chaperonin CPN60-like 1, mitochondrial isoform 4 [Theobroma cacao]
 gb|EOX94050.1| Chaperonin CPN60-like 1, mitochondrial isoform 4 [Theobroma cacao]
Length=426

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+AKN+TQ IGS LSWSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATSLASKARLAKNNTQLIGSRLSWSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVA+ATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVASATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010097982.1| Chaperonin CPN60-2 [Morus notabilis]
 gb|EXB73712.1| Chaperonin CPN60-2 [Morus notabilis]
Length=378

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A +LA KAR+A+N+TQQ+GS LSWSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRNATSLAFKARIARNATQQVGSRLSWSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFQDKVKNIGASLVKQVANATNDFAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDYVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010527490.1| PREDICTED: chaperonin CPN60, mitochondrial [Tarenaya hassleriana]
Length=574

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 172/177 (97%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+A+NS +Q+ S +SWSRNYAAKDI+FGVEARALML+GVEELADAV+V
Sbjct  1    MYRFASNLASKARIARNS-RQVSSRMSWSRNYAAKDIKFGVEARALMLKGVEELADAVRV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF NKVKNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFENKVKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  176



>ref|XP_007049892.1| Heat shock protein 60 isoform 3 [Theobroma cacao]
 gb|EOX94049.1| Heat shock protein 60 isoform 3 [Theobroma cacao]
Length=467

 Score =   329 bits (843),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+AKN+TQ IGS LSWSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATSLASKARLAKNNTQLIGSRLSWSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVA+ATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVASATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_007034504.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
 gb|EOY05430.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
Length=575

 Score =   332 bits (851),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASSLASKARIARNTTHQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS++F +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIDFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATLLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDDVVTNLKSRARMISTSEEIAQ  177



>ref|XP_003535967.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
 gb|KHN10297.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   332 bits (851),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+A++S+ QIGS LS SRNYAAKDIRFGVEARALML+GVEELADAVKV
Sbjct  1    MYRFASNLASKARIARSSSHQIGSRLSSSRNYAAKDIRFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  177



>gb|KHG24292.1| Chaperonin CPN60-2, mitochondrial [Gossypium arboreum]
 gb|KJB37762.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
 gb|KJB37763.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
 gb|KJB37764.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
Length=575

 Score =   332 bits (850),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEELADAV+V
Sbjct  1    MYRFASSLASKARAARNTTYQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELADAVRV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>emb|CDO99385.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   332 bits (850),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFAANLASKARVA+NS+QQI S L WSRNYAAKDIRFGV+ARALML+GVE+LA+AVKV
Sbjct  1    MYRFAANLASKARVARNSSQQISSRLGWSRNYAAKDIRFGVDARALMLKGVEDLAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGI MAVD VVT LKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGINMAVDDVVTTLKSRARMISTSEEIAQ  177



>ref|XP_007225634.1| hypothetical protein PRUPE_ppa003391mg [Prunus persica]
 gb|EMJ26833.1| hypothetical protein PRUPE_ppa003391mg [Prunus persica]
Length=578

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKARVA+N ++QIG +LSWSRNYAAKDI+FGVEARALML GVE+LADAVKV
Sbjct  1    MYRFASSLASKARVARNCSKQIGGTLSWSRNYAAKDIKFGVEARALMLNGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAI+ EGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIYTEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  177



>gb|ABX76300.1| heat shock protein 60 [Ageratina adenophora]
Length=526

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A N+ASK+R+A+N+ QQIGS+LSW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRLAVNIASKSRIARNNAQQIGSNLSWNRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI++EGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTQAIYSEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  177



>gb|KJB37765.1| hypothetical protein B456_006G219200 [Gossypium raimondii]
 gb|KJB37766.1| hypothetical protein B456_006G219200 [Gossypium raimondii]
Length=575

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEEL+DAV+V
Sbjct  1    MYRFASSLASKARAARNTTYQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELSDAVRV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_002285608.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Vitis vinifera]
 emb|CBI33329.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+A+NST QIGS L+WSRNYAAKDIRFGVEARALML+GVEELADAV+V
Sbjct  1    MYRFATSLASKARIARNSTHQIGSRLNWSRNYAAKDIRFGVEARALMLKGVEELADAVRV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +++KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRA+MISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRAKMISTSEEIAQ  177



>ref|XP_010109672.1| Chaperonin CPN60-2 [Morus notabilis]
 gb|EXC24142.1| Chaperonin CPN60-2 [Morus notabilis]
Length=574

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR++KNS QQIGS LSW+RNYAAKDI+FGVEAR+LML+GVE+LADAVKV
Sbjct  1    MYRFATSLASKARLSKNSCQQIGSRLSWARNYAAKDIKFGVEARSLMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>gb|KHG09711.1| Chaperonin CPN60-2, mitochondrial [Gossypium arboreum]
Length=575

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR A+N+T QIGS LSW+RNYAAKDI+FGVEARALML+GVEEL+DAV+V
Sbjct  1    MYRFASSLASKARAARNTTYQIGSRLSWNRNYAAKDIKFGVEARALMLKGVEELSDAVRV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_003555721.1| PREDICTED: chaperonin CPN60-2, mitochondrial isoform 1 [Glycine 
max]
 gb|KHN31621.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+NLASKAR+A++S+QQIGS LS SRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRLASNLASKARIARSSSQQIGSRLSLSRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKS+AAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSIAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_003536270.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
 gb|KHN30688.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=577

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+A++STQQIGS +SW+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATSLASKARIARSSTQQIGSRVSWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LT+AIF EGCKSVAAGMNAMDLRRGI MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTKAIFTEGCKSVAAGMNAMDLRRGINMAVDTVVTNLKSRARMISTSEEIAQ  177



>ref|XP_007049890.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
 gb|EOX94047.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
Length=575

 Score =   329 bits (844),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+AKN+TQ IGS LSWSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATSLASKARLAKNNTQLIGSRLSWSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVA+ATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVASATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_004290029.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Fragaria vesca 
subsp. vesca]
Length=576

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+AK S QQIGS +SW RNYAAKDI+FGVEAR+LML+GVEELADAVKV
Sbjct  1    MYRFASNLASKARLAKTSGQQIGSRISWRRNYAAKDIKFGVEARSLMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVLEQSYGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDCVVTNLKSRARMISTSEEIAQ  177



>ref|XP_006385911.1| hypothetical protein POPTR_0003s17250g [Populus trichocarpa]
 gb|ERP63708.1| hypothetical protein POPTR_0003s17250g [Populus trichocarpa]
Length=512

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RF ++LASKAR+A+++T+QIGS LSWSRNYAAKDIRFGVEARA+ML+GVEELADAVKV
Sbjct  1    MHRFTSSLASKARIARSTTKQIGSRLSWSRNYAAKDIRFGVEARAVMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGI+MAV+SVVTNLKSR RMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGISMAVESVVTNLKSRTRMISTSEEIAQ  177



>ref|XP_007049891.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 gb|EOX94048.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
Length=484

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+AKN+TQ IGS LSWSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATSLASKARLAKNNTQLIGSRLSWSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVA+ATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVASATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010918836.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Elaeis guineensis]
Length=575

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR+A +S++QIGS L WSRNYAAKDIRFGVEARALML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARIAGSSSRQIGSRLGWSRNYAAKDIRFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_003556325.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
Length=575

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+A++STQQIGS ++W+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATSLASKARIARSSTQQIGSRVTWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LT+AIF EGCKSVAAGMNAMDLRRGI MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTKAIFTEGCKSVAAGMNAMDLRRGINMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010243653.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nelumbo nucifera]
Length=574

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AANLASKAR+A+N ++Q+GS LSW+RNYAAKD++FGVEARALML+GVEELADAVKV
Sbjct  1    MYRMAANLASKARIARNGSRQVGSRLSWNRNYAAKDVKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +K KNVGASLVKQVANATND+AGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDKTKNVGASLVKQVANATNDMAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF+EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFSEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>gb|KHN00995.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+A++STQQIGS ++W+RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATSLASKARIARSSTQQIGSRVTWNRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LT+AIF EGCKSVAAGMNAMDLRRGI MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTKAIFTEGCKSVAAGMNAMDLRRGINMAVDAVVTNLKSRARMISTSEEIAQ  177



>emb|CDY72107.1| BnaCnng76000D, partial [Brassica napus]
Length=307

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +++ASKARVA+N T QIGS LS +RNYAAKDIRFGVE RALML+GVEELADAVKV
Sbjct  1    MYRLISSIASKARVARNCTSQIGSRLSSTRNYAAKDIRFGVEGRALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF + VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDGVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010023772.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Eucalyptus grandis]
 gb|KCW60142.1| hypothetical protein EUGRSUZ_H02866 [Eucalyptus grandis]
Length=575

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+NS  QIGS  SW+RNYAAKDI+FGVEARALML+GVE+LADAVKV
Sbjct  1    MYRFASSLASKARIARNSAHQIGSRASWARNYAAKDIKFGVEARALMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKSVEF +++KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSVEFKDRIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGIT+AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITLAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_002521151.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF41302.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=575

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRF + LASKAR+AKNSTQQ+GS L+WSR+YAAKDI+FGVEARALML+GVE+LADAVKV
Sbjct  1    MYRFVSGLASKARLAKNSTQQVGSRLAWSRSYAAKDIKFGVEARALMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSWGAPKVTKDGVTVAKSIEFQDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAI  EGCKSVAAGMNAMDLRRGI+MAVD+V+TNLKSR RMISTSEEIAQ
Sbjct  121  TCATVLTRAILVEGCKSVAAGMNAMDLRRGISMAVDTVITNLKSRTRMISTSEEIAQ  177



>ref|XP_007144180.1| hypothetical protein PHAVU_007G135100g [Phaseolus vulgaris]
 gb|ESW16174.1| hypothetical protein PHAVU_007G135100g [Phaseolus vulgaris]
Length=575

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR++++ TQQIGS +SWSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFATSLASKARISRSGTQQIGSRVSWSRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMN MDLRRGI MAVDSVVTNLKSRARMI+TSEEIAQ
Sbjct  121  TCATILTRAIFTEGCKSVAAGMNTMDLRRGINMAVDSVVTNLKSRARMINTSEEIAQ  177



>ref|XP_007145430.1| hypothetical protein PHAVU_007G238500g [Phaseolus vulgaris]
 gb|ESW17424.1| hypothetical protein PHAVU_007G238500g [Phaseolus vulgaris]
Length=575

 Score =   327 bits (838),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A++ ++Q+GS LSWSRNYAAKDIRFGVEARALML+GVEELA+AVKV
Sbjct  1    MYRFASSLASKARIARSGSKQVGSRLSWSRNYAAKDIRFGVEARALMLKGVEELAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+G PKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSFGGPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGI MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGINMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_008224072.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Prunus mume]
Length=578

 Score =   327 bits (838),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKARVA+N ++QIG +LSWSRNYAAKDI+FGVEARALML GVE+LADAVKV
Sbjct  1    MYRFASSLASKARVARNCSKQIGGTLSWSRNYAAKDIKFGVEARALMLNGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAI+ EGCKSVAAGMNAMDLRRGITMAVD VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIYTEGCKSVAAGMNAMDLRRGITMAVDFVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010513304.1| PREDICTED: chaperonin CPN60, mitochondrial-like [Camelina sativa]
Length=577

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+A+N T+Q+ S +SWSRNYAAK+I+FGVEARALML+GVE+LADAVKV
Sbjct  1    MYRFASNLASKARIAQN-TRQVSSRMSWSRNYAAKEIKFGVEARALMLKGVEDLADAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKS+ARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSKARMISTSEEIAQ  176



>ref|XP_008235753.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Prunus mume]
Length=555

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA +LASKAR+A+N TQQIGSSL   RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRFAGSLASKARLARNCTQQIGSSLISRRNYAAKDIKFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFRDKVKNIGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010550847.1| PREDICTED: chaperonin CPN60, mitochondrial-like [Tarenaya hassleriana]
Length=574

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 171/177 (97%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKARVA+NS +Q+ S ++WSRNYAAKDI+FGVEARALML+GVE+LADAV+V
Sbjct  1    MYRFASNLASKARVARNS-RQVASRMNWSRNYAAKDIKFGVEARALMLKGVEDLADAVRV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIAMAVDAVVTNLKSRARMISTSEEIAQ  176



>ref|XP_002885624.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61883.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 171/177 (97%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+A+N T Q+ S +SWSRNYAAK+I+FGVEARALML+GVE+LADAVKV
Sbjct  1    MYRFASNLASKARIAQN-TSQVSSRMSWSRNYAAKEIKFGVEARALMLKGVEDLADAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  176



>ref|XP_008810807.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Phoenix dactylifera]
Length=576

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR+A +S++Q+GS L WSRNYAAKDIRFGVEARALML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARIAGSSSRQVGSRLGWSRNYAAKDIRFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR+VV+EQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRHVVLEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_006297236.1| hypothetical protein CARUB_v10013241mg, partial [Capsella rubella]
 gb|EOA30134.1| hypothetical protein CARUB_v10013241mg, partial [Capsella rubella]
Length=617

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+A+N T+Q+ S +SWSRNYAAK+I+FGVEARALML+GVE+LADAVKV
Sbjct  41   MYRFASNLASKARIAQN-TRQVSSRMSWSRNYAAKEIKFGVEARALMLKGVEDLADAVKV  99

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  100  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  159

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKS+ARMISTSEEIAQ
Sbjct  160  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSKARMISTSEEIAQ  216



>ref|NP_189041.1| heat shock protein 60 [Arabidopsis thaliana]
 sp|P29197.2|CH60A_ARATH RecName: Full=Chaperonin CPN60, mitochondrial; AltName: Full=HSP60; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03017.1| chaperonin hsp60, mitochondrial precursor (HSP60) [Arabidopsis 
thaliana]
 gb|AAM20445.1| mitochondrial chaperonin hsp60 [Arabidopsis thaliana]
 gb|AAQ56841.1| At3g23990 [Arabidopsis thaliana]
 gb|AEE76842.1| heat shock protein 60 [Arabidopsis thaliana]
Length=577

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 173/177 (98%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+A+N+ +Q+ S +SWSRNYAAK+I+FGVEARALML+GVE+LADAVKV
Sbjct  1    MYRFASNLASKARIAQNA-RQVSSRMSWSRNYAAKEIKFGVEARALMLKGVEDLADAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKS+ARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSKARMISTSEEIAQ  176



>emb|CAA77646.1| chaperonin hsp60 [Arabidopsis thaliana]
Length=577

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 173/177 (98%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+A+N+ +Q+ S +SWSRNYAAK+I+FGVEARALML+GVE+LADAVKV
Sbjct  1    MYRFASNLASKARIAQNA-RQVSSRMSWSRNYAAKEIKFGVEARALMLKGVEDLADAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKS+ARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSKARMISTSEEIAQ  176



>ref|XP_002299295.2| Chaperonin CPN60-2 family protein [Populus trichocarpa]
 gb|EEE84100.2| Chaperonin CPN60-2 family protein [Populus trichocarpa]
Length=574

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RF ++LASKAR+A++ST QIGS LSWSRNYAAKDIRFGVEARA ML+GVEELADAVKV
Sbjct  1    MHRFTSSLASKARIARSSTNQIGSRLSWSRNYAAKDIRFGVEARAGMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAV+SVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTQAIFTEGCKSVAAGMNAMDLRRGISMAVESVVTNLKSRARMISTSEEIAQ  177



>ref|XP_009362047.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Pyrus x bretschneideri]
Length=578

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKARVA+N T+QIG  LSWSRNYAAKDI+FGVEARALML GVEELADAVKV
Sbjct  1    MYRFASSLASKARVARNCTKQIGGRLSWSRNYAAKDIKFGVEARALMLSGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            T AT+LT+AI+ EGCKSVAAGMNAMDLRRGIT AVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TLATILTKAIYTEGCKSVAAGMNAMDLRRGITSAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010466805.1| PREDICTED: chaperonin CPN60, mitochondrial [Camelina sativa]
 ref|XP_010488513.1| PREDICTED: chaperonin CPN60, mitochondrial [Camelina sativa]
Length=577

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 172/177 (97%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA+NLASKAR+A+N+ +Q+ S +SWSRNYAAK+I+FGVEARALML+GVE+LADAVKV
Sbjct  1    MYRFASNLASKARIAQNA-RQVSSRMSWSRNYAAKEIKFGVEARALMLKGVEDLADAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQSWGAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKS+ARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSKARMISTSEEIAQ  176



>ref|XP_009377449.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Pyrus x bretschneideri]
Length=578

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKARVA+N T+QIG  LSWSRNYAAKDI+FGVEARALML GVEELADAVKV
Sbjct  1    MYRFASSLASKARVARNCTKQIGGRLSWSRNYAAKDIKFGVEARALMLSGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            T AT+LT+AI+ EGCKSVAAGMNAMDLRRGIT A+DSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TLATILTKAIYTEGCKSVAAGMNAMDLRRGITSAIDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010933209.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Elaeis guineensis]
Length=575

 Score =   324 bits (830),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR+A +S++QIGS L W+RNYAAKDIRFGVEAR+LML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARIAGSSSRQIGSRLGWNRNYAAKDIRFGVEARSLMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNMGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_004496079.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cicer arietinum]
Length=575

 Score =   324 bits (830),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+N+T QIGS + W+RNYAAK+I+FGVEARALML+GVEELA+AVKV
Sbjct  1    MYRFASSLASKARIARNNTHQIGSRVGWNRNYAAKEIKFGVEARALMLKGVEELAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGI MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIFTEGCKSVAAGMNAMDLRRGINMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010556941.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Tarenaya hassleriana]
Length=576

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRF +++ASK R+A+N T QIGS L+ SRNYAAKDIRFGVEARALML+GVEELADAV+V
Sbjct  1    MYRFVSSIASKTRIARNCTNQIGSRLTSSRNYAAKDIRFGVEARALMLKGVEELADAVRV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VV+EQSWGAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRTVVLEQSWGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_004299212.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=577

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A++LASKAR  +N+ QQIG  L+WSRNYAAKDIRFGV+ARALML G+E+LADAVKV
Sbjct  1    MYRLASSLASKARGIRNNAQQIGGRLNWSRNYAAKDIRFGVDARALMLSGIEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAI+ EGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIYTEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_008460701.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Cucumis melo]
Length=575

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RFA+ LASKAR+A+NST QI S  SWSRNYAAKD++FGVEAR LML+GVE+LA+AVKV
Sbjct  1    MHRFASGLASKARLARNSTNQIASRSSWSRNYAAKDVKFGVEARGLMLKGVEDLAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSRARMISTSEEIAQ  177



>emb|CDX84697.1| BnaA03g15330D [Brassica napus]
Length=563

 Score =   322 bits (824),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +++ASKARVA+N T QIGS LS +RNYAAKDIRFGVE RALML+GVEELADAVKV
Sbjct  1    MYRLISSIASKARVARNCTSQIGSRLSSTRNYAAKDIRFGVEGRALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLKSRARMISTSEEIAQ  177



>ref|XP_003591643.1| Chaperonin CPN60-like protein [Medicago truncatula]
 gb|ABE86688.1| GroEL-like chaperone, ATPase [Medicago truncatula]
 gb|AES61894.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=574

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+++  QIGS ++WSRNYAAK+I+FGVEARALML+GVEELA+AVKV
Sbjct  1    MYRFASSLASKARIARSNANQIGSRVAWSRNYAAKEIKFGVEARALMLKGVEELAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGINMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_009420744.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=575

 Score =   321 bits (823),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  ++LASKARVA+ S  QIGS L WSRNYAAKDIRFGVEARALML+GVE+LADAVKV
Sbjct  1    MYRAISSLASKARVARGSGGQIGSRLGWSRNYAAKDIRFGVEARALMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +++KN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRIKNMGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF+EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIFSEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_009132917.1| PREDICTED: chaperonin CPN60, mitochondrial [Brassica rapa]
Length=584

 Score =   322 bits (824),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +++ASKARVA+N T QIGS LS +RNYAAKDIRFGVE RALML+GVEELADAVKV
Sbjct  1    MYRLISSIASKARVARNCTSQIGSRLSSTRNYAAKDIRFGVEGRALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLKSRARMISTSEEIAQ  177



>gb|KFK31072.1| hypothetical protein AALP_AA6G064600 [Arabis alpina]
Length=583

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +N+ASKARVA+  T QIGS L+ +RNYAAKDI+FGVEARALML+GVEELADAV+V
Sbjct  1    MYRLVSNIASKARVARQCTSQIGSRLNSTRNYAAKDIKFGVEARALMLRGVEELADAVRV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI MAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_008812917.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Phoenix dactylifera]
Length=621

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  176  LLVKIMYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELA  355
             L   MYR  A+LASKAR+A++S +QIGS L W+RNYAAKDI+FGVEAR LML+GVEELA
Sbjct  42   FLFSTMYRAVASLASKARIAESSRRQIGSRLGWNRNYAAKDIKFGVEARCLMLKGVEELA  101

Query  356  DAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDV  535
            DAVKVTMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDV
Sbjct  102  DAVKVTMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNMGASLVKQVANATNDV  161

Query  536  AGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEI  715
            AGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEI
Sbjct  162  AGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEI  221

Query  716  AQ  721
            AQ
Sbjct  222  AQ  223



>ref|XP_004147171.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Cucumis sativus]
 gb|KGN61548.1| hypothetical protein Csa_2G169720 [Cucumis sativus]
Length=575

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RFA+ LASKAR+A+NST QI S  +WSRNYAAKD++FGVEAR LML+GVE+LA+AVKV
Sbjct  1    MHRFASGLASKARLARNSTNQIASRSNWSRNYAAKDVKFGVEARGLMLKGVEDLAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +K+KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIFMEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_008346198.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Malus domestica]
Length=575

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA NLASKAR+A+NS+QQIGS L   RNYAAK+IRFGVEARA ML+GVEELADAVKV
Sbjct  1    MYRFATNLASKARLARNSSQQIGSKLISRRNYAAKEIRFGVEARAGMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVV NLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVANLKSRARMISTSEEIAQ  177



>ref|XP_008372428.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin CPN60-2, mitochondrial-like 
[Malus domestica]
Length=576

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA NLASKAR+A+NS+QQIGS L   RNYAAK+IRFGVEARA ML+GVEELADAVKV
Sbjct  1    MYRFATNLASKARLARNSSQQIGSKLISRRNYAAKEIRFGVEARAGMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVV NLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVANLKSRARMISTSEEIAQ  177



>ref|XP_009371099.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Pyrus x bretschneideri]
Length=575

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA NLASKAR+A+NS+QQIGS L   RNYAAK+IRFGVEARA ML+GVEELADAVKV
Sbjct  1    MYRFATNLASKARLARNSSQQIGSKLISRRNYAAKEIRFGVEARAGMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVV NLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVANLKSRARMISTSEEIAQ  177



>ref|XP_006293894.1| hypothetical protein CARUB_v10022887mg [Capsella rubella]
 gb|EOA26792.1| hypothetical protein CARUB_v10022887mg [Capsella rubella]
Length=583

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR   N+ASKAR+A+N T QIGS L+ +RNYAAKDIRFGVEARALML+GVE+LADAVKV
Sbjct  1    MYRLVTNVASKARIARNCTSQIGSRLNSTRNYAAKDIRFGVEARALMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFQDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNL+SRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQ  177



>ref|XP_009405691.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=577

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  A+LAS+ARVA +S++QIGS + WSRNYAAKDIRFGVEARALML+GVEELADAVKV
Sbjct  1    MYRAMASLASRARVAGSSSKQIGSRVGWSRNYAAKDIRFGVEARALMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +++KN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRIKNMGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LT+AIFAEGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTKAIFAEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_006410461.1| hypothetical protein EUTSA_v10016427mg [Eutrema salsugineum]
 gb|ESQ51914.1| hypothetical protein EUTSA_v10016427mg [Eutrema salsugineum]
Length=582

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +N+ASKAR+A+N T Q+GS L+ +RNYAAKDIRFGVEARA ML+GVEELADAVKV
Sbjct  1    MYRLVSNIASKARIARNCTSQVGSRLNSTRNYAAKDIRFGVEARASMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLKSRARMISTSEEIAQ  177



>ref|XP_011002149.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Populus euphratica]
Length=574

 Score =   319 bits (818),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RF ++LASKAR+ ++ T QIGS LSWSRNYAAKDIRFGVEAR+ ML+GVEELADAVKV
Sbjct  1    MHRFTSSLASKARIVRSKTNQIGSRLSWSRNYAAKDIRFGVEARSGMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAV+SVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTQAIFTEGCKSVAAGMNAMDLRRGISMAVESVVTNLKSRARMISTSEEIAQ  177



>ref|XP_002881268.1| hypothetical protein ARALYDRAFT_902390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57527.1| hypothetical protein ARALYDRAFT_902390 [Arabidopsis lyrata subsp. 
lyrata]
Length=581

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR   N+ASKAR+A+N T QIGS L+ +RNYAAKDIRFGVEARALML+GVE+LADAVKV
Sbjct  1    MYRLVTNVASKARIARNCTSQIGSRLNSTRNYAAKDIRFGVEARALMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF +++KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNL+SRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQ  177



>emb|CDY17152.1| BnaA05g10360D [Brassica napus]
Length=574

 Score =   319 bits (818),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +++ASKARVA+N T QIGS LS +RNYAAKDI+FGVE RALML+GVEELADAV+V
Sbjct  1    MYRLVSSIASKARVARNGTTQIGSRLSATRNYAAKDIKFGVEGRALMLRGVEELADAVQV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLKSRARMISTSEEIAQ  177



>emb|CDP03832.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   319 bits (817),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AANL SKA VA+N+TQQ+GS L+W RNYAAKDI FGVEAR+LMLQGV+ELADAVKV
Sbjct  1    MYRLAANLVSKACVARNATQQVGSRLAWIRNYAAKDILFGVEARSLMLQGVDELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+G PKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGTPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+L RAI++EGCKSVAAGMNAMDLRRGI+MA+DSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILARAIYSEGCKSVAAGMNAMDLRRGISMAIDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_006410460.1| hypothetical protein EUTSA_v10016425mg [Eutrema salsugineum]
 gb|ESQ51913.1| hypothetical protein EUTSA_v10016425mg [Eutrema salsugineum]
Length=583

 Score =   319 bits (817),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR   N+ASKAR+A+N T Q+GS L+ +RNYAAKDIRFGVEARA ML+GVEELADAVKV
Sbjct  1    MYRLLTNIASKARIARNCTSQVGSRLNSTRNYAAKDIRFGVEARASMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLKSRARMISTSEEIAQ  177



>emb|CDX94835.1| BnaC03g43530D [Brassica napus]
Length=577

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RF ++LASKAR+A N T+Q+ S +SWSRNYAAK+I+FGVEARALML+GVEELADAV+V
Sbjct  1    MFRFVSSLASKARIASN-TRQVSSRMSWSRNYAAKEIKFGVEARALMLKGVEELADAVRV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VVIEQSWGAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRTVVIEQSWGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  176



>ref|XP_009143882.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Brassica rapa]
Length=586

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +++ASKARVA+N T QIGS LS +RNYAAKDI+FGVE RALML+GVEELADAV+V
Sbjct  1    MYRLVSSIASKARVARNGTTQIGSRLSSTRNYAAKDIKFGVEGRALMLRGVEELADAVQV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLKSRARMISTSEEIAQ  177



>ref|XP_003591642.1| Chaperonin CPN60-2 [Medicago truncatula]
 gb|ABE86687.1| GroEL-like chaperone, ATPase [Medicago truncatula]
 gb|AES61893.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=576

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA++LASKAR+A+N+ QQ+GS ++W+RNYAAK+I+FGVEARALML+GVE+LA+AVKV
Sbjct  1    MYRFASSLASKARIARNNVQQVGSRVAWNRNYAAKEIKFGVEARALMLKGVEDLAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF  KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKCKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF+EGCKSVAAGMNAMDLRRGI MAVD+VVT+LKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIFSEGCKSVAAGMNAMDLRRGINMAVDAVVTSLKSRARMISTSEEIAQ  177



>gb|AFW68651.1| chaperonin 1, partial [Zea mays]
Length=382

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNS--TQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A NS  T+Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGNSLATRQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>ref|XP_009135882.1| PREDICTED: chaperonin CPN60, mitochondrial [Brassica rapa]
Length=577

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RF ++LASKAR+A N T+Q+ S +SWSRNYAAK+I+FGVEARALML+GVEELADAV+V
Sbjct  1    MFRFVSSLASKARIASN-TRQVSSRMSWSRNYAAKEIKFGVEARALMLRGVEELADAVRV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VVIEQSWGAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRTVVIEQSWGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  120  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  176



>sp|Q05046.1|CH62_CUCMA RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; 
Flags: Precursor [Cucurbita maxima]
 pir||S29316 chaperonin 60 - cucurbit
 emb|CAA50218.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri]
Length=575

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RFA+ LASKAR+A+    QI S  SWSRNYAAKD++FGVEAR LML+GVE+LADAVKV
Sbjct  1    MHRFASGLASKARLARKGANQIASRSSWSRNYAAKDVKFGVEARGLMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_008358471.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Malus domestica]
Length=576

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA NLASKARVA+NS+ QIGS L   RNYAAK+IRFGVEARA ML+GVEELADAVKV
Sbjct  1    MYRFATNLASKARVARNSSXQIGSKLISRRNYAAKEIRFGVEARAGMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVV NLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVANLKSRARMISTSEEIAQ  177



>ref|XP_006841664.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Amborella trichopoda]
 gb|ERN03339.1| hypothetical protein AMTR_s00003p00241820 [Amborella trichopoda]
Length=575

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 171/177 (97%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA LASKAR + N++QQIGS +SW+RNYAAKDI+FGVEARALML+GVEELADAV+V
Sbjct  1    MYRAAARLASKARFS-NASQQIGSRVSWNRNYAAKDIKFGVEARALMLKGVEELADAVQV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +++KNVGASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRIKNVGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAI+AEGCKSVAAGMNAMDLRRGITMAVD+VVT+LKSRARMISTSEEIAQ
Sbjct  120  TCATLLTRAIYAEGCKSVAAGMNAMDLRRGITMAVDTVVTSLKSRARMISTSEEIAQ  176



>emb|CDY19471.1| BnaC04g11280D [Brassica napus]
Length=593

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +++ASKARVA+N T QIGS LS +RNYAAKDI+FGVE RALML+GVEELADAV+V
Sbjct  1    MYRLVSSVASKARVARNCTTQIGSRLSATRNYAAKDIKFGVEGRALMLRGVEELADAVQV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLKSRARMISTSEEIAQ  177



>ref|NP_001189665.1| heat shock protein 60-2 [Arabidopsis thaliana]
 gb|AEC08800.1| heat shock protein 60-2 [Arabidopsis thaliana]
Length=580

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +N+ASKAR+A+  T QIGS L+ +RNYAAKDIRFGVEARALML+GVE+LADAVKV
Sbjct  1    MYRLVSNVASKARIARKCTSQIGSRLNSTRNYAAKDIRFGVEARALMLRGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF +++KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNL+SRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQ  177



>ref|XP_011020718.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X1 
[Populus euphratica]
 ref|XP_011020719.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X1 
[Populus euphratica]
 ref|XP_011020720.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X2 
[Populus euphratica]
Length=574

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RF ++LASK+R+A+++T+QIGS LSWSRNYAAKDIRFGVEARA+ML+GVEELADAVKV
Sbjct  1    MHRFTSSLASKSRIARSTTKQIGSRLSWSRNYAAKDIRFGVEARAVMLKGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATND AGDG 
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDAAGDGA  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFA GCKSVAAGMNAM LRRGI+MAV+SVVTNLKSR RMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAAGCKSVAAGMNAMGLRRGISMAVESVVTNLKSRTRMISTSEEIAQ  177



>gb|KFK31073.1| hypothetical protein AALP_AA6G064700 [Arabis alpina]
Length=580

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +N+ASKARVA+  T QIGS  + +RNYAAKDI FGVE RALML+GVEELADAV+V
Sbjct  1    MYRLVSNIASKARVARKCTTQIGSRFNSTRNYAAKDIHFGVEGRALMLRGVEELADAVRV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI MAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_011024539.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Populus euphratica]
Length=575

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 1/178 (1%)
 Frame = +2

Query  191  MYRFAANLASKAR-VAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            MYRFA+ LASKA  VA N+ +QIGS L+W RNYAAKDI+FGVEARALML+GVEELADAV+
Sbjct  1    MYRFASGLASKASGVAGNNAKQIGSRLAWRRNYAAKDIKFGVEARALMLRGVEELADAVQ  60

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGRNVV+EQSWGAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDG
Sbjct  61   VTMGPKGRNVVLEQSWGAPKVTKDGVTVAKSIEFQDRVKNIGASLVKQVANATNDVAGDG  120

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGI+MAV++VVT+LKSRARMISTSEEIAQ
Sbjct  121  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGISMAVEAVVTSLKSRARMISTSEEIAQ  178



>ref|NP_850203.1| heat shock protein 60-2 [Arabidopsis thaliana]
 sp|Q8L7B5.1|CH60B_ARATH RecName: Full=Chaperonin CPN60-like 1, mitochondrial; AltName: 
Full=HSP60-like 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM97026.1| mitochondrial chaperonin HSP60 [Arabidopsis thaliana]
 gb|AAN15422.1| mitochondrial chaperonin HSP60 [Arabidopsis thaliana]
 dbj|BAD43178.1| mitochondrial chaperonin (HSP60) [Arabidopsis thaliana]
 gb|AEC08799.1| heat shock protein 60-2 [Arabidopsis thaliana]
Length=585

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +N+ASKAR+A+  T QIGS L+ +RNYAAKDIRFGVEARALML+GVE+LADAVKV
Sbjct  1    MYRLVSNVASKARIARKCTSQIGSRLNSTRNYAAKDIRFGVEARALMLRGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF +++KNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRIKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNL+SRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQ  177



>ref|XP_002303091.1| Chaperonin CPN60-2 family protein [Populus trichocarpa]
 gb|EEE82364.1| Chaperonin CPN60-2 family protein [Populus trichocarpa]
Length=575

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 1/178 (1%)
 Frame = +2

Query  191  MYRFAANLASKAR-VAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            MYRFA+ LASKA  VA N+ +QIGS L+W RNYAAKDI+FGVEARALML+GVEELADAV+
Sbjct  1    MYRFASGLASKASGVAGNNAKQIGSRLAWRRNYAAKDIKFGVEARALMLRGVEELADAVQ  60

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGRNVV+EQSWGAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDG
Sbjct  61   VTMGPKGRNVVLEQSWGAPKVTKDGVTVAKSIEFQDRVKNIGASLVKQVANATNDVAGDG  120

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGI+MAV++VVT+LKSRARMISTSEEIAQ
Sbjct  121  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGISMAVEAVVTSLKSRARMISTSEEIAQ  178



>ref|XP_004496080.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cicer arietinum]
Length=575

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRFA ++A+K R+A+N+ Q++GS + W+RNYAAKDI+FGVEARALML+GVEELA+AVKV
Sbjct  1    MYRFATSIATKTRIARNNVQRVGSRVGWNRNYAAKDIKFGVEARALMLKGVEELAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF EGCKSVAAGMNAMDLRRGI MAVD+VVT+LKSRARMISTSEEIAQ
Sbjct  121  TCATILTRAIFTEGCKSVAAGMNAMDLRRGINMAVDAVVTSLKSRARMISTSEEIAQ  177



>ref|XP_010522438.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Tarenaya hassleriana]
Length=580

 Score =   317 bits (811),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYRF ++ ASK R+A+NS  QIGS L+  RNYAAKDI+FGVEARALML+GVEELADAV+V
Sbjct  1    MYRFVSSFASKTRIARNSANQIGSRLTSRRNYAAKDIKFGVEARALMLKGVEELADAVRV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VVIEQSWGAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRTVVIEQSWGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIFAEGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKS ARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSMARMISTSEEIAQ  177



>ref|XP_010509916.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=585

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR   N+ASKAR+A   T+QIGS L+ +RNYAAKDIRFGVEARA+ML+GVE+LADAVKV
Sbjct  1    MYRLVTNVASKARIASKCTRQIGSRLNSTRNYAAKDIRFGVEARAMMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNL+SRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQ  177



>gb|KJB42388.1| hypothetical protein B456_007G151700 [Gossypium raimondii]
Length=516

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MY    +LASKAR+AKN  Q  G+ LSWSRNYAAKDI+FGVEARALML GV+ELADAVK+
Sbjct  1    MYSHLTSLASKARLAKNRIQLNGTRLSWSRNYAAKDIKFGVEARALMLSGVQELADAVKL  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_010413901.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=583

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR   N+ASKAR+A   T QIGS L+ +RNYAAKDIRFGVEARA+ML+GVE+LADAVKV
Sbjct  1    MYRLLTNVASKARIASKCTSQIGSRLNSTRNYAAKDIRFGVEARAMMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNL+SRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQ  177



>gb|KJB42386.1| hypothetical protein B456_007G151700 [Gossypium raimondii]
Length=575

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MY    +LASKAR+AKN  Q  G+ LSWSRNYAAKDI+FGVEARALML GV+ELADAVK+
Sbjct  1    MYSHLTSLASKARLAKNRIQLNGTRLSWSRNYAAKDIKFGVEARALMLSGVQELADAVKL  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>gb|KJB42387.1| hypothetical protein B456_007G151700 [Gossypium raimondii]
Length=510

 Score =   312 bits (799),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MY    +LASKAR+AKN  Q  G+ LSWSRNYAAKDI+FGVEARALML GV+ELADAVK+
Sbjct  1    MYSHLTSLASKARLAKNRIQLNGTRLSWSRNYAAKDIKFGVEARALMLSGVQELADAVKL  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  177



>ref|XP_006662418.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Oryza brachyantha]
Length=574

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR A +S +Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARQAGSSARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  177



>gb|AAA33450.1| chaperonin 60 [Zea mays]
Length=577

 Score =   313 bits (803),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNS--TQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A NS  T+Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGNSLATRQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>ref|XP_010469503.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=585

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR   N+ASKAR+A   T QIGS  + +RNYAAKDIRFGVEARA+ML+GVE+LADAVKV
Sbjct  1    MYRLVTNVASKARIASKCTSQIGSRFNSTRNYAAKDIRFGVEARAMMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNL+SRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQ  177



>sp|P29185.2|CH61_MAIZE RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; 
Flags: Precursor [Zea mays]
Length=577

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNS--TQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A NS  T+Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGNSLATRQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>ref|XP_008644293.1| PREDICTED: chaperonin CPN60-1, mitochondrial isoform X1 [Zea 
mays]
Length=579

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNS--TQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A NS  T+Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGNSLATRQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>gb|ACL52466.1| unknown [Zea mays]
Length=381

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNST--QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR A +LASKAR A +S+  +Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAVSLASKARQAGSSSAARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>ref|NP_001105716.1| chaperonin CPN60-1, mitochondrial precursor [Zea mays]
 emb|CAA78100.1| mitochondrial chaperonin-60 [Zea mays]
Length=577

 Score =   311 bits (797),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNS--TQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A NS   +Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGNSLAARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>sp|Q05045.1|CH61_CUCMA RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; 
Flags: Precursor [Cucurbita maxima]
 pir||S29315 chaperonin 60 - cucurbit
 emb|CAA50217.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri]
Length=575

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RFA  LASKAR+A+N   QI S  +W RNYAAKD++FGVEAR LML+GVE+LADAVKV
Sbjct  1    MHRFATGLASKARLARNGANQIASRSNWRRNYAAKDVKFGVEARGLMLKGVEDLADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VVIEQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRTVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LT+AIF EGCKSVA+GMNAMDLRRGI+MAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  TCATILTKAIFTEGCKSVASGMNAMDLRRGISMAVDSVVTNLKSRARMISTSEEIAQ  177



>ref|XP_003558831.1| PREDICTED: chaperonin CPN60-1, mitochondrial [Brachypodium distachyon]
Length=575

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR A +S +Q+GS L+WSRNYAAKDIRFGVEARALML GVEELADAVKV
Sbjct  1    MYRAAASLASKARQAGSSARQVGSRLAWSRNYAAKDIRFGVEARALMLSGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRTVIIEQSFGAPKVTKDGVTVAKSIEFTDRVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLK  ARMI+T EEIAQ
Sbjct  121  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKGMARMINTPEEIAQ  177



>ref|NP_001048938.1| Os03g0143400 [Oryza sativa Japonica Group]
 gb|ABF93929.1| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10852.1| Os03g0143400 [Oryza sativa Japonica Group]
 dbj|BAG93753.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74496.1| hypothetical protein OsI_09970 [Oryza sativa Indica Group]
 gb|EEE58306.1| hypothetical protein OsJ_09368 [Oryza sativa Japonica Group]
 gb|ADB84620.1| chaperonin [Oryza sativa Japonica Group]
Length=577

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR A +S +QIGS L+  RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARQAGSSARQIGSRLALHRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VVIEQS+GAPKVTKDGVTVAKS+EF+N+VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRTVVIEQSFGAPKVTKDGVTVAKSIEFSNRVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIFAEGCKSVAAGMNAMDLRRGI+MAVD VVTNLK  ARMISTSEEIAQ
Sbjct  121  TCATVLTKAIFAEGCKSVAAGMNAMDLRRGISMAVDEVVTNLKGMARMISTSEEIAQ  177



>ref|XP_004139642.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cucumis sativus]
 gb|KGN44557.1| hypothetical protein Csa_7G332900 [Cucumis sativus]
Length=572

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RFA+ LASKAR+A NS +QI S  + SRNYAAK I+FGVEAR LML+GVEELADAVKV
Sbjct  1    MHRFASGLASKARLANNSARQINSRFNSSRNYAAKHIKFGVEARTLMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKNVGASLVKQVANATNDVAGDGT
Sbjct  61   TMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFEDKVKNVGASLVKQVANATNDVAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVA+G+NAMDLRRGITMAVDSV+T LKSRARMISTSEEIAQ
Sbjct  121  TCATVLTRAIFTEGCKSVASGVNAMDLRRGITMAVDSVITTLKSRARMISTSEEIAQ  177



>gb|EMS57340.1| Chaperonin CPN60-2, mitochondrial [Triticum urartu]
Length=587

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR+A +S +Q+GS L+WSRNYAAKDIRFGVEARA+ML+GVE+LADAVK+
Sbjct  1    MYRAAASLASKARLAGSSARQVGSRLAWSRNYAAKDIRFGVEARAMMLKGVEDLADAVKL  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IEQS+GAPKVTKDGVTVAKS+EF+++VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRTVIIEQSFGAPKVTKDGVTVAKSIEFSDRVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLK  ARMI+TSEEIAQ
Sbjct  121  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKGMARMINTSEEIAQ  177



>ref|NP_001105690.1| chaperonin CPN60-2, mitochondrial precursor [Zea mays]
 sp|Q43298.1|CH62_MAIZE RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; 
Flags: Precursor [Zea mays]
 gb|AAA33451.1| chaperonin 60 [Zea mays]
 gb|AAA33452.1| mitochondrial chaperonin 60 [Zea mays]
 tpg|DAA49764.1| TPA: putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=576

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNST--QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A +S+  +Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGSSSAARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>ref|NP_001064784.1| Os10g0462900 [Oryza sativa Japonica Group]
 gb|AAN05528.1| mitochondrial chaperonin-60 [Oryza sativa Japonica Group]
 dbj|BAF26698.1| Os10g0462900 [Oryza sativa Japonica Group]
 gb|EEC67118.1| hypothetical protein OsI_33923 [Oryza sativa Indica Group]
 gb|EEE51095.1| hypothetical protein OsJ_31804 [Oryza sativa Japonica Group]
 gb|ADR66966.1| 60 kDa chaperonin [Oryza sativa Japonica Group]
Length=574

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR A +S +Q+GS L+ SRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARQAGSSARQVGSRLALSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+G+PKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRNVVIEQSYGSPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  177



>ref|XP_002467123.1| hypothetical protein SORBIDRAFT_01g020010 [Sorghum bicolor]
 gb|EER94121.1| hypothetical protein SORBIDRAFT_01g020010 [Sorghum bicolor]
Length=577

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNST--QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A +S   +Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGSSAAARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK+ ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKNMARMISTSEEIAQ  179



>ref|XP_004982955.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Setaria italica]
Length=576

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNST--QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A +S   +Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGSSAAARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>ref|XP_011622760.1| PREDICTED: chaperonin CPN60, mitochondrial [Amborella trichopoda]
Length=575

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 170/177 (96%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ L +K+R+ +N++ QIGS ++W+RNYAAKDIRFG++ARALML+GVE+LADAV++
Sbjct  1    MYRLASGLLAKSRI-RNTSSQIGSRVNWNRNYAAKDIRFGIDARALMLKGVEDLADAVRI  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGT
Sbjct  60   TMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNMGASLVKQVANATNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCAT+LTRAIF+EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  120  TCATILTRAIFSEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  176



>dbj|BAK05600.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   308 bits (790),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR A +S +Q+GS L+WSRNYAAKDIRFGVEARA ML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARQAGSSARQVGSRLAWSRNYAAKDIRFGVEARASMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRTVIIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDSAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD VVTNLK  ARMISTSEEIAQ
Sbjct  121  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDDVVTNLKGMARMISTSEEIAQ  177



>ref|XP_004985740.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Setaria italica]
Length=570

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR A +  +Q+GS L+WSRNYAAKDI+FGV+ARALML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARQAGSGARQVGSRLAWSRNYAAKDIKFGVQARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IEQS+GAPKVTKDGVTVAKS+EF+++VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRTVIIEQSFGAPKVTKDGVTVAKSIEFSDRVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  177



>gb|EMT05673.1| Chaperonin CPN60-2, mitochondrial [Aegilops tauschii]
Length=574

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR A +S +Q+GS L+WSRNYAAKDIRFGVEARA ML+GVEELADAVKV
Sbjct  1    MYRAAASLASKARQAGSSARQVGSRLAWSRNYAAKDIRFGVEARASMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRTVIIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDSAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD VVTNLK  ARMISTSEEIAQ
Sbjct  121  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDDVVTNLKGMARMISTSEEIAQ  177



>gb|EPS59136.1| hypothetical protein M569_15674, partial [Genlisea aurea]
Length=313

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  248  QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPK  427
            QQIG  LSWSRNYAAKDIRFGVEARALML+GVEELADAVK+TMGPKGRNVVIEQSWGAPK
Sbjct  3    QQIGGRLSWSRNYAAKDIRFGVEARALMLKGVEELADAVKITMGPKGRNVVIEQSWGAPK  62

Query  428  VTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVA  607
            VTKDGVTVAKS+EF +KVKN+GASLVKQVANATND AGDGTTCATVLTRAIF EGCKSVA
Sbjct  63   VTKDGVTVAKSIEFKDKVKNIGASLVKQVANATNDAAGDGTTCATVLTRAIFTEGCKSVA  122

Query  608  AGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AGMNAMDLRRGIT AV++VVTNLKSRARMISTSEEIAQ
Sbjct  123  AGMNAMDLRRGITNAVEAVVTNLKSRARMISTSEEIAQ  160



>gb|AAP54159.2| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=634

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR A +S +Q+GS L+ SRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  61   MYRAAASLASKARQAGSSARQVGSRLALSRNYAAKDIKFGVEARALMLRGVEELADAVKV  120

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNVVIEQS+G+PKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGDGT
Sbjct  121  TMGPKGRNVVIEQSYGSPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGDGT  180

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  181  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  237



>ref|XP_003574012.1| PREDICTED: chaperonin CPN60-1, mitochondrial [Brachypodium distachyon]
Length=574

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A +LASKAR A +S +Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRAAVSLASKARQAGSSARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRTVIIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF+EGCKSVAAGMNAMDLRRGI+MAVD VVTNLK  ARMIST EEIAQ
Sbjct  121  TCATVLTKAIFSEGCKSVAAGMNAMDLRRGISMAVDDVVTNLKGMARMISTPEEIAQ  177



>emb|CAA78101.1| mitochondrial chaperonin-60 [Zea mays]
Length=576

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNST--QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A +S+  +Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGSSSAARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDNAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>emb|CAA77645.1| chaperonin hsp60 [Zea mays]
Length=577

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 2/179 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNS--TQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A NS  T+Q+GS L+WSRNYAAKDI+FGVEARALML+GVEELADAV
Sbjct  1    MYRAAASLASKARQAGNSLATRQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLV +VANATND AGD
Sbjct  61   KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVNRVANATNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTC TVLT+AIF EGCKSVAAGMNAM+LRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  GTTCDTVLTKAIFTEGCKSVAAGMNAMNLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  179



>sp|P35480.1|CH60_BRANA RecName: Full=Chaperonin CPN60, mitochondrial; Flags: Precursor 
[Brassica napus]
 emb|CAA81689.1| mitochondrial chaperonin [Brassica napus]
Length=587

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 160/180 (89%), Gaps = 3/180 (2%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  +++ASKARVA+N T QIGS LS +RNYAAKDIRFGVE RALML+GVEELADAVKV
Sbjct  1    MYRLISSIASKARVARNCTSQIGSRLSSTRNYAAKDIRFGVEGRALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVAN---ATNDVAG  541
            T+ PKGRNV+IEQSWGAPKVTKDGVTVAKS+EF ++VKNVGASLVKQVAN     N   G
Sbjct  61   TIPPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANRPTQLNRCLG  120

Query  542  DGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            DGTTCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVT LKSRARMISTSEEIAQ
Sbjct  121  DGTTCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTKLKSRARMISTSEEIAQ  180



>ref|XP_002465871.1| hypothetical protein SORBIDRAFT_01g047360 [Sorghum bicolor]
 gb|EER92869.1| hypothetical protein SORBIDRAFT_01g047360 [Sorghum bicolor]
Length=169

 Score =   281 bits (720),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 2/169 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNST--QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR AA+LASKAR A +S   +Q+  SL+WSRNYAAKDI+FGV+AR LML+GVEELADAV
Sbjct  1    MYRAAASLASKARHAGSSARQEQVAGSLAWSRNYAAKDIKFGVQARVLMLRGVEELADAV  60

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGR V+IEQS+GAPKVTKDGVTVAKS+EF+++VKNVGASLVKQVAN+TND AGD
Sbjct  61   KVTMGPKGRTVIIEQSFGAPKVTKDGVTVAKSIEFSDRVKNVGASLVKQVANSTNDTAGD  120

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRAR  691
            GTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKS A+
Sbjct  121  GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSMAK  169



>gb|ERN04382.1| hypothetical protein AMTR_s00147p00091670 [Amborella trichopoda]
Length=560

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  254  IGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVT  433
            IGS ++W+RNYAAKDIRFG++ARALML+GVE+LADAV++TMGPKGRNVVIEQS+GAPKVT
Sbjct  6    IGSRVNWNRNYAAKDIRFGIDARALMLKGVEDLADAVRITMGPKGRNVVIEQSFGAPKVT  65

Query  434  KDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAG  613
            KDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGTTCAT+LTRAIF+EGCKSVAAG
Sbjct  66   KDGVTVAKSIEFKDRVKNMGASLVKQVANATNDVAGDGTTCATILTRAIFSEGCKSVAAG  125

Query  614  MNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            MNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  126  MNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  161



>gb|EMT21164.1| Chaperonin CPN60-2, mitochondrial [Aegilops tauschii]
Length=626

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 168/216 (78%), Gaps = 39/216 (18%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LASKAR+A +S +Q+GS L+WSRNYAAKDIRFGVEARA+ML+GVE+LADAVK+
Sbjct  1    MYRAAASLASKARLAGSSARQVGSRLAWSRNYAAKDIRFGVEARAMMLKGVEDLADAVKL  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD--  544
            TMGPKGR V+IEQS+GAPKVTKDGVTVAKS+EF+++VKNVGASLVKQVANATND AGD  
Sbjct  61   TMGPKGRTVIIEQSFGAPKVTKDGVTVAKSIEFSDRVKNVGASLVKQVANATNDTAGDVL  120

Query  545  -------------------------------------GTTCATVLTRAIFAEGCKSVAAG  613
                                                 GTTCATVLT+AIF EGCKSVAAG
Sbjct  121  PEIGSLGLLLVRVTDCVIILLSHSRALGSCADVFTLSGTTCATVLTKAIFTEGCKSVAAG  180

Query  614  MNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            MNAMDLRRGI+MAVDSVVTNLK  ARMI+TSEEIAQ
Sbjct  181  MNAMDLRRGISMAVDSVVTNLKGMARMINTSEEIAQ  216



>ref|XP_006651029.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Oryza brachyantha]
Length=577

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA+LAS+AR A +  +QIGS L+  RNYAAKDI+FGVEARALML+GVEELADAVKV
Sbjct  1    MYRAAASLASRARQAGSGARQIGSRLASHRNYAAKDIKFGVEARALMLRGVEELADAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VVIEQS+GAPKVTKDGVTVAKS+EF+N+VKNVGASLVKQVANATND AGDGT
Sbjct  61   TMGPKGRTVVIEQSFGAPKVTKDGVTVAKSIEFSNRVKNVGASLVKQVANATNDTAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  ARMISTSEEIAQ
Sbjct  121  TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQ  177



>gb|EYU46365.1| hypothetical protein MIMGU_mgv1a026299mg, partial [Erythranthe 
guttata]
Length=548

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  260  SSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKD  439
            S L WSRNYAAK+IRFGVEARA ML+GVEELADAVKVTMGPKGRNVV+EQS+GAPKVTKD
Sbjct  4    SRLLWSRNYAAKEIRFGVEARARMLRGVEELADAVKVTMGPKGRNVVLEQSYGAPKVTKD  63

Query  440  GVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMN  619
            GVTVAKS+EF +KV NVGASLVKQVANATNDVAGDGTTCAT+LTRAI++EGCKSVAAGMN
Sbjct  64   GVTVAKSIEFKDKVMNVGASLVKQVANATNDVAGDGTTCATILTRAIYSEGCKSVAAGMN  123

Query  620  AMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AMDLRRGI MAVD+VV NLKSRARMISTSEEIAQ
Sbjct  124  AMDLRRGINMAVDAVVNNLKSRARMISTSEEIAQ  157



>gb|AAN63805.1| heat shock protein 60 [Prunus dulcis]
Length=545

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  281  NYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKS  460
            NYAAKDI+FGVEARALML+GVEELADAVKVTMGPKGRNVV+EQS+GAPKVTKDGVTVAKS
Sbjct  1    NYAAKDIKFGVEARALMLKGVEELADAVKVTMGPKGRNVVLEQSFGAPKVTKDGVTVAKS  60

Query  461  VEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRG  640
            +EF +KVKN+GASLVKQVANATND AGDGTTCATVLTRAIF EGCKSVAAGMNAMDLRRG
Sbjct  61   IEFRDKVKNIGASLVKQVANATNDAAGDGTTCATVLTRAIFTEGCKSVAAGMNAMDLRRG  120

Query  641  ITMAVDSVVTNLKSRARMISTSEEIAQ  721
            I+MAVDSVVTNLKSRARMISTSEEIAQ
Sbjct  121  ISMAVDSVVTNLKSRARMISTSEEIAQ  147



>gb|EMS53265.1| Chaperonin CPN60-2, mitochondrial [Triticum urartu]
Length=640

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  254  IGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVT  433
            +GS L+WSRNYAAKDIRFGVEARA ML+GVEELADAVKVTMGPKGR V+IEQS+GAPKVT
Sbjct  88   VGSRLAWSRNYAAKDIRFGVEARASMLRGVEELADAVKVTMGPKGRTVIIEQSFGAPKVT  147

Query  434  KDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAG  613
            KDGVTVAKS+EF ++VKNVGASLVKQVANATND AGDGTTCATVLT+AIF EGCKSVAAG
Sbjct  148  KDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGDGTTCATVLTKAIFTEGCKSVAAG  207

Query  614  MNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            MNAMDLRRGI+MAVD VVTNLK  ARMISTSEEIAQ
Sbjct  208  MNAMDLRRGISMAVDDVVTNLKGMARMISTSEEIAQ  243



>ref|XP_001772410.1| predicted protein [Physcomitrella patens]
 gb|EDQ62881.1| predicted protein [Physcomitrella patens]
Length=580

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA L+++    +   Q   + L  +RN++AKDIRFGVEARALMLQGVE+LADAV+V
Sbjct  1    MYRAAATLSARINRGRALVQNF-NKLQSTRNFSAKDIRFGVEARALMLQGVEQLADAVQV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VVIEQS+G+PKVTKDGVTVAK++EF ++++NVGASLVK VA++TNDVAGDGT
Sbjct  60   TMGPKGRTVVIEQSFGSPKVTKDGVTVAKAIEFKDRLQNVGASLVKSVASSTNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVDSVV++LKS+A+MISTSEEIAQ
Sbjct  120  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGINLAVDSVVSHLKSQAKMISTSEEIAQ  176



>ref|XP_001783814.1| predicted protein [Physcomitrella patens]
 gb|EDQ51354.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA LAS+    ++  Q   S L  +R+++AKDIRFGVEARALMLQGVE+LADAV+V
Sbjct  1    MYRAAAALASRVNRGRSLVQNF-SKLQSTRHFSAKDIRFGVEARALMLQGVEQLADAVQV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IEQS+G+PKVTKDGVTVAK++EF ++++NVGASLVK VA++TNDVAGDGT
Sbjct  60   TMGPKGRTVIIEQSFGSPKVTKDGVTVAKAIEFKDRLQNVGASLVKSVASSTNDVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI++AVD+VV+ LKS+A+MISTSEEIAQ
Sbjct  120  TCATVLTRAIFVEGCKSVAAGMNAMDLRRGISVAVDAVVSYLKSQAKMISTSEEIAQ  176



>ref|XP_001762115.1| predicted protein [Physcomitrella patens]
 gb|EDQ73219.1| predicted protein [Physcomitrella patens]
Length=575

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA LAS  RV++  +      L  +R ++ KDIRFGVEARALMLQGVE+LADAV+V
Sbjct  1    MYRVAAALAS--RVSRGQSLVQACRLQSARKFSGKDIRFGVEARALMLQGVEQLADAVQV  58

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IEQS+G+PKVTKDGVTVAKS+EF +++KNVGASLVK VAN+TNDVAGDGT
Sbjct  59   TMGPKGRTVIIEQSFGSPKVTKDGVTVAKSIEFKDRLKNVGASLVKSVANSTNDVAGDGT  118

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            T ATVLTRAIFAEGCKSVAAGMNAMDLRRGI +AV++VV +LKS+A+MISTSEEIAQ
Sbjct  119  TAATVLTRAIFAEGCKSVAAGMNAMDLRRGINLAVEAVVAHLKSQAKMISTSEEIAQ  175



>ref|XP_002978237.1| hypothetical protein SELMODRAFT_108429, partial [Selaginella 
moellendorffii]
 gb|EFJ20894.1| hypothetical protein SELMODRAFT_108429, partial [Selaginella 
moellendorffii]
Length=557

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  260  SSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKD  439
            S   W R Y+AK+I+FGVEARALMLQGVE+LADAVKVTMGPKGRNVVI+Q +G+PKVTKD
Sbjct  6    SKAQWVRRYSAKEIKFGVEARALMLQGVEQLADAVKVTMGPKGRNVVIDQGFGSPKVTKD  65

Query  440  GVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMN  619
            GVTVAKS++F +K+KNVGASLVKQVANATNDVAGDGTTCATVL RAIFAEGCKSVAAGMN
Sbjct  66   GVTVAKSIDFKDKLKNVGASLVKQVANATNDVAGDGTTCATVLARAIFAEGCKSVAAGMN  125

Query  620  AMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AMDLRRGI+ AV+SVV NLKS+A+MISTSEEIAQ
Sbjct  126  AMDLRRGISSAVESVVENLKSKAKMISTSEEIAQ  159



>ref|XP_002966324.1| hypothetical protein SELMODRAFT_85251, partial [Selaginella moellendorffii]
 gb|EFJ32351.1| hypothetical protein SELMODRAFT_85251, partial [Selaginella moellendorffii]
Length=557

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  260  SSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKD  439
            S   W R Y+AK+I+FGVEARALMLQGVE+LADAVKVTMGPKGRNVVI+Q +G+PKVTKD
Sbjct  6    SRAQWVRRYSAKEIKFGVEARALMLQGVEQLADAVKVTMGPKGRNVVIDQGFGSPKVTKD  65

Query  440  GVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMN  619
            GVTVAKS++F +K+KNVGASLVKQVANATNDVAGDGTTCATVL RAIFAEGCKSVAAGMN
Sbjct  66   GVTVAKSIDFKDKLKNVGASLVKQVANATNDVAGDGTTCATVLARAIFAEGCKSVAAGMN  125

Query  620  AMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AMDLRRGI+ AV+SVV NLKS+A+MISTSEEIAQ
Sbjct  126  AMDLRRGISSAVESVVENLKSKAKMISTSEEIAQ  159



>ref|XP_010666478.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  242  STQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGA  421
            +T+ IG SL++SRNYAAK+IRFG +AR  ML+G+EELADAVKVTMGP+GRNVVIEQS+GA
Sbjct  15   TTRSIGGSLNFSRNYAAKEIRFGEDARKSMLKGIEELADAVKVTMGPRGRNVVIEQSFGA  74

Query  422  PKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKS  601
            PKVTKDGVTVAKS+EF ++ KN+GASLVKQVAN+TNDVAGDGTTCATVLT+AI  EG +S
Sbjct  75   PKVTKDGVTVAKSIEFKDRYKNLGASLVKQVANSTNDVAGDGTTCATVLTKAILIEGVRS  134

Query  602  VAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            V  GMNAMDLRRG+TMAVD+VV  LKSRARMISTSEEIAQ
Sbjct  135  VGVGMNAMDLRRGMTMAVDAVVNYLKSRARMISTSEEIAQ  174



>emb|CDX93002.1| BnaA03g37240D [Brassica napus]
Length=550

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 143/177 (81%), Gaps = 28/177 (16%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+RF ++LASKAR+A N T+Q+ S +SWSRNYAAK+I+FGVEARALML+GVEELADAV+V
Sbjct  1    MFRFVSSLASKARIASN-TRQVSSRMSWSRNYAAKEIKFGVEARALMLRGVEELADAVRV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR VVIEQSWGAPK                           QVANATNDVAGDGT
Sbjct  60   TMGPKGRTVVIEQSWGAPK---------------------------QVANATNDVAGDGT  92

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  93   TCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSRARMISTSEEIAQ  149



>ref|XP_001760735.1| predicted protein [Physcomitrella patens]
 gb|EDQ74474.1| predicted protein [Physcomitrella patens]
Length=580

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  278  RNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAK  457
            R ++AKDIRFGVEARALMLQGVE+LADAV+VTMGPKGR VV+EQS+G+PK+TKDGVTVAK
Sbjct  28   RWFSAKDIRFGVEARALMLQGVEQLADAVQVTMGPKGRTVVLEQSYGSPKITKDGVTVAK  87

Query  458  SVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRR  637
            S+EF +K+KNVGASLVK VANATNDVAGDGTT ATVL RAIF EGCKSVAAGMNAMDLRR
Sbjct  88   SIEFKDKLKNVGASLVKSVANATNDVAGDGTTAATVLARAIFTEGCKSVAAGMNAMDLRR  147

Query  638  GITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GIT+AVD+VV +LKS+A+MISTSEEIAQ
Sbjct  148  GITLAVDAVVAHLKSQAKMISTSEEIAQ  175



>gb|ACR37371.1| unknown [Zea mays]
Length=157

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  329  MLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVK  508
            ML+GVEELADAVKVTMGPKGRNVVIEQS+GAPKVTKDGVTVAKS+EF ++VKNVGASLVK
Sbjct  1    MLRGVEELADAVKVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVK  60

Query  509  QVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRA  688
            QVANATND AGDGTTCATVLT+AIF EGCKSVAAGMNAMDLRRGI+MAVD+VVTNLK  A
Sbjct  61   QVANATNDTAGDGTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMA  120

Query  689  RMISTSEEIAQ  721
            RMISTSEEIAQ
Sbjct  121  RMISTSEEIAQ  131



>ref|XP_007201704.1| hypothetical protein PRUPE_ppa004110mg [Prunus persica]
 gb|EMJ02903.1| hypothetical protein PRUPE_ppa004110mg [Prunus persica]
Length=529

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  329  MLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVK  508
            ML+GVEELADAVKVTMGPKGRNVV+EQS+GAPKVTKDGVTVAKS+EF +KVKN+GASLVK
Sbjct  1    MLKGVEELADAVKVTMGPKGRNVVLEQSFGAPKVTKDGVTVAKSIEFRDKVKNIGASLVK  60

Query  509  QVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRA  688
            QVANATND AGDGTTCATVLTRAIF EGCKSVAAGMNAMDLRRGI+MAVDSVVTNLKSRA
Sbjct  61   QVANATNDAAGDGTTCATVLTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSRA  120

Query  689  RMISTSEEIAQ  721
            RMISTSEEIAQ
Sbjct  121  RMISTSEEIAQ  131



>ref|XP_004235594.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Solanum lycopersicum]
Length=573

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+R AA +AS  R +  S + + S +  SRNYAAKDI FG  AR  MLQGV ELA+AVKV
Sbjct  1    MFRAAAAVASSIRFS-TSRKLVSSRIISSRNYAAKDISFGSHARLAMLQGVNELAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVAKS+ F  K KNVGA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIEKSPGNPKVTKDGVTVAKSINFKEKAKNVGADLVKQVANATNSVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCK+VAAG++ MDLR GI MA+D+VV +LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAIFTEGCKAVAAGVSVMDLRNGINMAIDAVVADLKSRAVMISTPEEITQ  176



>ref|XP_006342978.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin CPN60-like 2, mitochondrial-like 
[Solanum tuberosum]
Length=573

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+R AA +AS  R +  S + + S +  SRNYAAKDI FG  AR  MLQGV ELA+AVKV
Sbjct  1    MFRAAAAVASSIR-SSTSRKLVSSRIISSRNYAAKDISFGSHARLAMLQGVNELAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVAKS+ F  K KNVGA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIEKSPGNPKVTKDGVTVAKSINFKEKAKNVGADLVKQVANATNSVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCK+VAAG++ MDLR GI MA+D+VV +LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAIFTEGCKAVAAGVSVMDLRNGINMAIDAVVADLKSRAVMISTPEEITQ  176



>ref|XP_010242227.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nelumbo nucifera]
Length=574

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA++ S  R A  S + + S +  SRNYAAK+I FG+ ARA MLQGV ELA+AVKV
Sbjct  1    MYRVAASVFSSIRSA-TSKKLVYSRVLLSRNYAAKEINFGIGARAAMLQGVAELAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVAKS++F  K KNVGA LVKQVA ATN  AGDGT
Sbjct  60   TMGPKGRNVIIEKSRGGPKVTKDGVTVAKSIKFKEKAKNVGADLVKQVAKATNATAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG N MDLR GI MAVD+V+++LKSRA MI T EEIAQ
Sbjct  120  TCATVLTQAILTEGCKSVAAGSNVMDLRHGINMAVDAVISHLKSRALMICTPEEIAQ  176



>ref|XP_005848352.1| hypothetical protein CHLNCDRAFT_51922 [Chlorella variabilis]
 gb|EFN56250.1| hypothetical protein CHLNCDRAFT_51922 [Chlorella variabilis]
Length=496

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = +2

Query  251  QIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKV  430
            +IG  L   R YAAK++RFG E RA +L GVE+LADAV+VT+GPKGRNVVIEQ++GAPK+
Sbjct  13   RIGGQLC--RGYAAKELRFGDECRASLLAGVEKLADAVQVTLGPKGRNVVIEQAYGAPKI  70

Query  431  TKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAA  610
            TKDGVTVAK++EF ++ +NVGASLVKQVA+ATNDVAGDGTT ATVLTRAI  EGCKSVAA
Sbjct  71   TKDGVTVAKAIEFKDRFQNVGASLVKQVASATNDVAGDGTTTATVLTRAILVEGCKSVAA  130

Query  611  GMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GMN MDLRRGI +AVD VV  LK+RA+MIST+EEIAQ
Sbjct  131  GMNPMDLRRGINLAVDHVVAELKARAKMISTTEEIAQ  167



>ref|XP_010654528.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Vitis vinifera]
Length=574

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA LAS    A +S + + S +  SR+Y AKDI FG+ ARA MLQGV ELA+AVKV
Sbjct  1    MYRVAAKLASTISSA-SSKKLVYSRVLSSRSYGAKDIHFGIGARAAMLQGVTELAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE++ G PKVTKDGVTVAKS++F  K KNVGA LVKQVA+ATN  AGDGT
Sbjct  60   TMGPKGRNVIIEKNRGDPKVTKDGVTVAKSIKFKEKAKNVGADLVKQVASATNTAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAG+NAMDLR GI MAV++V+++LK RA MIST EEI Q
Sbjct  120  TCATVLTQAIFTEGCKSVAAGVNAMDLRSGINMAVNAVISDLKCRAVMISTPEEITQ  176



>ref|XP_010501368.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  + L+S    A  S + +   +  SRNYAAKDI FG+ ARA MLQGV E+A+AVKV
Sbjct  1    MYRVLSKLSSSIG-ASTSRKLVSGRIISSRNYAAKDISFGIGARAAMLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE S+G PK+TKDGVTVAKS+ F  K KN+GA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIENSYGGPKITKDGVTVAKSISFQAKAKNIGAELVKQVANATNKVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MA+ +VV++LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAILIEGCKSVAAGVNVMDLRVGINMAIAAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_009629888.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nicotiana 
tomentosiformis]
Length=573

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+R AA +AS  R +  S +   S +   RNYAAKDI FG +AR  MLQGV ELA+AVKV
Sbjct  1    MFRAAAAVASSIR-SSTSRKLAASRIISRRNYAAKDINFGSQARLAMLQGVNELAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDG TVAKS+ F +K KNVGA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIEKSQGNPKVTKDGATVAKSINFKDKTKNVGADLVKQVANATNSVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF+EGCK+VAAG++ MDLR GI MAVD+VV +LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAIFSEGCKAVAAGVSVMDLRSGINMAVDAVVADLKSRAVMISTPEEITQ  176



>ref|XP_007024506.1| Chaperonin-60 kDa protein isoform 2 [Theobroma cacao]
 gb|EOY27128.1| Chaperonin-60 kDa protein isoform 2 [Theobroma cacao]
Length=387

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+R A+ LAS    +  S + + S +  +RNY AK I FG  ARA MLQGV E+A+AVKV
Sbjct  1    MHRRASKLASFI-CSSTSKKLVYSRVICNRNYVAKVINFGFGARAAMLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+  G PKVTKDGVTVAKS++F NK KNVGA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIEKRPGYPKVTKDGVTVAKSIKFKNKAKNVGADLVKQVANATNKVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MAVD+V+++LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAILLEGCKSVAAGVNVMDLRSGINMAVDAVISDLKSRAIMISTPEEITQ  176



>gb|KJB56919.1| hypothetical protein B456_009G141700 [Gossypium raimondii]
Length=572

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS    +  S + + S +  +RNY AKDI FGV ARA M+ GV E+ADAVKV
Sbjct  1    MYRIASKLASSISSST-SRKLVCSRIICNRNYVAKDISFGVGARAAMMLGVSEVADAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE S G PKVTKDGVTVAKS++F +K KNVGA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIESSRGYPKVTKDGVTVAKSIKFKDKAKNVGADLVKQVANATNKVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKS+AAG+N MDLR+GI MAVD+V+++LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAILLEGCKSLAAGVNVMDLRKGINMAVDTVISDLKSRAVMISTPEEITQ  176



>ref|XP_010534892.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Tarenaya hassleriana]
Length=572

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  + LAS    +  S + + S +  SRNY AKDI FGV ARA MLQGV E+A+AVKV
Sbjct  1    MYRAVSKLASSIG-SSASRKLVCSRIISSRNYVAKDISFGVGARAAMLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PK+TKDGV+VAKS+ F +K KNVGA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIEKSHGEPKITKDGVSVAKSISFKDKAKNVGAELVKQVANATNKVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI +AVD+VV++LK RA MIST EEI Q
Sbjct  120  TCATVLTQAILTEGCKSVAAGVNVMDLRSGINLAVDAVVSDLKKRAVMISTPEEITQ  176



>ref|XP_002946991.1| hypothetical protein VOLCADRAFT_79395 [Volvox carteri f. nagariensis]
 gb|EFJ52217.1| hypothetical protein VOLCADRAFT_79395 [Volvox carteri f. nagariensis]
Length=571

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  248  QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPK  427
            QQ G  L   R YA KD+RFG+E R  +L GV +LADAV+VT+GPKGRNV+IEQS+G PK
Sbjct  16   QQNGQILQAVRYYAVKDVRFGIECRDKVLAGVNKLADAVQVTLGPKGRNVMIEQSYGGPK  75

Query  428  VTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVA  607
            +TKDGVTVAK++E  +K +N+GASLVKQVA+ATNDVAGDGTT ATVLTRAI AEGCKSVA
Sbjct  76   ITKDGVTVAKAIELKDKFENMGASLVKQVASATNDVAGDGTTTATVLTRAILAEGCKSVA  135

Query  608  AGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AGMN MDLRRGI MAVD VV+ LK RA+MIST+EEIAQ
Sbjct  136  AGMNPMDLRRGINMAVDHVVSVLKGRAKMISTTEEIAQ  173



>emb|CAN78641.1| hypothetical protein VITISV_031740 [Vitis vinifera]
Length=579

 Score =   238 bits (608),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 141/177 (80%), Gaps = 12/177 (7%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA LAS  RV           LS SR+Y AKDI FG+ ARA MLQGV ELA+AVKV
Sbjct  1    MYRVAAKLASTIRV-----------LS-SRSYGAKDIHFGIGARAAMLQGVTELAEAVKV  48

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE++ G PKVTKDGVTVAKS++F  K KNVGA LVKQVA+ATN  AGDGT
Sbjct  49   TMGPKGRNVIIEKNRGDPKVTKDGVTVAKSIKFKEKAKNVGADLVKQVASATNTAAGDGT  108

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAG+NAMDLR GI MAV++V+++LK RA MIST EEI Q
Sbjct  109  TCATVLTQAIFTEGCKSVAAGVNAMDLRSGINMAVNAVISDLKCRAVMISTPEEITQ  165



>ref|XP_009135334.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Brassica rapa]
Length=572

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNY AKDI FGV ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+GAPK+TKDGVTVA
Sbjct  28   SRNYVAKDISFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIESSYGAPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F +  KN+GA LVKQVANATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFESNAKNMGAELVKQVANATNKVAGDGTTCATVLTQAILTEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+D+VV++LKSRA MIST EEI Q
Sbjct  148  SGINMAIDAVVSDLKSRAVMISTPEEITQ  176



>emb|CDX82514.1| BnaA03g33070D [Brassica napus]
Length=572

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNY AKDI FGV ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+GAPK+TKDGVTVA
Sbjct  28   SRNYVAKDISFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIESSYGAPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F +  KN+GA LVKQVANATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFESNAKNMGAELVKQVANATNKVAGDGTTCATVLTQAILTEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+D+VV++LKSRA MIST EEI Q
Sbjct  148  SGINMAIDAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_011072524.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Sesamum indicum]
Length=574

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA   + +  +  S + + S + +SRNY AKDI FG  ARA ML GV +LA+AVKV
Sbjct  1    MYRVAAAAIASSIRSSTSRKLVCSRVVYSRNYVAKDINFGTGARAAMLAGVNDLAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVAKS+ F+ K KNVGA LVKQVANATN VAGDGT
Sbjct  61   TMGPKGRNVIIEKS-GDPKVTKDGVTVAKSINFSEKAKNVGADLVKQVANATNKVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAG+N MDLR+GI MAVD+V+ +LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAIFTEGCKSVAAGVNVMDLRKGINMAVDAVIADLKSRALMISTPEEITQ  176



>ref|XP_006466018.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Citrus 
sinensis]
Length=574

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS            G  L  +RNY AKDI FGV ARA MLQGV E+A+AVKV
Sbjct  1    MYRIASKLASSISSPAAKKGVYGRVL-CNRNYVAKDINFGVGARAAMLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVA+S+EF +K K+VGA+LVKQVA ATN  AGDGT
Sbjct  60   TMGPKGRNVIIEKSIGNPKVTKDGVTVARSIEFRDKAKDVGANLVKQVAGATNKAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MA+D+V+++LKSRA+MIST EEI Q
Sbjct  120  TCATVLTQAILTEGCKSVAAGVNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQ  176



>ref|XP_009796310.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nicotiana 
sylvestris]
Length=570

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  242  STQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGA  421
            S + + S ++  RNY AKDI FG++AR  MLQGV ELA+AVKVTMGPKGRNV+IE+S G 
Sbjct  14   SRKLVASRINSRRNYVAKDINFGIQARLAMLQGVNELAEAVKVTMGPKGRNVIIEKSQGN  73

Query  422  PKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKS  601
            PKVTKDGVTVAKS+ F  K KNVGA LVKQVANATN VAGDGTTCATVLT+AIF EGCK+
Sbjct  74   PKVTKDGVTVAKSISFKEKTKNVGADLVKQVANATNSVAGDGTTCATVLTQAIFTEGCKA  133

Query  602  VAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            VAAG++ MDLR GI MAVD+VV +LKSRA MIST EEI Q
Sbjct  134  VAAGVSVMDLRSGINMAVDAVVADLKSRAVMISTPEEITQ  173



>ref|XP_006426562.1| hypothetical protein CICLE_v10025257mg [Citrus clementina]
 gb|ESR39802.1| hypothetical protein CICLE_v10025257mg [Citrus clementina]
Length=574

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS            G  L  +RNY AKDI FGV ARA MLQGV E+A+AVKV
Sbjct  1    MYRIASKLASSISSPAAKKGVYGRVL-CNRNYVAKDINFGVGARAAMLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVA S+EF +K K+VGA+LVKQVA ATN  AGDGT
Sbjct  60   TMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MA+D+V+++LKSRA+MIST EEI Q
Sbjct  120  TCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQ  176



>ref|XP_011659644.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Cucumis sativus]
 gb|KGN45525.1| hypothetical protein Csa_7G451310 [Cucumis sativus]
Length=570

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS       S + + S ++ SR+YAAKDI FG  ARA MLQGV E+A+AVKV
Sbjct  1    MYRLASKLASS-----TSRKLVCSRVTSSRSYAAKDINFGDGARAAMLQGVSEVAEAVKV  55

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+I+ S+G+PKVTKDGVTVAKS++F +K KNVGA LVKQVA+ATN  AGDGT
Sbjct  56   TMGPKGRNVIIDTSFGSPKVTKDGVTVAKSIQFKDKAKNVGADLVKQVASATNTAAGDGT  115

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKS+AAG+N MDLR GI  AVD+V++ LKSRA MIST EEI Q
Sbjct  116  TCATVLTQAILTEGCKSIAAGVNVMDLRIGIKKAVDAVISELKSRALMISTPEEITQ  172



>emb|CDX75733.1| BnaC03g38160D [Brassica napus]
Length=572

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNY AKDI FGV ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+GAPK+TKDGVTVA
Sbjct  28   SRNYVAKDISFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIESSYGAPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F +K KN+GA LVKQVANATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFESKAKNMGAELVKQVANATNKVAGDGTTCATVLTQAILTEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+++VV +LKSRA MIST EEI Q
Sbjct  148  SGINMAINAVVCDLKSRAVMISTPEEITQ  176



>gb|AAL09728.1| AT3g13860/MCP4_7 [Arabidopsis thaliana]
Length=429

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNYAAKDI FG+ ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+G PK+TKDGVTVA
Sbjct  28   SRNYAAKDISFGIGARAAMLQGVSEVAEAVKVTMGPKGRNVIIESSYGGPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F  K KN+GA LVKQVA+ATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFQAKAKNIGAELVKQVASATNKVAGDGTTCATVLTQAILIEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+ +VV++LKSRA MIST EEI Q
Sbjct  148  VGINMAIAAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_011401079.1| Chaperonin CPN60, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM28067.1| Chaperonin CPN60, mitochondrial [Auxenochlorella protothecoides]
Length=580

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  269  SWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVT  448
            S SR YAAKDI FG   RA MLQGVE+LADAV+VT+GPKGRNVVIEQ +G PK+TKDGVT
Sbjct  23   SQSRGYAAKDILFGDACRASMLQGVEKLADAVQVTLGPKGRNVVIEQPYGGPKITKDGVT  82

Query  449  VAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMD  628
            VAK+VEF+++  N+GA+LVKQVA ATND AGDGTT ATVLTRAI  EGCKSVAAGMN MD
Sbjct  83   VAKAVEFSDRFHNLGAALVKQVAGATNDAAGDGTTTATVLTRAILVEGCKSVAAGMNPMD  142

Query  629  LRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            LRRGI +AVD VV+ LK RAR IST+EEIAQ
Sbjct  143  LRRGINLAVDHVVSELKRRARQISTTEEIAQ  173



>ref|XP_003064760.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51094.1| predicted protein [Micromonas pusilla CCMP1545]
Length=544

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  290  AKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEF  469
            AKD++FGV+ARALMLQG + LADAV+VTMGPKGRNVVIEQ++GAPK+TKDGVTVA+++EF
Sbjct  2    AKDVKFGVDARALMLQGCDNLADAVQVTMGPKGRNVVIEQTYGAPKITKDGVTVARNIEF  61

Query  470  NNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITM  649
             ++  N+GASLVKQVA+ATNDVAGDGTT ATVLTRAIF+EGCKSVAAGMN MDLRRGIT 
Sbjct  62   TDRFMNLGASLVKQVASATNDVAGDGTTTATVLTRAIFSEGCKSVAAGMNPMDLRRGITA  121

Query  650  AVDSVVTNLKSRARMISTSEEIAQ  721
            AVD VV  LK  A++IST+EEIAQ
Sbjct  122  AVDQVVKELKKAAKLISTTEEIAQ  145



>ref|XP_010685392.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685393.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685394.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=570

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 140/177 (79%), Gaps = 4/177 (2%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  ++L      +  S + + S +  SRNY AKDI FGVEAR  MLQGV E+A+AVKV
Sbjct  1    MYRVTSSLIR----SHASRRLVSSRIISSRNYVAKDISFGVEARMAMLQGVNEIAEAVKV  56

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGP+GR VVIE+S   PKVTKDGVTVAKS++FN + KN+GA LVKQVA ATN VAGDGT
Sbjct  57   TMGPRGRTVVIERSHKDPKVTKDGVTVAKSIKFNERTKNLGAELVKQVAKATNTVAGDGT  116

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT++I  EGCKS+AAG+NAMDLR GI MAVD+VV+NLKS++ MIST EEI Q
Sbjct  117  TCATVLTQSILVEGCKSIAAGVNAMDLRTGINMAVDAVVSNLKSKSMMISTPEEITQ  173



>ref|XP_007024507.1| Heat shock protein 60-3A isoform 3 [Theobroma cacao]
 gb|EOY27129.1| Heat shock protein 60-3A isoform 3 [Theobroma cacao]
Length=546

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+R A+ LAS    +  S + + S +  +RNY AK I FG  ARA MLQGV E+A+AVKV
Sbjct  1    MHRRASKLASFI-CSSTSKKLVYSRVICNRNYVAKVINFGFGARAAMLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+  G PKVTKDGVTVAKS++F NK KNVGA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIEKRPGYPKVTKDGVTVAKSIKFKNKAKNVGADLVKQVANATNKVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MAVD+V+++LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAILLEGCKSVAAGVNVMDLRSGINMAVDAVISDLKSRAIMISTPEEITQ  176



>ref|XP_006296696.1| hypothetical protein CARUB_v10013333mg [Capsella rubella]
 gb|EOA29594.1| hypothetical protein CARUB_v10013333mg [Capsella rubella]
Length=572

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNYAAKDI FGV ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+G PK+TKDGVTVA
Sbjct  28   SRNYAAKDISFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIENSYGGPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F  K KN+GA LVKQVANATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFQAKAKNIGAELVKQVANATNKVAGDGTTCATVLTQAILMEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+ +VV++LKSRA MIST EEI Q
Sbjct  148  VGINMAIAAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_002527401.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF34967.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=573

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS    +  S + +   L  SR+Y AKDI FGV ARA MLQG+ E+A+AVKV
Sbjct  1    MYRIASRLASSFG-SSPSKKLVYGQLICSRSYVAKDISFGVGARAAMLQGINEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVAKS++F    KN+GA LVKQVANATN  AGDGT
Sbjct  60   TMGPKGRNVIIEKSHGGPKVTKDGVTVAKSIKFKENAKNIGADLVKQVANATNTAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MA+D+VV++LK  A MIST EEI Q
Sbjct  120  TCATVLTQAILTEGCKSVAAGVNVMDLRTGINMAIDAVVSDLKKSALMISTPEEITQ  176



>emb|CDO97909.1| unnamed protein product [Coffea canephora]
Length=574

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA +AS  R +  + + + S    SRNY AKDI FG  ARA ML GV ELA+AVKV
Sbjct  1    MYRVAAAIASSVR-SSATKKLVCSRFISSRNYVAKDINFGTSARAAMLLGVNELAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE++ GAPKVTKDGVTVAKS++F +K KNVGA LVKQVANATN  AGDGT
Sbjct  60   TMGPKGRNVIIEKTNGAPKVTKDGVTVAKSIKFKDKAKNVGAELVKQVANATNVAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EG KSVAAG+N MDLR G+ MAV++V+ +LKS+A MIST EEI Q
Sbjct  120  TCATVLTQAIFTEGYKSVAAGVNVMDLRSGMNMAVNAVIQDLKSKAMMISTPEEITQ  176



>ref|XP_004297534.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=574

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 146/178 (82%), Gaps = 3/178 (2%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQ-IGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            MYR A+ L S   VA ++T++ IGS +  +RNYAAKDI FGV ARA +LQGV E+A+AVK
Sbjct  1    MYRIASKLVSS--VASSTTKKLIGSRIICNRNYAAKDISFGVGARASLLQGVSEVAEAVK  58

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGR V+IE+S   P+VTKDGVTVAKS+ F +K K++GA+LVKQVA ATN  AGDG
Sbjct  59   VTMGPKGRFVIIEKSGKNPQVTKDGVTVAKSISFEDKRKDLGANLVKQVARATNTAAGDG  118

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLT+AI  EGCKS+AAG+NAMDLR GI MAVD++VT+LKS+A MIST EEI Q
Sbjct  119  TTCATVLTQAILIEGCKSIAAGVNAMDLRSGINMAVDAIVTDLKSKALMISTPEEITQ  176



>ref|XP_010487162.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNYAAKDI FG+ ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+G PK+TKDGVTVA
Sbjct  28   SRNYAAKDISFGIGARAAMLQGVSEVAEAVKVTMGPKGRNVIIENSYGGPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F  K KN+GA LVKQVANATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFQAKAKNIGAELVKQVANATNKVAGDGTTCATVLTQAILMEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+ +VV++LKSRA MIST EEI Q
Sbjct  148  VGINMAIAAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_010465258.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNYAAKDI FG+ ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+G PK+TKDGVTVA
Sbjct  28   SRNYAAKDISFGIGARAAMLQGVSEVAEAVKVTMGPKGRNVIIENSYGGPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F  K KN+GA LVKQVANATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFQAKAKNIGAELVKQVANATNKVAGDGTTCATVLTQAILMEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+ +VV++LKSRA MIST EEI Q
Sbjct  148  VGINMAIAAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_007024505.1| Heat shock protein 60-3A isoform 1 [Theobroma cacao]
 gb|EOY27127.1| Heat shock protein 60-3A isoform 1 [Theobroma cacao]
Length=572

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            M+R A+ LAS    +  S + + S +  +RNY AK I FG  ARA MLQGV E+A+AVKV
Sbjct  1    MHRRASKLASFI-CSSTSKKLVYSRVICNRNYVAKVINFGFGARAAMLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+  G PKVTKDGVTVAKS++F NK KNVGA LVKQVANATN VAGDGT
Sbjct  60   TMGPKGRNVIIEKRPGYPKVTKDGVTVAKSIKFKNKAKNVGADLVKQVANATNKVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MAVD+V+++LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAILLEGCKSVAAGVNVMDLRSGINMAVDAVISDLKSRAIMISTPEEITQ  176



>emb|CBL93634.1| mitochondrial chaperonin 60 precursor [Chlamydomonas reinhardtii]
Length=571

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  248  QQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPK  427
            QQ  + L   R YAAKD+RFG+E R  +L GV +LADAV+VT+GPKGRNV+IEQ++G PK
Sbjct  16   QQNSALLQAVRFYAAKDVRFGIECRDKVLAGVNKLADAVQVTLGPKGRNVMIEQTYGGPK  75

Query  428  VTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVA  607
            +TKDGVTVAK++E  +K +N+GASLVKQVA+ATNDVAGDGTT ATVLTRAI AEGCKSVA
Sbjct  76   ITKDGVTVAKAIELKDKFENIGASLVKQVASATNDVAGDGTTTATVLTRAILAEGCKSVA  135

Query  608  AGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AGMN MDLRRGI MAV+ VV  LK+RA+MIST+EEIAQ
Sbjct  136  AGMNPMDLRRGINMAVEHVVGVLKARAKMISTTEEIAQ  173



>ref|XP_005646765.1| mitochondrial chaperonin 60 [Coccomyxa subellipsoidea C-169]
 gb|EIE22221.1| mitochondrial chaperonin 60 [Coccomyxa subellipsoidea C-169]
Length=568

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +2

Query  248  QQIGSSLSWS-RNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAP  424
            Q  G +L  S R   +K++RFGV+ R+ +L GV++LADAV+VT+GPKGRNVVIEQS+G P
Sbjct  2    QSFGRALVHSARKSRSKEVRFGVDCRSGVLAGVDKLADAVQVTLGPKGRNVVIEQSYGGP  61

Query  425  KVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSV  604
            K+TKDGVTVAKS+E  +K +NVGASLVKQVA+ATNDVAGDGTT ATVLTRAIF+EGCKSV
Sbjct  62   KITKDGVTVAKSIELKDKFQNVGASLVKQVASATNDVAGDGTTTATVLTRAIFSEGCKSV  121

Query  605  AAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AAGMN MDLRRGI +AV+ V+ +LKSRA+MIST+EEIAQ
Sbjct  122  AAGMNPMDLRRGINLAVEKVLEDLKSRAKMISTTEEIAQ  160



>ref|XP_007135549.1| hypothetical protein PHAVU_010G138700g [Phaseolus vulgaris]
 gb|ESW07543.1| hypothetical protein PHAVU_010G138700g [Phaseolus vulgaris]
Length=569

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A  +AS +  AKN     G  LS SRN+ +KDI FGV ARA +LQGV ++ADAVKV
Sbjct  1    MYRLARRVASSS--AKNLVY--GRVLS-SRNFVSKDINFGVGARAAILQGVTQVADAVKV  55

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G P++TKDGVTVAKS++FN+K KNVGA LVKQVA ATN  AGDGT
Sbjct  56   TMGPKGRNVIIERSRGNPRITKDGVTVAKSIKFNDKAKNVGADLVKQVAKATNTAAGDGT  115

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKS+AAG+N MDLR GI  AVD+V+T+LKSRA MIST EEI Q
Sbjct  116  TCATVLTQAILTEGCKSIAAGVNVMDLRSGINKAVDAVITDLKSRALMISTPEEITQ  172



>ref|XP_002884993.1| hypothetical protein ARALYDRAFT_478789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61252.1| hypothetical protein ARALYDRAFT_478789 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNYAAKDI FGV ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+G PK+TKDGVTVA
Sbjct  28   SRNYAAKDISFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIESSYGGPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F  K KN+GA LVKQVA+ATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFQAKAKNIGAELVKQVASATNKVAGDGTTCATVLTQAILIEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+ +VV++LKSRA MIST EEI Q
Sbjct  148  VGINMAISAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_006407158.1| hypothetical protein EUTSA_v10020386mg [Eutrema salsugineum]
 gb|ESQ48611.1| hypothetical protein EUTSA_v10020386mg [Eutrema salsugineum]
Length=572

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNY AKDI FG+ ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+G PK+TKDGVTVA
Sbjct  28   SRNYVAKDISFGIGARAAMLQGVSEVAEAVKVTMGPKGRNVIIENSYGGPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F  K KN+GA LVKQVANATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFKAKAKNMGAELVKQVANATNKVAGDGTTCATVLTQAILTEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+ +VV++LKSRA MIST EEI Q
Sbjct  148  TGINMAIHAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_012068975.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X2 
[Jatropha curcas]
Length=573

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  + LAS    +  S + +  ++  +R+Y AKDI FGV ARA MLQGV E+A+AVKV
Sbjct  1    MYRVVSRLASSIG-SSASKKLVCGNIICNRSYVAKDINFGVGARAAMLQGVNEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVAKS+ F  K KNVGA LVKQVANATN  AGDGT
Sbjct  60   TMGPKGRNVIIEKSHGDPKVTKDGVTVAKSINFKEKSKNVGADLVKQVANATNTAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MAV++VV++LK RA MIST EEI Q
Sbjct  120  TCATVLTQAILTEGCKSVAAGVNVMDLRTGINMAVEAVVSDLKKRALMISTPEEITQ  176



>ref|XP_012068973.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Jatropha curcas]
Length=574

 Score =   233 bits (594),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  + LAS    +  S + +  ++  +R+Y AKDI FGV ARA MLQGV E+A+AVKV
Sbjct  1    MYRVVSRLASSIGSSSASKKLVCGNIICNRSYVAKDINFGVGARAAMLQGVNEVAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVAKS+ F  K KNVGA LVKQVANATN  AGDGT
Sbjct  61   TMGPKGRNVIIEKSHGDPKVTKDGVTVAKSINFKEKSKNVGADLVKQVANATNTAAGDGT  120

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MAV++VV++LK RA MIST EEI Q
Sbjct  121  TCATVLTQAILTEGCKSVAAGVNVMDLRTGINMAVEAVVSDLKKRALMISTPEEITQ  177



>gb|EYU21369.1| hypothetical protein MIMGU_mgv1a003594mg [Erythranthe guttata]
Length=575

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA   S +  +  S +     +  SRNY AKDI FG  ARA ML GV ELA+AVKV
Sbjct  1    MYRVAAAAISSSIRSSTSRKLACGGIVHSRNYVAKDISFGTGARAAMLAGVNELAEAVKV  60

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR+V+IE++ G PKVTKDGVTVAKS+EF++K KNVGA LVKQVANATN VAGDGT
Sbjct  61   TMGPKGRHVIIEKT-GNPKVTKDGVTVAKSIEFSDKAKNVGADLVKQVANATNKVAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AIF EGCKSVAAG+N MDLR+GI MAVD+V+ +LKSRA MIST EEI Q
Sbjct  120  TCATVLTQAIFREGCKSVAAGVNVMDLRKGINMAVDAVIADLKSRAIMISTPEEITQ  176



>ref|NP_566466.1| heat shock protein 60-3A [Arabidopsis thaliana]
 sp|Q93ZM7.2|CH60C_ARATH RecName: Full=Chaperonin CPN60-like 2, mitochondrial; AltName: 
Full=HSP60-like 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02911.1| chaperonin; similar to GroEL protein [Arabidopsis thaliana]
 gb|AAM19824.1| AT3g13860/MCP4_7 [Arabidopsis thaliana]
 gb|AAU95459.1| At3g13860 [Arabidopsis thaliana]
 gb|AEE75427.1| heat shock protein 60-3A [Arabidopsis thaliana]
Length=572

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SRNYAAKDI FG+ ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+G PK+TKDGVTVA
Sbjct  28   SRNYAAKDISFGIGARAAMLQGVSEVAEAVKVTMGPKGRNVIIESSYGGPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F  K KN+GA LVKQVA+ATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFQAKAKNIGAELVKQVASATNKVAGDGTTCATVLTQAILIEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MA+ +VV++LKSRA MIST EEI Q
Sbjct  148  VGINMAIAAVVSDLKSRAVMISTPEEITQ  176



>gb|KFK38736.1| hypothetical protein AALP_AA3G153700 [Arabis alpina]
Length=572

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            SR+Y AKDI FG+ ARA MLQGV E+A+AVKVTMGPKGRNV+IE S+G PK+TKDGVTVA
Sbjct  28   SRSYVAKDISFGIGARAAMLQGVSEVAEAVKVTMGPKGRNVIIESSYGGPKITKDGVTVA  87

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            KS+ F  K KN+GA LVKQVANATN VAGDGTTCATVLT+AI  EGCKSVAAG+N MDLR
Sbjct  88   KSISFQAKAKNIGAELVKQVANATNKVAGDGTTCATVLTQAILIEGCKSVAAGVNVMDLR  147

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             GI MAV +VV++LKSRA MIST EEI Q
Sbjct  148  SGINMAVAAVVSDLKSRAVMISTPEEITQ  176



>ref|XP_007510337.1| chaperonin GroEL [Bathycoccus prasinos]
 emb|CCO18682.1| chaperonin GroEL [Bathycoccus prasinos]
Length=599

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  278  RNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAK  457
            R YA+KD++FGVEARAL+LQG + LADAV+VT+GPKGRNVVIEQ++G PK+TKDGVTVAK
Sbjct  54   RGYASKDLKFGVEARALILQGCDRLADAVQVTLGPKGRNVVIEQNYGPPKITKDGVTVAK  113

Query  458  SVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRR  637
            +VEF +++ N+GASLVKQVA +TNDVAGDGTT ATVLTRAIF+EGCKSVAAGMN MDLRR
Sbjct  114  NVEFKDRMMNLGASLVKQVAVSTNDVAGDGTTTATVLTRAIFSEGCKSVAAGMNPMDLRR  173

Query  638  GITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GI  AVD ++  L+S  +MIST+EEIAQ
Sbjct  174  GIQQAVDVILKELQSTRKMISTTEEIAQ  201



>ref|XP_001691353.1| chaperonin 60C [Chlamydomonas reinhardtii]
 gb|EDP05086.1| chaperonin 60C, partial [Chlamydomonas reinhardtii]
Length=537

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +2

Query  284  YAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSV  463
            YAAKD+RFG+E R  +L GV +LADAV+VT+GPKGRNV+IEQ++G PK+TKDGVTVAK++
Sbjct  1    YAAKDVRFGIECRDKVLAGVNKLADAVQVTLGPKGRNVMIEQTYGGPKITKDGVTVAKAI  60

Query  464  EFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGI  643
            E  +K +N+GASLVKQVA+ATNDVAGDGTT ATVLTRAI AEGCKSVAAGMN MDLRRGI
Sbjct  61   ELKDKFENIGASLVKQVASATNDVAGDGTTTATVLTRAILAEGCKSVAAGMNPMDLRRGI  120

Query  644  TMAVDSVVTNLKSRARMISTSEEIAQ  721
             MAV+ VV  LK+RA+MIST+EEIAQ
Sbjct  121  NMAVEHVVGVLKARAKMISTTEEIAQ  146



>ref|XP_010925013.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Elaeis guineensis]
Length=576

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +2

Query  191  MYRFAANLASKA-RVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            MYR AA +AS   R++ + TQ     +  +R+YAAKDI FGV ARA ML GV ELA+AVK
Sbjct  1    MYRAAATIASSMIRLSSSETQIWSGRILSARSYAAKDIDFGVGARAAMLLGVHELAEAVK  60

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGRNVVIE+S G PKVTKDGVTVAKS+EF  + KN+GA+LVKQVA ATN  AGDG
Sbjct  61   VTMGPKGRNVVIEKSRGDPKVTKDGVTVAKSIEFKERAKNLGANLVKQVAKATNTAAGDG  120

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLT+AI  EGCK+VA+G+N MDLR GI MAVD+V+++LK +A M ST EEI Q
Sbjct  121  TTCATVLTQAILTEGCKAVASGVNVMDLRNGINMAVDAVISHLKGKAWMTSTPEEITQ  178



>ref|XP_009341038.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Pyrus x bretschneideri]
Length=570

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 137/177 (77%), Gaps = 5/177 (3%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS       S + +GS +  +RNY AKDI FGV ARA +LQGV E+A+AVKV
Sbjct  1    MYRIASKLASS-----TSRKLVGSRVISNRNYVAKDISFGVGARAALLQGVSEVAEAVKV  55

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IE +   PKVTKDGVTVAKS+ F  K KNVGA LVKQVA ATN  AGDGT
Sbjct  56   TMGPKGRYVIIENTHKDPKVTKDGVTVAKSISFEGKYKNVGADLVKQVAKATNTAAGDGT  115

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKS+AAG+NAMDLR GI  AVD+VVT+LKSRA MIST +EI Q
Sbjct  116  TCATVLTQAILIEGCKSIAAGVNAMDLRIGINAAVDAVVTDLKSRALMISTPDEITQ  172



>ref|XP_008807997.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Phoenix dactylifera]
Length=576

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +2

Query  191  MYRFAANLASKA-RVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            MYR AA +AS   RV+ + TQ     +  +R+YAAKDI FGV ARA +LQGV ELA+AVK
Sbjct  1    MYRAAAAIASSMIRVSSSKTQIWSGRILSARSYAAKDIDFGVGARAAILQGVHELAEAVK  60

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGRNVVIE+S G PKVTKDGVTVAKS+EF  + KNVGA+LVKQVA ATN  AGDG
Sbjct  61   VTMGPKGRNVVIEKSRGDPKVTKDGVTVAKSIEFKERAKNVGANLVKQVAKATNTAAGDG  120

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLT+AI  EGCK+VA+G+N MDLR GI MAVD+V+++L+S+A MIST EEI Q
Sbjct  121  TTCATVLTQAILTEGCKAVASGVNVMDLRNGINMAVDAVISHLRSKAWMISTPEEITQ  178



>gb|KDD77186.1| TCP-1/cpn60 chaperonin [Helicosporidium sp. ATCC 50920]
Length=574

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  278  RNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAK  457
            R YAAKD+ FG   RA +LQGVE LADAV+VT+GPKGRNVVIEQ +GAPK+TKDGVTVAK
Sbjct  25   RGYAAKDLVFGDACRAAVLQGVERLADAVQVTLGPKGRNVVIEQPYGAPKITKDGVTVAK  84

Query  458  SVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRR  637
            ++EF +K +NVGASLVKQVA+ TNDVAGDGTT ATVLTRAI  EGCK VAAGMN MDLRR
Sbjct  85   ALEFKDKYQNVGASLVKQVASQTNDVAGDGTTTATVLTRAILVEGCKGVAAGMNPMDLRR  144

Query  638  GITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GIT AVD+VV +L+ RAR IST+EEIAQ
Sbjct  145  GITAAVDAVVADLQRRARRISTAEEIAQ  172



>ref|XP_008228292.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Prunus mume]
Length=574

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS    +  S + + S +  +RNY AKDI FGV ARA +LQGV E+A+AVKV
Sbjct  1    MYRIASKLASSV-ASSTSRKLVCSRVICNRNYVAKDISFGVGARAALLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IE S   PKVTKDGVTVAKS+ F  K KNVGA LVKQVA ATN  AGDGT
Sbjct  60   TMGPKGRYVIIENSHKDPKVTKDGVTVAKSISFKGKYKNVGADLVKQVAKATNTAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKS+AAG+NAMDLR GI +AVD+VV++LKSRA MIST +EI Q
Sbjct  120  TCATVLTQAILTEGCKSIAAGVNAMDLRIGINLAVDAVVSDLKSRALMISTPDEITQ  176



>ref|XP_008391328.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Malus domestica]
Length=574

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS    +  S + +GS +  +RNY AKDI FGV ARA +LQGV E+A+AVKV
Sbjct  1    MYRIASKLASSV-ASSTSRKLVGSRVISNRNYVAKDISFGVGARAALLQGVSEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR V+IE +   P+VTKDGVTVAKS+ F  K KNVGA LVKQVA ATN  AGDGT
Sbjct  60   TMGPKGRYVIIENTHKDPQVTKDGVTVAKSISFKGKYKNVGADLVKQVAKATNTAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKS+AAG+NAMDLR GI  AVD+VVT+LKSRA MIST +EI Q
Sbjct  120  TCATVLTQAILIEGCKSIAAGVNAMDLRIGINAAVDAVVTDLKSRALMISTPDEITQ  176



>ref|XP_010062630.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Eucalyptus 
grandis]
Length=573

 Score =   230 bits (587),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGS-SLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            M+R AA LAS   ++   ++++   ++  +R Y AKDI FG+ ARA MLQGV E+A+AVK
Sbjct  1    MFRIAAKLASS--ISHGYSKKLACRAVIGTRCYVAKDINFGIGARAAMLQGVTEVAEAVK  58

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGR V+IE S G PK+TKDGVTVAKS++F +KVKNVGA LVKQVANATN VAGDG
Sbjct  59   VTMGPKGRIVIIENSRGNPKITKDGVTVAKSIQFKDKVKNVGADLVKQVANATNKVAGDG  118

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLT+AI  EGCKSVAAG N MDLR GI  AVD+V+ +LKSRA MIST EEI Q
Sbjct  119  TTCATVLTQAIVMEGCKSVAAGANVMDLRSGINKAVDAVIADLKSRALMISTPEEITQ  176



>ref|XP_006583012.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Glycine 
max]
Length=574

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 139/179 (78%), Gaps = 5/179 (3%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQI--GSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR A  + S   +A  S + +  G  LS SRN+ +KDI FGV ARA +L GV E+ADAV
Sbjct  1    MYRLARRVGSS--IASPSAKNLVYGGVLS-SRNFVSKDINFGVGARAAILHGVTEVADAV  57

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNV+IE+S G P++TKDGVTVAKS++F +K KNVGA LVKQVA ATN  AGD
Sbjct  58   KVTMGPKGRNVIIERSRGNPRITKDGVTVAKSIKFKDKSKNVGADLVKQVAKATNTAAGD  117

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AI  EGCKS+AAG+N MDLR GI  AVD+V+T LK RA MISTSEEI Q
Sbjct  118  GTTCATVLTQAILTEGCKSIAAGVNVMDLRHGINKAVDAVITELKRRALMISTSEEITQ  176



>gb|KHN39306.1| Chaperonin CPN60-like 2, mitochondrial [Glycine soja]
Length=574

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 139/179 (78%), Gaps = 5/179 (3%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQI--GSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR A  + S   +A  S + +  G  LS SRN+ +KDI FGV ARA +L GV E+ADAV
Sbjct  1    MYRLARRVGSS--IASPSAKNLVYGGVLS-SRNFVSKDINFGVGARAAILHGVTEVADAV  57

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNV+IE+S G P++TKDGVTVAKS++F +K KNVGA LVKQVA ATN  AGD
Sbjct  58   KVTMGPKGRNVIIERSRGNPRITKDGVTVAKSIKFKDKSKNVGADLVKQVAKATNTAAGD  117

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AI  EGCKS+AAG+N MDLR GI  AVD+V+T LK RA MISTSEEI Q
Sbjct  118  GTTCATVLTQAILTEGCKSIAAGVNVMDLRHGINKAVDAVITELKRRALMISTSEEITQ  176



>gb|KCW69759.1| hypothetical protein EUGRSUZ_F03134 [Eucalyptus grandis]
Length=653

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGS-SLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            M+R AA LAS   ++   ++++   ++  +R Y AKDI FG+ ARA MLQGV E+A+AVK
Sbjct  81   MFRIAAKLASS--ISHGYSKKLACRAVIGTRCYVAKDINFGIGARAAMLQGVTEVAEAVK  138

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGR V+IE S G PK+TKDGVTVAKS++F +KVKNVGA LVKQVANATN VAGDG
Sbjct  139  VTMGPKGRIVIIENSRGNPKITKDGVTVAKSIQFKDKVKNVGADLVKQVANATNKVAGDG  198

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLT+AI  EGCKSVAAG N MDLR GI  AVD+V+ +LKSRA MIST EEI Q
Sbjct  199  TTCATVLTQAIVMEGCKSVAAGANVMDLRSGINKAVDAVIADLKSRALMISTPEEITQ  256



>ref|XP_009410784.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   228 bits (581),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 142/184 (77%), Gaps = 7/184 (4%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQ------IGSS-LSWSRNYAAKDIRFGVEARALMLQGVEE  349
            MYR A    + + + ++S Q+      IGS  L ++R+Y AKDI FGV ARA MLQGV E
Sbjct  1    MYRAAVAAVASSALRRSSFQKQRDARRIGSGVLLYARSYVAKDINFGVGARAAMLQGVNE  60

Query  350  LADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATN  529
            LA+AVKVTMGPKGR V+IE+S G  KVTKDGVTVAKS+EF  + KNVGA LVKQVA ATN
Sbjct  61   LAEAVKVTMGPKGRTVIIEKSHGGVKVTKDGVTVAKSIEFKERSKNVGADLVKQVAKATN  120

Query  530  DVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSE  709
              AGDGTTCATVLT+AI AEGCKS+A+G+N MDLR GI MAVD+++++LK RA MIST E
Sbjct  121  TAAGDGTTCATVLTQAILAEGCKSLASGVNVMDLRHGINMAVDTIISHLKHRAWMISTPE  180

Query  710  EIAQ  721
            EI Q
Sbjct  181  EITQ  184



>ref|XP_003531614.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=574

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 139/179 (78%), Gaps = 5/179 (3%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQI--GSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYR A  +AS   +A  S + +  G  LS SRN+ +KDI FGV ARA +LQGV E+ADAV
Sbjct  1    MYRLARRVASS--IASPSAKNLVYGGVLS-SRNFVSKDINFGVGARAAILQGVTEVADAV  57

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKG NV+IE+S G P++TKDGVTVA+S++F +K KNVGA LVKQVA ATN  AGD
Sbjct  58   KVTMGPKGHNVIIERSRGNPRITKDGVTVARSIKFKDKSKNVGADLVKQVAKATNTAAGD  117

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AI  EGCKS+AAG+N MDLR GI  AVD+V+T LKSR  MIST EEI Q
Sbjct  118  GTTCATVLTQAILTEGCKSIAAGINVMDLRNGINKAVDAVITELKSRTLMISTPEEITQ  176



>ref|XP_001419890.1| chaperonin 60, mitochondrial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98183.1| chaperonin 60, mitochondrial [Ostreococcus lucimarinus CCE9901]
Length=584

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = +2

Query  275  SRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVA  454
            +R YA KD+RFGVEARALMLQG ++LADAV+VT+GPKGRNVVIEQ +G PK+TKDGVTVA
Sbjct  31   TRGYA-KDLRFGVEARALMLQGCDKLADAVQVTLGPKGRNVVIEQQYGPPKITKDGVTVA  89

Query  455  KSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLR  634
            K++EF +++ N+GA+LVKQV+ +TNDVAGDGTT ATVL RAIF+EGCKSVAAGMN MDLR
Sbjct  90   KNIEFKDRMMNLGANLVKQVSVSTNDVAGDGTTTATVLARAIFSEGCKSVAAGMNPMDLR  149

Query  635  RGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            RGI  AV+ VV  LK   +MIST+EEIAQ
Sbjct  150  RGINAAVEHVVAELKKNRKMISTTEEIAQ  178



>ref|XP_008462350.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Cucumis melo]
Length=576

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQ-IGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            MYR A+ L   +    +++++ + S ++ SR+Y AKDI FG  ARA MLQGV E+A+AVK
Sbjct  1    MYRLASKLKLASSFGSSTSRKLVCSRVTSSRSYVAKDINFGNGARAAMLQGVSEVAEAVK  60

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGRNV+I+   G+PKVTKDGVTVAKS++F +K KNVGA LVKQVA+ATN  AGDG
Sbjct  61   VTMGPKGRNVIIDSRLGSPKVTKDGVTVAKSIQFKDKAKNVGADLVKQVASATNTAAGDG  120

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLT+AI  EGCKS+AAG+N MDLR GI  AVD+V++ LKS A MIST EEI Q
Sbjct  121  TTCATVLTQAILTEGCKSIAAGVNVMDLRIGIKKAVDAVISELKSTALMISTPEEITQ  178



>emb|CEF99267.1| Chaperonin Cpn60 [Ostreococcus tauri]
Length=587

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +2

Query  269  SWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVT  448
            + +R YA KD+RFGVEARALML+G + LADAV+VT+GPKGRNVVIEQ +G PK+TKDGVT
Sbjct  34   AIARTYA-KDLRFGVEARALMLRGCDTLADAVQVTLGPKGRNVVIEQQYGPPKITKDGVT  92

Query  449  VAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMD  628
            VAK++EF++++ N+GASLVKQV+ +TNDVAGDGTT ATVL RAIF+EGCKSVAAGMN MD
Sbjct  93   VAKNIEFSDRMMNLGASLVKQVSVSTNDVAGDGTTTATVLARAIFSEGCKSVAAGMNPMD  152

Query  629  LRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            LRRGI  AV+ VV  LK   +MIST+EEIAQ
Sbjct  153  LRRGINAAVEHVVKELKKNVKMISTTEEIAQ  183



>gb|AAC04902.1| mitochondrial chaperonin (HSP60) [Arabidopsis thaliana]
Length=524

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  374  MGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTT  553
            MGPKGRNV+IEQSWGAPKVTKDGVTVAKS+EF +++KNVGASLVKQVANATNDVAGDGTT
Sbjct  1    MGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRIKNVGASLVKQVANATNDVAGDGTT  60

Query  554  CATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            CATVLTRAIF EGCKSVAAGMNAMDLRRGI +AVD+VVTNL+SRARMISTSEEIAQ
Sbjct  61   CATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQ  116



>ref|XP_003627097.1| Chaperonin CPN60-like protein [Medicago truncatula]
 gb|AET01573.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=576

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 140/179 (78%), Gaps = 3/179 (2%)
 Frame = +2

Query  191  MYRFAANLASKARVA--KNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAV  364
            MYRFA+ LAS    +  KN       +L   RNY  KDI+FGV ARA MLQGV E+A+AV
Sbjct  1    MYRFASKLASSLASSTSKNKNLVCNGAL-LRRNYVTKDIKFGVGARAAMLQGVSEVAEAV  59

Query  365  KVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGD  544
            KVTMGPKGRNV+IE+S   P+VTKDGVTVAKS++F +K KN+GA L+KQVA ATN  AGD
Sbjct  60   KVTMGPKGRNVIIEKSNRNPRVTKDGVTVAKSIKFKDKAKNLGADLIKQVAKATNSTAGD  119

Query  545  GTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GTTCATVLT+AI  EGCKSVAAG+N MDLR GI  AVD+V+T+LKSRA MISTSEEI Q
Sbjct  120  GTTCATVLTQAILIEGCKSVAAGVNVMDLRNGINKAVDAVITDLKSRAVMISTSEEITQ  178



>ref|XP_003081465.1| chaperonin-60, mitochondrial precursor (IC) [Ostreococcus tauri]
Length=639

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +2

Query  269  SWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVT  448
            + +R YA KD+RFGVEARALML+G + LADAV+VT+GPKGRNVVIEQ +G PK+TKDGVT
Sbjct  30   AIARTYA-KDLRFGVEARALMLRGCDTLADAVQVTLGPKGRNVVIEQQYGPPKITKDGVT  88

Query  449  VAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMD  628
            VAK++EF++++ N+GASLVKQV+ +TNDVAGDGTT ATVL RAIF+EGCKSVAAGMN MD
Sbjct  89   VAKNIEFSDRMMNLGASLVKQVSVSTNDVAGDGTTTATVLARAIFSEGCKSVAAGMNPMD  148

Query  629  LRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            LRRGI  AV+ VV  LK   +MIST+EEIAQ
Sbjct  149  LRRGINAAVEHVVKELKKNVKMISTTEEIAQ  179



>gb|KDP40768.1| hypothetical protein JCGZ_24767 [Jatropha curcas]
Length=1295

 Score =   231 bits (588),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR  + LAS    +  S + +  ++  +R+Y AKDI FGV ARA MLQGV E+A+AVKV
Sbjct  1    MYRVVSRLASSIG-SSASKKLVCGNIICNRSYVAKDINFGVGARAAMLQGVNEVAEAVKV  59

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE+S G PKVTKDGVTVAKS+ F  K KNVGA LVKQVANATN  AGDGT
Sbjct  60   TMGPKGRNVIIEKSHGDPKVTKDGVTVAKSINFKEKSKNVGADLVKQVANATNTAAGDGT  119

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TCATVLT+AI  EGCKSVAAG+N MDLR GI MAV++VV++LK RA MIST EEI Q
Sbjct  120  TCATVLTQAILTEGCKSVAAGVNVMDLRTGINMAVEAVVSDLKKRALMISTPEEITQ  176



>ref|XP_002988181.1| hypothetical protein SELMODRAFT_159265 [Selaginella moellendorffii]
 gb|EFJ10600.1| hypothetical protein SELMODRAFT_159265 [Selaginella moellendorffii]
Length=532

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  305  FGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVK  484
            FGVEARALML+GV ELADAV+VTMGPKGRNVVIE S+G PK+TKDGVTVA+S+ F N+VK
Sbjct  2    FGVEARALMLEGVNELADAVQVTMGPKGRNVVIELSYGTPKITKDGVTVARSMAFENRVK  61

Query  485  NVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSV  664
            NVGA+LVKQVANATN VAGDGTT ATVL R+IFAEG KSVAAGMNAMDLRRG+ MAVD+V
Sbjct  62   NVGAALVKQVANATNAVAGDGTTLATVLARSIFAEGTKSVAAGMNAMDLRRGMNMAVDTV  121

Query  665  VTNLKSRARMISTSEEIAQ  721
            V  LKS+A+ IST  E AQ
Sbjct  122  VEYLKSKAKTISTPTEYAQ  140



>ref|XP_007215308.1| hypothetical protein PRUPE_ppa003440mg [Prunus persica]
 gb|EMJ16507.1| hypothetical protein PRUPE_ppa003440mg [Prunus persica]
Length=574

 Score =   223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  260  SSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKD  439
            S +  +RNY AKDI FGV ARA +LQGV E+A+AVKVTMGPKGR V+IE S   PKVTKD
Sbjct  23   SRVICNRNYVAKDISFGVGARAALLQGVSEVAEAVKVTMGPKGRYVIIENSHKDPKVTKD  82

Query  440  GVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMN  619
            GVTVAKS+ F  K KNVGA LVKQVA ATN  AGDGTTCATVLT+AI  EGCKS+AAG+N
Sbjct  83   GVTVAKSISFKGKYKNVGADLVKQVAKATNTAAGDGTTCATVLTQAILTEGCKSIAAGVN  142

Query  620  AMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AMDLR GI MAVD+VV++LKSRA MIST +EI Q
Sbjct  143  AMDLRIGINMAVDAVVSDLKSRALMISTPDEITQ  176



>gb|EEC79614.1| hypothetical protein OsI_20809 [Oryza sativa Indica Group]
Length=581

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  257  GSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTK  436
            G    W+R YAAK++ FGV ARA +LQGV +LADAVKVTMGPKGRNV+IE+S  APKVTK
Sbjct  29   GEQRLWARGYAAKEVAFGVGARAALLQGVNDLADAVKVTMGPKGRNVIIERSHRAPKVTK  88

Query  437  DGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGM  616
            DGVTVAKS+EF +  KNVGA+LVKQVA ATN VAGDGTTCATVLT+AI  EGCK+VAAG+
Sbjct  89   DGVTVAKSIEFEDSAKNVGANLVKQVAEATNKVAGDGTTCATVLTQAILTEGCKAVAAGV  148

Query  617  NAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            N MDLR GI  A+ S+ T+LKS+A +I++SEEI Q
Sbjct  149  NVMDLRNGINKAISSITTHLKSKAWIINSSEEINQ  183



>ref|NP_001056181.1| Os05g0540300 [Oryza sativa Japonica Group]
 gb|AAV67812.1| putative chaperonin [Oryza sativa Japonica Group]
 dbj|BAF18095.1| Os05g0540300 [Oryza sativa Japonica Group]
 gb|EEE64532.1| hypothetical protein OsJ_19383 [Oryza sativa Japonica Group]
Length=581

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  257  GSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTK  436
            G    W+R YAAK++ FGV ARA +LQGV +LADAVKVTMGPKGRNV+IE+S  APKVTK
Sbjct  29   GEQRLWARGYAAKEVAFGVGARAALLQGVNDLADAVKVTMGPKGRNVIIERSHRAPKVTK  88

Query  437  DGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGM  616
            DGVTVAKS+EF +  KNVGA+LVKQVA ATN VAGDGTTCATVLT+AI  EGCK+VAAG+
Sbjct  89   DGVTVAKSIEFEDSAKNVGANLVKQVAEATNKVAGDGTTCATVLTQAILTEGCKAVAAGV  148

Query  617  NAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            N MDLR GI  A+ S+ T+LKS+A +I++SEEI Q
Sbjct  149  NVMDLRNGINKAISSITTHLKSKAWIINSSEEINQ  183



>ref|XP_011000813.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial, partial [Populus 
euphratica]
Length=527

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  242  STQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGA  421
            S +Q+ S +++SR+Y AKDI  G  ARA MLQ V E+A+AVKVTMGPKGR+V+IE+S G 
Sbjct  34   SKKQLSSRITYSRSYVAKDINLGAGARAAMLQDVNEVAEAVKVTMGPKGRHVIIEKSRGL  93

Query  422  PKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKS  601
             KVTKDGVT+AKS++F  KVKNVGA LVKQVANATN   GDGTTCATVLT+AI  EGCKS
Sbjct  94   LKVTKDGVTIAKSIKFKEKVKNVGADLVKQVANATNTATGDGTTCATVLTQAILIEGCKS  153

Query  602  VAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            V+AG+N MDLR GI +AV +V+++LK RA MIST EEI Q
Sbjct  154  VSAGVNVMDLRNGINIAVHAVLSDLKRRALMISTPEEITQ  193



>gb|ADN34111.1| chaperonin-60 kDa protein [Cucumis melo subsp. melo]
Length=990

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQ-IGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVK  367
            MYR A+ L   +    +++++ + S ++ SR+Y AKDI FG  ARA MLQGV E+A+AVK
Sbjct  273  MYRLASKLKLASSFGSSTSRKLVCSRVTSSRSYVAKDINFGNGARAAMLQGVSEVAEAVK  332

Query  368  VTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDG  547
            VTMGPKGRNV+I+   G+PKVTKDGVTVAKS++F +K KNVGA LVKQVA+ATN  AGDG
Sbjct  333  VTMGPKGRNVIIDSRLGSPKVTKDGVTVAKSIQFKDKAKNVGADLVKQVASATNTAAGDG  392

Query  548  TTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            TTCATVLT+AI  EGCKS+AAG+N MDLR GI  AVD+V++ LKS A MIST EEI Q
Sbjct  393  TTCATVLTQAILTEGCKSIAAGVNVMDLRIGIKKAVDAVISELKSTALMISTPEEITQ  450



>ref|XP_006655538.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Oryza 
brachyantha]
Length=578

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 135/167 (81%), Gaps = 5/167 (3%)
 Frame = +2

Query  221  KARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVV  400
            K  V +   Q++G+     R YAAK++ FGV ARA MLQGV +LADAVKVTMGPKGRNV+
Sbjct  18   KQLVRRGGEQRLGA-----RGYAAKEVAFGVGARAAMLQGVNDLADAVKVTMGPKGRNVI  72

Query  401  IEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAI  580
            IE+S G PKVTKDGVTVAKS+EF +  KNVGA+LVKQVA ATN VAGDGTTCATVLT+AI
Sbjct  73   IERSHGTPKVTKDGVTVAKSIEFEDSTKNVGANLVKQVAEATNKVAGDGTTCATVLTQAI  132

Query  581  FAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
              EGCK+VAAG+N MDLR G+  A++S+ T+LKS+A +I++SEEI Q
Sbjct  133  LTEGCKAVAAGVNVMDLRNGMNKAINSITTHLKSKAWIINSSEEINQ  179



>ref|XP_002960969.1| hypothetical protein SELMODRAFT_74977, partial [Selaginella moellendorffii]
 gb|EFJ38508.1| hypothetical protein SELMODRAFT_74977, partial [Selaginella moellendorffii]
Length=548

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  KDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQS-WGAPKVTKDGVTVAKSVEF  469
            K+ ++GVEAR LMLQGV++LAD VKVTMGPKGRNV+IEQ  +G P+VTKDGVTVAK++ F
Sbjct  1    KNTKYGVEARLLMLQGVQQLADCVKVTMGPKGRNVIIEQDKYGPPRVTKDGVTVAKAIGF  60

Query  470  NNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITM  649
             +K+KNVGA LVK+VA +TND AGDGTT ATVLTRAIF EGCK VAAGMNAM+LRRGI +
Sbjct  61   KDKMKNVGADLVKRVAISTNDAAGDGTTLATVLTRAIFTEGCKLVAAGMNAMELRRGINL  120

Query  650  AVDSVVTNLKSRARMISTSEEIAQ  721
            AVD VV +LK+RA+MISTSEEI+Q
Sbjct  121  AVDHVVFHLKNRAKMISTSEEISQ  144



>ref|XP_002967038.1| hypothetical protein SELMODRAFT_87823, partial [Selaginella moellendorffii]
 gb|EFJ31637.1| hypothetical protein SELMODRAFT_87823, partial [Selaginella moellendorffii]
Length=548

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  KDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQS-WGAPKVTKDGVTVAKSVEF  469
            K+ ++GVEAR LMLQGV++LAD VKVTMGPKGRNV+IEQ  +G P+VTKDGVTVAK++ F
Sbjct  1    KNTKYGVEARLLMLQGVQQLADCVKVTMGPKGRNVIIEQDKYGPPRVTKDGVTVAKAIGF  60

Query  470  NNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITM  649
             +K+KNVGA LVK+VA +TND AGDGTT ATVLTRAIF EGCK VAAGMNAM+LRRGI +
Sbjct  61   KDKMKNVGADLVKRVAISTNDAAGDGTTLATVLTRAIFTEGCKLVAAGMNAMELRRGINL  120

Query  650  AVDSVVTNLKSRARMISTSEEIAQ  721
            AVD VV +LK+RA+MISTSEEI+Q
Sbjct  121  AVDHVVFHLKNRAKMISTSEEISQ  144



>ref|XP_004510380.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Cicer 
arietinum]
Length=576

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  278  RNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAK  457
            RNY  KDI FGV ARA +LQGV E+ADAVKVTMGPKGRNV+IE+S   P+VTKDGVTVAK
Sbjct  31   RNYVTKDINFGVGARAAILQGVSEVADAVKVTMGPKGRNVIIEKSHRNPRVTKDGVTVAK  90

Query  458  SVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRR  637
            S++F ++ KNVGA L+KQVA ATN  AGDGTTCATVLT+AI  EGCKS+AAG+N MDLR 
Sbjct  91   SIKFKDRAKNVGAELIKQVAKATNTTAGDGTTCATVLTQAILIEGCKSIAAGVNVMDLRN  150

Query  638  GITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GI  AVD+V+T+LKSRA  IST EEI Q
Sbjct  151  GINKAVDAVITDLKSRAVRISTPEEITQ  178



>ref|XP_006385443.1| hypothetical protein POPTR_0003s04550g [Populus trichocarpa]
 gb|ERP63240.1| hypothetical protein POPTR_0003s04550g [Populus trichocarpa]
Length=225

 Score =   207 bits (528),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 131/175 (75%), Gaps = 18/175 (10%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR A+ LAS           IG  +++SR+Y AKDI FGV ARA MLQGV E+A+AVKV
Sbjct  1    MYRIASRLAS----------SIGR-VTYSRSYVAKDINFGVGARAAMLQGVNEVAEAVKV  49

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGR+V+IE+S       KDGVTVAKS++F  K K+VGA LVKQVANATN   GDGT
Sbjct  50   TMGPKGRHVIIEKS-------KDGVTVAKSIKFKEKAKSVGADLVKQVANATNTATGDGT  102

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEI  715
            TCATVLT+AI  EGCKSV+AG+N MDLR GI +AV  V+++LK RA MIST EEI
Sbjct  103  TCATVLTQAILVEGCKSVSAGVNVMDLRSGINIAVGGVLSDLKKRALMISTPEEI  157



>emb|CBI35954.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 127/160 (79%), Gaps = 12/160 (8%)
 Frame = +2

Query  191  MYRFAANLASKARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKV  370
            MYR AA LAS  RV           LS SR+Y AKDI FG+ ARA MLQGV ELA+AVKV
Sbjct  1    MYRVAAKLASTIRV-----------LS-SRSYGAKDIHFGIGARAAMLQGVTELAEAVKV  48

Query  371  TMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGT  550
            TMGPKGRNV+IE++ G PKVTKDGVTVAKS++F  K KNVGA LVKQVA+ATN  AGDGT
Sbjct  49   TMGPKGRNVIIEKNRGDPKVTKDGVTVAKSIKFKEKAKNVGADLVKQVASATNTAAGDGT  108

Query  551  TCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVT  670
            TCATVLT+AIF EGCKSVAAG+NAMDLR GI MAV+++ T
Sbjct  109  TCATVLTQAIFTEGCKSVAAGVNAMDLRSGINMAVNAIST  148



>ref|XP_004961365.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Setaria 
italica]
Length=579

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 136/186 (73%), Gaps = 14/186 (8%)
 Frame = +2

Query  191  MYRFAANLASK---------ARVAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGV  343
            MYR A +  S+         AR      Q++     W+R YAAK++ FGV ARA MLQGV
Sbjct  1    MYRAATSAISRSSSALRKHLARGGGGEPQRL-----WARGYAAKEVAFGVGARAAMLQGV  55

Query  344  EELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANA  523
             +LADAVKVTMGPKGR V+IE S+  PK+TKDGVTVAKSVEF +  KNVGA+LVKQVA A
Sbjct  56   NDLADAVKVTMGPKGRTVIIEGSYKGPKITKDGVTVAKSVEFEDSAKNVGANLVKQVAEA  115

Query  524  TNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMIST  703
            TN  AGDGTTCATVLT+AI  EGCK+VAAG+N MDLR GI  A++S+ ++LKS+A  I++
Sbjct  116  TNKTAGDGTTCATVLTQAILTEGCKAVAAGVNVMDLRNGINKAINSITSHLKSKAWKINS  175

Query  704  SEEIAQ  721
             EEI Q
Sbjct  176  PEEINQ  181



>gb|KJB42389.1| hypothetical protein B456_007G151700 [Gossypium raimondii]
Length=521

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  386  GRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATV  565
            GRNVV+EQS+GAPKVTKDGVTVAKS+EF ++VKN+GASLVKQVANATNDVAGDGTTCATV
Sbjct  12   GRNVVLEQSFGAPKVTKDGVTVAKSIEFKDRVKNIGASLVKQVANATNDVAGDGTTCATV  71

Query  566  LTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            LTRAIF EGCKSVAAGMNAMDLRRGITMAVD+VVTNLKSRARMISTSEEIAQ
Sbjct  72   LTRAIFVEGCKSVAAGMNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQ  123



>ref|XP_008862081.1| chaperonin GroL [Aphanomyces invadans]
 gb|ETW08276.1| chaperonin GroL [Aphanomyces invadans]
Length=570

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  230  VAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQ  409
            ++K    Q+  ++S     + KDIRFGVE RALML+G ++LADAV+VT+GPKGRNVVI+Q
Sbjct  2    LSKQVPTQMARTMSKRFFASGKDIRFGVEGRALMLKGADQLADAVQVTLGPKGRNVVIDQ  61

Query  410  SWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAE  589
            ++GAPK+TKDGVTVAK++EF +K +N+GA L++QVAN TND AGDGTT ATVLTRAI++E
Sbjct  62   AYGAPKITKDGVTVAKNIEFRDKFENMGAQLLRQVANNTNDAAGDGTTSATVLTRAIYSE  121

Query  590  GCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GCKSVAAGMN  DLRRGI +AVD VV+ L   ++ I   E++AQ
Sbjct  122  GCKSVAAGMNPQDLRRGIQLAVDHVVSELAKLSQDIDDKEKVAQ  165



>dbj|BAJ88210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=582

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +2

Query  272  WSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTV  451
            W+R YAAK++ FGV ARA ML+GV +LADAVKVTMGPKGRNVVIE+   +PKVTKDGVTV
Sbjct  35   WARGYAAKEVTFGVGARAAMLRGVNDLADAVKVTMGPKGRNVVIERPNRSPKVTKDGVTV  94

Query  452  AKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDL  631
            AKS+EF +  KNVGASLVKQVA+ATN  AGDGTTCATVLT+AI  EGCK+VAAG+N MDL
Sbjct  95   AKSIEFEDSAKNVGASLVKQVADATNKAAGDGTTCATVLTQAILTEGCKAVAAGVNVMDL  154

Query  632  RRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            R GI  A+ +V  +LKS+A MI + +EI Q
Sbjct  155  RNGINKAISAVTAHLKSKAWMIDSPDEINQ  184



>ref|XP_009842908.1| chaperonin GroL [Aphanomyces astaci]
 gb|ETV67651.1| chaperonin GroL [Aphanomyces astaci]
Length=572

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  230  VAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQ  409
            ++K    Q+  S+S     + KDIRFGVE RALML+G ++LADAV+VT+GPKGRNVVI+Q
Sbjct  2    LSKQVQTQMARSVSKRFFASGKDIRFGVEGRALMLKGADQLADAVQVTLGPKGRNVVIDQ  61

Query  410  SWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAE  589
            ++GAPK+TKDGVTVAK++EF +K +N+GA L++QVAN TND AGDGTT ATVLTRAI++E
Sbjct  62   AYGAPKITKDGVTVAKNIEFRDKFENMGAQLLRQVANNTNDAAGDGTTSATVLTRAIYSE  121

Query  590  GCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GCKSVAAGMN  DLRRGI +AVD VV  L   ++ I   E++AQ
Sbjct  122  GCKSVAAGMNPQDLRRGIQLAVDHVVAELAKLSQDIDDKEKVAQ  165



>ref|XP_008862079.1| chaperonin GroL [Aphanomyces invadans]
 gb|ETW08274.1| chaperonin GroL [Aphanomyces invadans]
Length=589

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  230  VAKNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQ  409
            ++K    Q+  ++S     + KDIRFGVE RALML+G ++LADAV+VT+GPKGRNVVI+Q
Sbjct  21   LSKQVPTQMARTMSKRFFASGKDIRFGVEGRALMLKGADQLADAVQVTLGPKGRNVVIDQ  80

Query  410  SWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAE  589
            ++GAPK+TKDGVTVAK++EF +K +N+GA L++QVAN TND AGDGTT ATVLTRAI++E
Sbjct  81   AYGAPKITKDGVTVAKNIEFRDKFENMGAQLLRQVANNTNDAAGDGTTSATVLTRAIYSE  140

Query  590  GCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            GCKSVAAGMN  DLRRGI +AVD VV+ L   ++ I   E++AQ
Sbjct  141  GCKSVAAGMNPQDLRRGIQLAVDHVVSELAKLSQDIDDKEKVAQ  184



>ref|XP_008604447.1| chaperonin GroL [Saprolegnia diclina VS20]
 gb|EQC41878.1| chaperonin GroL [Saprolegnia diclina VS20]
 gb|KDO32441.1| chaperonin GroL [Saprolegnia parasitica CBS 223.65]
Length=567

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  287  AAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVE  466
            + KDIRFGVE RALML+G ++LADAV+VT+GPKGRNVVI+Q++GAPK+TKDGVTVAK++E
Sbjct  17   SGKDIRFGVEGRALMLKGADQLADAVQVTLGPKGRNVVIDQAYGAPKITKDGVTVAKNIE  76

Query  467  FNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGIT  646
            F +K +N+GA L++QVAN TND AGDGTT ATVLTRAI++EGCKSVAAGMN  DLRRGI 
Sbjct  77   FKDKFENMGAQLLRQVANNTNDAAGDGTTSATVLTRAIYSEGCKSVAAGMNPQDLRRGIQ  136

Query  647  MAVDSVVTNLKSRARMISTSEEIAQ  721
            MAVD VV  L + ++ I   E++AQ
Sbjct  137  MAVDFVVAELATLSQDIDDKEKVAQ  161



>gb|EFA83887.1| chaperonin 60 [Polysphondylium pallidum PN500]
Length=558

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 6/165 (4%)
 Frame = +2

Query  230  VAKNSTQQIGSSLSWSRNYA-AKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIE  406
            +AK ++Q +G      R Y+  KDI+FG E RALML+GVE+LA AV+VT+GPKGRNV+++
Sbjct  6    LAKTTSQLVGR-----RAYSTGKDIKFGAECRALMLRGVEQLAAAVEVTLGPKGRNVILD  60

Query  407  QSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFA  586
            Q +GAPK+TKDGVTVAK +EF ++  N+GA LVK VA+ TND+AGDGTT ATVLT+AIFA
Sbjct  61   QPFGAPKITKDGVTVAKHIEFKDRHINLGAQLVKGVASNTNDIAGDGTTTATVLTKAIFA  120

Query  587  EGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            EGCK+VAAGMN MDL RGI  AVD V+  LK  +R IST+EEIAQ
Sbjct  121  EGCKAVAAGMNPMDLWRGINFAVDRVIDELKKLSRPISTTEEIAQ  165



>ref|XP_004359903.1| chaperonin 60 [Dictyostelium fasciculatum]
 gb|EGG22052.1| chaperonin 60 [Dictyostelium fasciculatum]
Length=558

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +2

Query  275  SRNYA-AKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTV  451
            SR+Y+  KDI+FG E RALML+GVE+LA AV+VT+GPKGRNV+++Q +GAPK+TKDGVTV
Sbjct  16   SRSYSTGKDIKFGAECRALMLRGVEQLAAAVEVTLGPKGRNVILDQPFGAPKITKDGVTV  75

Query  452  AKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDL  631
            AK VEF ++  N+GA LVK VA+ TND+AGDGTT ATVLT+AIFAEGCK+VAAGMN MDL
Sbjct  76   AKHVEFKDRHVNLGALLVKGVASNTNDIAGDGTTTATVLTKAIFAEGCKAVAAGMNPMDL  135

Query  632  RRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             RGI  AVD V+  LK  +R IST+EEIAQ
Sbjct  136  WRGINFAVDKVIEELKVLSRPISTTEEIAQ  165



>ref|XP_001017291.2| TCP-1/cpn60 chaperonin family protein [Tetrahymena thermophila]
 gb|EAR97046.2| chaperonin CPN60-1 [Tetrahymena thermophila SB210]
Length=574

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = +2

Query  236  KNSTQQIGSSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSW  415
            K+ST+  G S  +   +AAK++ FG+EAR  ML G E+LADAV+ T+GPKGRNVVIEQ++
Sbjct  12   KSSTK--GLSQKFPMFFAAKELSFGMEARQKMLIGCEKLADAVQTTLGPKGRNVVIEQTF  69

Query  416  GAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGC  595
            G PK+TKDGVTVAK++EF++K +N+GASLVKQVA+ TND AGDGTT ATVL RAIF EGC
Sbjct  70   GPPKITKDGVTVAKNIEFSDKFENIGASLVKQVASKTNDEAGDGTTTATVLARAIFKEGC  129

Query  596  KSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIA  718
            KSVAAGMN MDLRRGI +AVD VV  LK+ +R ++T++ I+
Sbjct  130  KSVAAGMNPMDLRRGINLAVDHVVKTLKANSRPVNTTQLIS  170



>ref|XP_011270172.1| hypothetical protein CAOG_08572, partial [Capsaspora owczarzaki 
ATCC 30864]
Length=384

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +2

Query  260  SSLSWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKD  439
            SS    R YA+K+++FG +AR+ ML+GV +LADAV VTMGPKGRNV+IEQ +G PK+TKD
Sbjct  30   SSSVQVRTYASKELKFGADARSAMLKGVHKLADAVAVTMGPKGRNVIIEQPYGGPKITKD  89

Query  440  GVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMN  619
            GVTVAK++EF +K +N+GA LV+ VA+ TND+AGDGTT AT+L RAI AEG KSVAAG+N
Sbjct  90   GVTVAKAIEFKDKFENLGARLVQDVASKTNDLAGDGTTTATILARAIAAEGFKSVAAGLN  149

Query  620  AMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             +DLRRGI  AVD VV  LK  ++ ++TSEEIAQ
Sbjct  150  PLDLRRGIQSAVDVVVKGLKDLSKPVTTSEEIAQ  183



>emb|CBJ29791.1| conserved unknown protein [Ectocarpus siliculosus]
Length=578

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +2

Query  269  SWSRNYAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVT  448
            S  R    KD++FGVE RALMLQGV+ LADAV+VTMGPKGR+ ++EQ++G P++TKDGVT
Sbjct  18   SVRRLATGKDVKFGVEGRALMLQGVDMLADAVQVTMGPKGRSAILEQTYGVPRITKDGVT  77

Query  449  VAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMD  628
            VAKS+EF +K  N+GA LV+QVA+ TND AGDGTT ATVLTRAIF EGCK+VAAGMN MD
Sbjct  78   VAKSIEFKDKFHNMGAQLVRQVASKTNDAAGDGTTSATVLTRAIFREGCKAVAAGMNPMD  137

Query  629  LRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            LR+GI +A D VV  L   ++ IST EE+AQ
Sbjct  138  LRKGIKLATDHVVNVLSDISKPISTKEEVAQ  168



>gb|KJB56920.1| hypothetical protein B456_009G141700 [Gossypium raimondii]
Length=527

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  329  MLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVK  508
            M+ GV E+ADAVKVTMGPKGRNV+IE S G PKVTKDGVTVAKS++F +K KNVGA LVK
Sbjct  1    MMLGVSEVADAVKVTMGPKGRNVIIESSRGYPKVTKDGVTVAKSIKFKDKAKNVGADLVK  60

Query  509  QVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRA  688
            QVANATN VAGDGTTCATVLT+AI  EGCKS+AAG+N MDLR+GI MAVD+V+++LKSRA
Sbjct  61   QVANATNKVAGDGTTCATVLTQAILLEGCKSLAAGVNVMDLRKGINMAVDTVISDLKSRA  120

Query  689  RMISTSEEIAQ  721
             MIST EEI Q
Sbjct  121  VMISTPEEITQ  131



>emb|CCI46088.1| unnamed protein product [Albugo candida]
Length=580

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  218  SKARVAKNSTQQIGSSLSWSRNYAA-KDIRFGVEARALMLQGVEELADAVKVTMGPKGRN  394
            S+A   K S  Q  +     R++A+ KDIRFGVE RALML+G ++L +AV+VTMGPKGRN
Sbjct  4    SRAIAIKKSLMQHATRAVARRSFASGKDIRFGVEGRALMLKGADQLTNAVEVTMGPKGRN  63

Query  395  VVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTR  574
            VVI+QS+GAPK+TKDGVTVAK+++F +K +N+GA L++QVAN TND AGDGTT ATVLTR
Sbjct  64   VVIDQSYGAPKITKDGVTVAKNIDFKDKFENMGAQLLRQVANNTNDAAGDGTTSATVLTR  123

Query  575  AIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AI++EGCK+VAAGMN  DLRRGI +AVD VV  L+  ++ ++  ++IAQ
Sbjct  124  AIYSEGCKAVAAGMNPTDLRRGIKLAVDHVVEELQKISQDVADKQKIAQ  172



>ref|WP_038387615.1| molecular chaperone GroEL [Bradyrhizobium elkanii]
Length=540

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  287  AAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVE  466
            AAKD++F  EAR  ML+GV+ LA+AVKVT+GPKGRNVVIE+S+GAP++TKDGVTVAK VE
Sbjct  2    AAKDVKFATEARERMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEVE  61

Query  467  FNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGIT  646
              +K +N+GA +V++VA+ TND+AGDGTT ATVL RAIF EG KSVAAGMN MDL+RGI 
Sbjct  62   LEDKFENMGAQMVREVASKTNDLAGDGTTTATVLARAIFKEGSKSVAAGMNPMDLKRGID  121

Query  647  MAVDSVVTNLKSRARMISTSEEIAQ  721
            +AVD+VV++LKS AR I++++EIAQ
Sbjct  122  LAVDAVVSDLKSHARKITSNDEIAQ  146



>emb|CCA20827.1| mitochondriatargeted chaperonin putative [Albugo laibachii Nc14]
Length=580

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  218  SKARVAKNSTQQIGSSLSWSRNYAA-KDIRFGVEARALMLQGVEELADAVKVTMGPKGRN  394
            S+A   K S  Q  +     R++A+ KDIRFGVE RALML+G ++L +AV+VTMGPKGRN
Sbjct  4    SRAIAMKKSLMQHATRAVARRSFASGKDIRFGVEGRALMLKGADQLTNAVEVTMGPKGRN  63

Query  395  VVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTR  574
            VVI+QS+GAPK+TKDGVTVAK+++F +K +N+GA L++QVAN TND AGDGTT ATVLTR
Sbjct  64   VVIDQSFGAPKITKDGVTVAKNIDFKDKFENMGAQLLRQVANNTNDAAGDGTTSATVLTR  123

Query  575  AIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            AI++EGCK+VAAGMN  DLRRGI +AVD VV  L+  ++ ++  ++IAQ
Sbjct  124  AIYSEGCKAVAAGMNPTDLRRGIKLAVDHVVEELQKISQDVADKQKIAQ  172



>ref|XP_003567994.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Brachypodium 
distachyon]
Length=576

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  257  GSSLSWSRNYAA-KDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVT  433
            G    W+R YAA K++ FGV ARA ML+GV +LADAVKVTMGPKGRNV+IE++  +P+VT
Sbjct  23   GEQRQWARGYAAAKEVTFGVGARAAMLRGVNDLADAVKVTMGPKGRNVIIERAHKSPQVT  82

Query  434  KDGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAG  613
            KDGVTVAKS+EF +  KNVGASLVKQVA+ATN VAGDGTTCATVLT+AI  EGCK++AAG
Sbjct  83   KDGVTVAKSIEFEDSAKNVGASLVKQVADATNKVAGDGTTCATVLTQAILTEGCKALAAG  142

Query  614  MNAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            +N MDLR GI  A++++ ++LKS+A  I++ +EI Q
Sbjct  143  VNVMDLRIGINKAINAITSHLKSKAWTINSPDEINQ  178



>dbj|GAM20525.1| hypothetical protein SAMD00019534_037000 [Acytostelium subglobosum 
LB1]
Length=416

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = +2

Query  275  SRNYA-AKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTV  451
            S NY+  K+I+FG E RALML GVE+LA AV+VT+GPKGRNV+++Q +G PK+TKDGVTV
Sbjct  18   SVNYSTGKEIKFGAECRALMLCGVEQLAAAVEVTLGPKGRNVILDQPFGPPKITKDGVTV  77

Query  452  AKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDL  631
            A+ +EF ++  N+GA+LVK VA+ TND+AGDGTT ATVLTRAIFAEGCK+VAAGMN MDL
Sbjct  78   ARHIEFQDRRINLGAALVKGVASKTNDIAGDGTTTATVLTRAIFAEGCKAVAAGMNPMDL  137

Query  632  RRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             RGI  AVD V+  LK  +R I+T+EEIAQ
Sbjct  138  WRGINFAVDRVLEELKKNSRPITTTEEIAQ  167



>ref|XP_009535382.1| hypothetical protein PHYSODRAFT_549587 [Phytophthora sojae]
 gb|EGZ08749.1| hypothetical protein PHYSODRAFT_549587 [Phytophthora sojae]
Length=576

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  287  AAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVE  466
            + KDIRFGVE RA ML+G ++LA+AV+VT+GPKGRNVVI+QS+GAPK+TKDGVTVA+SV+
Sbjct  25   SGKDIRFGVEGRAAMLKGADQLANAVQVTLGPKGRNVVIDQSYGAPKITKDGVTVARSVD  84

Query  467  FNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGIT  646
            F +K +N+GA LV+ VA++TND AGDGTT ATVLTRAIF+EGCKSVAAGMN  DLRRGI 
Sbjct  85   FKDKFENMGAQLVRSVASSTNDAAGDGTTSATVLTRAIFSEGCKSVAAGMNPTDLRRGIQ  144

Query  647  MAVDSVVTNLKSRARMISTSEEIAQ  721
            MAVD VV  L+  ++ ++  E++AQ
Sbjct  145  MAVDHVVDGLQKLSQDVADKEKVAQ  169



>ref|XP_008894090.1| chaperonin GroL [Phytophthora parasitica INRA-310]
 gb|ETI41692.1| chaperonin GroL [Phytophthora parasitica P1569]
 gb|ETK81723.1| chaperonin GroL [Phytophthora parasitica]
 gb|ETL35126.1| chaperonin GroL [Phytophthora parasitica]
 gb|ETL88368.1| chaperonin GroL [Phytophthora parasitica]
 gb|ETM41616.1| chaperonin GroL [Phytophthora parasitica]
 gb|ETN20081.1| chaperonin GroL [Phytophthora parasitica INRA-310]
 gb|ETO70315.1| chaperonin GroL [Phytophthora parasitica P1976]
 gb|ETP11424.1| chaperonin GroL [Phytophthora parasitica CJ01A1]
 gb|ETP39556.1| chaperonin GroL [Phytophthora parasitica P10297]
Length=598

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  287  AAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVE  466
            + KDIRFGVE RA ML+G ++LA+AV+VTMGPKGRNVVI+QS+GAPK+TKDGVTVA+SV+
Sbjct  47   SGKDIRFGVEGRAAMLKGADQLANAVQVTMGPKGRNVVIDQSYGAPKITKDGVTVARSVD  106

Query  467  FNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGIT  646
            F +K +N+GA LV+ VA++TND AGDGTT ATVLTRAIF+EGCKSVAAGMN  DLRRGI 
Sbjct  107  FKDKFENMGAQLVRSVASSTNDAAGDGTTSATVLTRAIFSEGCKSVAAGMNPTDLRRGIQ  166

Query  647  MAVDSVVTNLKSRARMISTSEEIAQ  721
            MAVD VV  L+  +  ++  E++AQ
Sbjct  167  MAVDHVVDGLQKLSMDVADKEKVAQ  191



>ref|XP_002963470.1| hypothetical protein SELMODRAFT_405358 [Selaginella moellendorffii]
 gb|EFJ35341.1| hypothetical protein SELMODRAFT_405358 [Selaginella moellendorffii]
Length=507

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  329  MLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVEFNNKVKNVGASLVK  508
            ML+GV ELADAV+VTMGPKGRNVVIE S+G PK+TKDGVTVA+S+ F N+VKNVGA+LVK
Sbjct  1    MLEGVNELADAVQVTMGPKGRNVVIELSYGTPKITKDGVTVARSMAFENRVKNVGAALVK  60

Query  509  QVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGITMAVDSVVTNLKSRA  688
            QVANATN VAGDGTT ATVL R+IFAEG KSVAAGMNAMDLRRG+ MAVD+VV  LKS+A
Sbjct  61   QVANATNAVAGDGTTLATVLARSIFAEGTKSVAAGMNAMDLRRGMNMAVDTVVEYLKSKA  120

Query  689  RMISTSEEIAQ  721
            + IST  E AQ
Sbjct  121  KTISTPTEYAQ  131



>ref|XP_005708137.1| chaperonin GroEL [Galdieria sulphuraria]
 gb|EME31617.1| chaperonin GroEL [Galdieria sulphuraria]
Length=617

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +2

Query  263  SLSWSRNYA-AKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKD  439
            SL  +RN+A  KD+RF  EAR LML+GV+ LADAV+VT+GPKGRNV+IEQS+GAPK+TKD
Sbjct  63   SLFLTRNFATGKDLRFATEARNLMLKGVDSLADAVEVTLGPKGRNVIIEQSFGAPKITKD  122

Query  440  GVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMN  619
            GVTVAK++EF +K  N+GA LV+ VANATND+AGDGTT ATVL RAI+AEG K+VAAGMN
Sbjct  123  GVTVAKNIEFKDKHMNLGAQLVRSVANATNDIAGDGTTTATVLARAIYAEGIKAVAAGMN  182

Query  620  AMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
             MD++RGI  AV +V   L++ +R I++ EEI Q
Sbjct  183  PMDVKRGIDQAVKAVTEKLRAMSRKINSKEEIQQ  216



>ref|WP_016843172.1| molecular chaperone GroEL [Bradyrhizobium elkanii]
Length=540

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  287  AAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSVE  466
            AAKD++F  EAR  ML+GV+ LA+AVKVT+GPKGRNVVIE+S+GAP++TKDGVTVAK VE
Sbjct  2    AAKDVKFATEARERMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEVE  61

Query  467  FNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGIT  646
              +K +N+GA +V++VA+ TND+AGDGTT ATVL +AIF EG KSVAAGMN MDL+RGI 
Sbjct  62   LEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIFKEGSKSVAAGMNPMDLKRGID  121

Query  647  MAVDSVVTNLKSRARMISTSEEIAQ  721
            +AVD+VV++LKS AR I++++EIAQ
Sbjct  122  LAVDAVVSDLKSHARKITSNDEIAQ  146



>ref|XP_004035017.1| hypothetical protein IMG5_107510 [Ichthyophthirius multifiliis]
 gb|EGR31531.1| hypothetical protein IMG5_107510 [Ichthyophthirius multifiliis]
Length=568

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +2

Query  284  YAAKDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSV  463
            +AAK++ FG E R  ML G E+LADAV+ T+GPKGRNVVIEQ++G+PK+TKDGVTVAKS+
Sbjct  22   FAAKELSFGNECRQKMLVGCEKLADAVQTTLGPKGRNVVIEQTFGSPKITKDGVTVAKSI  81

Query  464  EFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGI  643
            EF++K +N+GASLVKQVA  TND AGDGTT AT+L RAIF EGCKSVAAGMN MDLRRGI
Sbjct  82   EFSDKFENIGASLVKQVAQKTNDEAGDGTTTATILARAIFKEGCKSVAAGMNPMDLRRGI  141

Query  644  TMAVDSVVTNLKSRARMISTSEEIA  718
             +AVD +V  LK+ ++ ++TS+ I+
Sbjct  142  NLAVDHIVKTLKNNSKPVNTSQLIS  166



>ref|XP_003286221.1| chaperonin 60 [Dictyostelium purpureum]
 gb|EGC37251.1| chaperonin 60 [Dictyostelium purpureum]
Length=557

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = +2

Query  260  SSLSWSRNYAA-KDIRFGVEARALMLQGVEELADAVKVTMGPKGRNVVIEQSWGAPKVTK  436
            SS  + RNY++ KDI+FG E RALML+GVE+LA AV+VT+GPKGRNV+++Q +GAPK+TK
Sbjct  9    SSSQFVRNYSSGKDIKFGAECRALMLRGVEQLAAAVEVTLGPKGRNVILDQPFGAPKITK  68

Query  437  DGVTVAKSVEFNNKVKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGM  616
            DGVTVAK VEF ++  N+GA LVK VA+ TND+AGDGTT ATVLT+AI++EGCK+VAAGM
Sbjct  69   DGVTVAKHVEFADRHVNLGALLVKGVASNTNDIAGDGTTTATVLTKAIYSEGCKAVAAGM  128

Query  617  NAMDLRRGITMAVDSVVTNLKSRARMISTSEEIAQ  721
            N MDL RGI  AV+ VV  LK  +R IS++EEI+Q
Sbjct  129  NPMDLWRGINHAVEIVVEELKKLSRPISSTEEISQ  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1323106870870