BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5246

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775599.1|  PREDICTED: uncharacterized protein LOC104225490    185   2e-51   Nicotiana sylvestris
ref|XP_009590542.1|  PREDICTED: uncharacterized protein LOC104087700    164   2e-43   Nicotiana tomentosiformis
ref|XP_004229996.1|  PREDICTED: uncharacterized protein LOC101256522    159   8e-42   Solanum lycopersicum
ref|XP_006339728.1|  PREDICTED: uncharacterized protein LOC102587...    155   2e-40   Solanum tuberosum [potatoes]
ref|XP_011093021.1|  PREDICTED: uncharacterized protein LOC105173071    149   5e-38   Sesamum indicum [beniseed]
emb|CDP08657.1|  unnamed protein product                                143   6e-36   Coffea canephora [robusta coffee]
gb|ACU19530.1|  unknown                                                 130   2e-33   Glycine max [soybeans]
ref|XP_008376151.1|  PREDICTED: uncharacterized protein LOC103439371    134   8e-33   Malus domestica [apple tree]
gb|KHN16423.1|  hypothetical protein glysoja_033827                     134   1e-32   Glycine soja [wild soybean]
ref|XP_006444815.1|  hypothetical protein CICLE_v10019982mg             132   1e-32   
ref|XP_003521812.1|  PREDICTED: uncharacterized protein LOC100784190    133   1e-32   Glycine max [soybeans]
ref|XP_011093988.1|  PREDICTED: uncharacterized protein LOC105173804    133   2e-32   Sesamum indicum [beniseed]
ref|XP_010100718.1|  hypothetical protein L484_023487                   133   2e-32   Morus notabilis
ref|XP_012083190.1|  PREDICTED: uncharacterized protein LOC105642...    131   4e-32   
gb|AGV54569.1|  hypothetical protein                                    126   6e-32   Phaseolus vulgaris [French bean]
gb|KDO86507.1|  hypothetical protein CISIN_1g011727mg                   132   7e-32   Citrus sinensis [apfelsine]
ref|XP_007217991.1|  hypothetical protein PRUPE_ppa005611mg             131   8e-32   Prunus persica
ref|XP_012083189.1|  PREDICTED: uncharacterized protein LOC105642...    131   9e-32   Jatropha curcas
ref|XP_012083184.1|  PREDICTED: uncharacterized protein LOC105642...    131   9e-32   Jatropha curcas
ref|XP_010661958.1|  PREDICTED: uncharacterized protein LOC100260...    130   2e-31   Vitis vinifera
ref|XP_002265230.1|  PREDICTED: uncharacterized protein LOC100260...    130   2e-31   
ref|XP_006491300.1|  PREDICTED: uncharacterized protein LOC102628...    130   2e-31   Citrus sinensis [apfelsine]
emb|CBI40568.3|  unnamed protein product                                130   2e-31   Vitis vinifera
gb|KDO86508.1|  hypothetical protein CISIN_1g011727mg                   130   2e-31   Citrus sinensis [apfelsine]
ref|XP_006444816.1|  hypothetical protein CICLE_v10019982mg             130   2e-31   Citrus clementina [clementine]
ref|XP_004306652.1|  PREDICTED: uncharacterized protein LOC101307620    130   2e-31   Fragaria vesca subsp. vesca
ref|XP_008233124.1|  PREDICTED: uncharacterized protein LOC103332188    128   9e-31   Prunus mume [ume]
ref|XP_002523322.1|  conserved hypothetical protein                     128   1e-30   
gb|KHN35389.1|  hypothetical protein glysoja_029019                     127   1e-30   Glycine soja [wild soybean]
ref|XP_007147328.1|  hypothetical protein PHAVU_006G114600g             125   9e-30   Phaseolus vulgaris [French bean]
ref|XP_009375414.1|  PREDICTED: uncharacterized protein LOC103964229    125   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_011038435.1|  PREDICTED: uncharacterized protein LOC105135311    118   3e-27   Populus euphratica
ref|XP_002320873.1|  hypothetical protein POPTR_0014s09580g             117   4e-27   
ref|XP_010544849.1|  PREDICTED: uncharacterized protein LOC104817374    117   4e-27   Tarenaya hassleriana [spider flower]
ref|XP_008352337.1|  PREDICTED: uncharacterized protein LOC103415805    116   2e-26   
gb|KJB09632.1|  hypothetical protein B456_001G153700                    114   5e-26   Gossypium raimondii
gb|KJB41570.1|  hypothetical protein B456_007G109800                    114   6e-26   Gossypium raimondii
ref|NP_001062992.1|  Os09g0363500                                       114   6e-26   
gb|EAZ08801.1|  hypothetical protein OsI_31062                          114   6e-26   Oryza sativa Indica Group [Indian rice]
gb|EYU38879.1|  hypothetical protein MIMGU_mgv1a007152mg                114   7e-26   Erythranthe guttata [common monkey flower]
gb|KEH24691.1|  transmembrane protein, putative                         113   1e-25   Medicago truncatula
ref|XP_010267568.1|  PREDICTED: uncharacterized protein LOC104604754    114   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006852588.1|  PREDICTED: uncharacterized protein LOC18442303     113   3e-25   Amborella trichopoda
ref|XP_006660568.1|  PREDICTED: uncharacterized protein LOC102720628    112   4e-25   Oryza brachyantha
gb|KHG18669.1|  Alanine--tRNA ligase                                    112   5e-25   Gossypium arboreum [tree cotton]
gb|KHN15921.1|  hypothetical protein glysoja_013137                     111   6e-25   Glycine soja [wild soybean]
ref|XP_010055001.1|  PREDICTED: uncharacterized protein LOC104443...    111   8e-25   Eucalyptus grandis [rose gum]
ref|XP_010054998.1|  PREDICTED: uncharacterized protein LOC104443...    111   9e-25   Eucalyptus grandis [rose gum]
gb|KHG01749.1|  hypothetical protein F383_21898                         110   1e-24   Gossypium arboreum [tree cotton]
ref|XP_009395815.1|  PREDICTED: uncharacterized protein LOC103980983    110   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010266583.1|  PREDICTED: uncharacterized protein LOC104604...    110   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010266582.1|  PREDICTED: uncharacterized protein LOC104604...    110   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010266580.1|  PREDICTED: uncharacterized protein LOC104604...    110   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010053838.1|  PREDICTED: uncharacterized protein LOC104442...    109   4e-24   Eucalyptus grandis [rose gum]
ref|XP_010053834.1|  PREDICTED: uncharacterized protein LOC104442...    109   4e-24   Eucalyptus grandis [rose gum]
ref|XP_009410810.1|  PREDICTED: uncharacterized protein LOC103992723    106   8e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011650672.1|  PREDICTED: uncharacterized protein LOC101208119    105   1e-22   Cucumis sativus [cucumbers]
ref|XP_007051516.1|  Uncharacterized protein isoform 1                  102   6e-22   
ref|XP_008437876.1|  PREDICTED: uncharacterized protein LOC103483...    103   7e-22   Cucumis melo [Oriental melon]
ref|XP_008437874.1|  PREDICTED: uncharacterized protein LOC103483...    103   7e-22   Cucumis melo [Oriental melon]
ref|XP_010523818.1|  PREDICTED: uncharacterized protein LOC104802082  97.4    7e-20   Tarenaya hassleriana [spider flower]
gb|EYU32264.1|  hypothetical protein MIMGU_mgv1a008979mg              92.0    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_004956665.1|  PREDICTED: uncharacterized protein LOC101784246  91.3    1e-17   Setaria italica
ref|XP_008810689.1|  PREDICTED: uncharacterized protein LOC103722046  90.5    2e-17   Phoenix dactylifera
ref|XP_010924900.1|  PREDICTED: uncharacterized protein LOC105047...  89.0    3e-17   
ref|XP_010924899.1|  PREDICTED: uncharacterized protein LOC105047...  89.4    8e-17   Elaeis guineensis
ref|XP_010912331.1|  PREDICTED: uncharacterized protein LOC105038276  88.2    2e-16   Elaeis guineensis
ref|XP_009394123.1|  PREDICTED: uncharacterized protein LOC103979678  88.2    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001061754.1|  Os08g0400300                                     85.5    1e-15   
gb|EAZ06915.1|  hypothetical protein OsI_29154                        85.5    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_002444305.1|  hypothetical protein SORBIDRAFT_07g019910        79.3    2e-13   Sorghum bicolor [broomcorn]
ref|XP_008667745.1|  PREDICTED: uncharacterized protein LOC100278...  78.6    3e-13   Zea mays [maize]
ref|NP_001145179.1|  uncharacterized protein LOC100278420             78.6    3e-13   Zea mays [maize]
ref|XP_010506666.1|  PREDICTED: uncharacterized protein LOC104783236  75.9    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010695879.1|  PREDICTED: uncharacterized protein LOC104908...  74.3    7e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010695652.1|  PREDICTED: uncharacterized protein LOC104908...  74.3    7e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS55815.1|  hypothetical protein TRIUR3_07244                     72.8    2e-11   Triticum urartu
ref|XP_003578029.1|  PREDICTED: uncharacterized protein LOC100835776  72.4    3e-11   Brachypodium distachyon [annual false brome]
ref|XP_006397848.1|  hypothetical protein EUTSA_v10001490mg           72.0    3e-11   Eutrema salsugineum [saltwater cress]
ref|XP_004973378.1|  PREDICTED: uncharacterized protein LOC101780987  71.2    7e-11   Setaria italica
gb|EMT30136.1|  hypothetical protein F775_07795                       70.9    9e-11   
ref|XP_006659382.1|  PREDICTED: uncharacterized protein LOC102700820  70.9    1e-10   Oryza brachyantha
ref|XP_009351984.1|  PREDICTED: uncharacterized protein LOC103943406  70.1    2e-10   Pyrus x bretschneideri [bai li]
ref|NP_566080.1|  uncharacterized protein                             69.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAM98127.1|  expressed protein                                     69.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272343.1|  PREDICTED: uncharacterized protein LOC100243561  69.3    3e-10   Vitis vinifera
ref|NP_001144345.1|  uncharacterized protein LOC100277248             69.3    3e-10   Zea mays [maize]
ref|XP_006294183.1|  hypothetical protein CARUB_v10023177mg           68.6    5e-10   
dbj|BAJ85356.1|  predicted protein                                    68.6    6e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93272.1|  predicted protein                                    68.6    6e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002882075.1|  hypothetical protein ARALYDRAFT_483815           68.2    8e-10   
ref|XP_004510657.1|  PREDICTED: uncharacterized protein LOC101490...  67.8    9e-10   Cicer arietinum [garbanzo]
ref|XP_008234716.1|  PREDICTED: uncharacterized protein LOC103333621  67.4    1e-09   Prunus mume [ume]
ref|XP_008381203.1|  PREDICTED: uncharacterized protein LOC103444069  67.4    1e-09   Malus domestica [apple tree]
gb|AAM61512.1|  unknown                                               66.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518331.1|  PREDICTED: uncharacterized protein LOC104793634  64.7    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010053839.1|  PREDICTED: uncharacterized protein LOC104442...  64.3    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010507999.1|  PREDICTED: uncharacterized protein LOC104784...  63.5    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006294182.1|  hypothetical protein CARUB_v10023177mg           63.2    3e-08   
ref|XP_007217977.1|  hypothetical protein PRUPE_ppa005435mg           62.8    6e-08   Prunus persica
ref|XP_009142627.1|  PREDICTED: uncharacterized protein LOC103866456  62.0    9e-08   Brassica rapa
emb|CDY56879.1|  BnaC04g52160D                                        60.1    4e-07   Brassica napus [oilseed rape]
ref|XP_011470673.1|  PREDICTED: uncharacterized protein LOC101306176  58.9    9e-07   Fragaria vesca subsp. vesca
ref|XP_010480486.1|  PREDICTED: uncharacterized protein LOC104759...  56.6    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010457146.1|  PREDICTED: uncharacterized protein LOC104738...  56.2    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_003574449.1|  PREDICTED: uncharacterized protein LOC100831357  56.2    9e-06   Brachypodium distachyon [annual false brome]
ref|NP_563623.1|  uncharacterized protein                             55.5    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64874.1|  unknown                                               55.5    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305329.1|  hypothetical protein CARUB_v10009708mg           55.1    2e-05   
ref|XP_006418404.1|  hypothetical protein EUTSA_v10008123mg           55.1    2e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010480492.1|  PREDICTED: uncharacterized protein LOC104759...  54.7    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002892078.1|  hypothetical protein ARALYDRAFT_470152           54.7    2e-05   
ref|XP_010474714.1|  PREDICTED: uncharacterized protein LOC104754270  54.7    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010457147.1|  PREDICTED: uncharacterized protein LOC104738...  54.7    2e-05   Camelina sativa [gold-of-pleasure]
gb|KEH18627.1|  transmembrane protein, putative                       54.3    3e-05   Medicago truncatula
ref|XP_008376756.1|  PREDICTED: uncharacterized protein LOC103439...  52.4    2e-04   Malus domestica [apple tree]
ref|XP_008376754.1|  PREDICTED: uncharacterized protein LOC103439...  52.0    2e-04   Malus domestica [apple tree]
emb|CDX85174.1|  BnaC07g07320D                                        50.8    2e-04   
emb|CDY27317.1|  BnaC04g50880D                                        50.8    5e-04   Brassica napus [oilseed rape]
emb|CDY61731.1|  BnaA04g27190D                                        49.7    0.001   Brassica napus [oilseed rape]
ref|XP_009142425.1|  PREDICTED: uncharacterized protein LOC103866...  49.7    0.001   Brassica rapa



>ref|XP_009775599.1| PREDICTED: uncharacterized protein LOC104225490 [Nicotiana sylvestris]
 ref|XP_009775600.1| PREDICTED: uncharacterized protein LOC104225490 [Nicotiana sylvestris]
 ref|XP_009775601.1| PREDICTED: uncharacterized protein LOC104225490 [Nicotiana sylvestris]
Length=474

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 125/184 (68%), Gaps = 10/184 (5%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEAR AWQR ANRC VQEDAKRAPKLACC   SPSAK+VDTGPA+ A+ Q+    CF
Sbjct  1    MAVAEARTAWQRAANRCLVQEDAKRAPKLACCSSASPSAKQVDTGPANGADAQNPSSTCF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQGSSTFGNSTSK----  498
            LP N N SY +LSPN+RWWLHL+PNYGYQ GL  E + S++ EM+      +ST K    
Sbjct  61   LPFNRNFSYCDLSPNTRWWLHLQPNYGYQRGLVSETVDSLEAEMESIGPVLDSTPKNSKF  120

Query  499  --LSEYEIEYVDEFTVDKSLLDSQVKMSAS-VKNDLGIGDKKLDTAFGSDSLDDCLRLES  669
               SE + +YVDE TV  S LD QVK SAS V +DLG+G K+L   F +D   D L LE 
Sbjct  121  TDQSEADDDYVDEVTVGGS-LDYQVKRSASHVNSDLGVGHKELIDVF-TDISKDSLNLED  178

Query  670  IKNP  681
             + P
Sbjct  179  GRYP  182



>ref|XP_009590542.1| PREDICTED: uncharacterized protein LOC104087700 [Nicotiana tomentosiformis]
 ref|XP_009590543.1| PREDICTED: uncharacterized protein LOC104087700 [Nicotiana tomentosiformis]
Length=474

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 127/204 (62%), Gaps = 10/204 (5%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEAR AWQR ANRC VQEDAKRAPKLACC   SPS+K+VDTGPA+ A+ Q+    CF
Sbjct  1    MAVAEARTAWQRAANRCLVQEDAKRAPKLACCSSASPSSKQVDTGPANGADAQNPSSTCF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQGSSTFGNSTSK----  498
            LP N NSSY +LSPN+RWWLHL+PNYGYQ GL  E + S + EM+      +ST K    
Sbjct  61   LPFNRNSSYCDLSPNTRWWLHLQPNYGYQRGLVSETVDSQEAEMENIGPVLDSTPKNSKF  120

Query  499  --LSEYEIEYVDEFTVDKSLLDSQVKMSAS-VKNDLGIGDKKLDTAFGSDSLDDCLRLES  669
               SE +  Y+DE TV  S LD QVK SAS V +DL +G K+L   F   S  D L LE 
Sbjct  121  CDQSEADGGYMDEVTVGGS-LDYQVKRSASHVNSDLEVGSKELIDVFTEIS-KDGLHLED  178

Query  670  IKNPTGFRMTESFDCPVSKPASEL  741
               P      +  D  V K   EL
Sbjct  179  TGYPYEESKKDMVDFTVCKQVDEL  202



>ref|XP_004229996.1| PREDICTED: uncharacterized protein LOC101256522 [Solanum lycopersicum]
 ref|XP_004229997.1| PREDICTED: uncharacterized protein LOC101256522 [Solanum lycopersicum]
 ref|XP_010327160.1| PREDICTED: uncharacterized protein LOC101256522 [Solanum lycopersicum]
Length=474

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 125/204 (61%), Gaps = 10/204 (5%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEAR AWQR  NRC VQEDAKRAPKLACC   SPS+K+VDTGPA+ A+ Q+    CF
Sbjct  1    MAVAEARTAWQRAVNRCLVQEDAKRAPKLACCSSASPSSKQVDTGPANGADAQNPSGTCF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQGSSTFGNSTSKL---  501
            LP + NSSY +LSPNSRWWLHL+PNYGYQ GL  E + S++ EM+      +S  K    
Sbjct  61   LPFDRNSSYCDLSPNSRWWLHLQPNYGYQKGLVSELVDSIEAEMENIGPVLDSIPKYNKL  120

Query  502  ---SEYEIEYVDEFTVDKSLLDSQVKMSAS-VKNDLGIGDKKLDTAFGSDSLDDCLRLES  669
               +E +   VD+FTV  S LDSQV  SAS V +DLG+G K+L   F   S  D   LE 
Sbjct  121  CDQNEADSICVDKFTVGGS-LDSQVTRSASYVNSDLGVGSKELTDVFTEIS-KDSPNLED  178

Query  670  IKNPTGFRMTESFDCPVSKPASEL  741
               P         D  V K   EL
Sbjct  179  TGYPNEASKKGLVDLTVGKQIDEL  202



>ref|XP_006339728.1| PREDICTED: uncharacterized protein LOC102587530 isoform X1 [Solanum 
tuberosum]
 ref|XP_006339729.1| PREDICTED: uncharacterized protein LOC102587530 isoform X2 [Solanum 
tuberosum]
Length=470

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 123/204 (60%), Gaps = 10/204 (5%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEAR AWQR  NRC VQEDAKRAPKLACC   SPS+K+VD GPA+ A+ Q+     F
Sbjct  1    MAVAEARTAWQRAVNRCLVQEDAKRAPKLACCSSASPSSKQVDAGPANGADAQNPSGTYF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQGSSTFGNSTSKL---  501
            LP + NSSY +LSPNSRWWLHL+PNYGYQ GL  E + S++ EM+      +S  K    
Sbjct  61   LPFDRNSSYCDLSPNSRWWLHLQPNYGYQKGLVSELVDSIEAEMENIGPVLDSIPKYNKL  120

Query  502  ---SEYEIEYVDEFTVDKSLLDSQVKMSAS-VKNDLGIGDKKLDTAFGSDSLDDCLRLES  669
               +E +   VD+FTV  S LDSQV  SAS V NDLG+G K+L   F   S  D   LE 
Sbjct  121  CDQNEADSICVDKFTVGGS-LDSQVTRSASYVNNDLGVGSKELTDVFTEIS-KDSPNLED  178

Query  670  IKNPTGFRMTESFDCPVSKPASEL  741
               P         D  V K   EL
Sbjct  179  TGYPNKASKKGLVDLTVGKQIDEL  202



>ref|XP_011093021.1| PREDICTED: uncharacterized protein LOC105173071 [Sesamum indicum]
 ref|XP_011093022.1| PREDICTED: uncharacterized protein LOC105173071 [Sesamum indicum]
Length=478

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 113/197 (57%), Gaps = 10/197 (5%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSP-SAKEVDTGPASAANPQDAERAC  330
            MA AEARAAWQRTANRC VQEDAKRAPKLACC  + P S K+ +TGP  AA  QD   + 
Sbjct  1    MAFAEARAAWQRTANRCLVQEDAKRAPKLACCSSSVPPSVKQAETGPTGAAGGQDIPNSP  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEY  510
             LP N   SYSNLSPNSRWWL L+PNYGYQ GL  E   S +   G+     ++  ++  
Sbjct  61   SLPFNHYPSYSNLSPNSRWWLQLQPNYGYQKGLTDEQFTSTEGKIGTCQIQENSGDVAS-  119

Query  511  EIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNPTGF  690
                VD  +  +S  D+Q       K +  + D K  T  G D   D L+LE  ++    
Sbjct  120  --NVVDRTSHVESSFDNQFG-----KEEFSVEDGKFGTFCGRD-CQDPLKLEVKEDFREL  171

Query  691  RMTESFDCPVSKPASEL  741
            R  + F C VSK A++L
Sbjct  172  RGEDLFCCEVSKNANDL  188



>emb|CDP08657.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 116/201 (58%), Gaps = 7/201 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEARAAWQRT NRC VQEDAKRAPKLA CP  SP  +EV+ GPA+AA  QD     F
Sbjct  1    MAVAEARAAWQRTVNRCLVQEDAKRAPKLAYCPLASPFVREVEVGPANAAEAQDISSVAF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQGSSTFGNSTSKLSEY  510
             P N ++S+SNLSPNS+WWL L  NY +Q GL  + L   D EM+      +S  K+ E 
Sbjct  61   PPFNQSTSFSNLSPNSKWWLQLPSNYRHQRGLTDQQLNCTDSEMETFHDRTSSALKMPES  120

Query  511  E---IEYVDEFTVDKSLLDSQVK-MSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKN  678
            E     + D    + S +DS ++ +S  +K D  +GDK L T     +     +LE + +
Sbjct  121  EDGSALFYDSIETE-SFVDSDLRILSTGLKKDTEVGDKDL-TPMNKLNPQCSPKLEDVGD  178

Query  679  PTGFRMTESFDCPVSKPASEL  741
                    ++ C VSK  +EL
Sbjct  179  LYERAEIGTYGCTVSKKKNEL  199



>gb|ACU19530.1| unknown [Glycine max]
Length=174

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 83/126 (66%), Gaps = 3/126 (2%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +  ++K VDTGPAS A+  D      
Sbjct  1    MAGAEARALWQRTANRCFVQEDAKRAPKLACCQSSCATSKSVDTGPASTADESDHNTVNV  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSV-DEMQGSSTFGNSTSKLSEY  510
               N  SS SNLS + RWWLH +PNYGYQ GL  E L ++ DE++  +   +  SK SE 
Sbjct  61   THFNRKSSISNLSSDCRWWLHSQPNYGYQKGLTYEQLNALEDEVE--TLLASDLSKNSEE  118

Query  511  EIEYVD  528
              E +D
Sbjct  119  FHELMD  124



>ref|XP_008376151.1| PREDICTED: uncharacterized protein LOC103439371 [Malus domestica]
 ref|XP_008376152.1| PREDICTED: uncharacterized protein LOC103439371 [Malus domestica]
Length=450

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 109/198 (55%), Gaps = 13/198 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +S + ++VD GPA+ A   D     F
Sbjct  1    MAAAEARAVWQRTANRCFVQEDAKRAPKLACCQSSSSTTRQVDAGPATVAEGPDHPATGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P N N SYS+L P++RWWL ++P+YGYQ     E L  L  D     + F  ST K SE
Sbjct  61   MPINRNPSYSSLPPDTRWWLQMQPSYGYQKDFTYEQLSALEADMETLRAGFVKSTPKTSE  120

Query  508  YEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNPTG  687
               +   EFT   S +  +    A  K D+        +A  S ++ + L+ E +K    
Sbjct  121  VHQQKA-EFTDAVSAVCMKTGYEAQ-KQDV--------SAKYSKNMQEPLQYE-MKEKYE  169

Query  688  FRMTESFDCPVSKPASEL  741
                ++ DCPVS    E 
Sbjct  170  IMGMDTIDCPVSNQPKEF  187



>gb|KHN16423.1| hypothetical protein glysoja_033827 [Glycine soja]
Length=426

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +  ++K VD GPAS A+  D      
Sbjct  1    MAGAEARALWQRTANRCFVQEDAKRAPKLACCQSSCATSKSVDAGPASTADESDHTTVNV  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
               N  SS SNLSP+SRWWLHL+PNYGYQ GL  E L ++++ +  +   +  SK SE  
Sbjct  61   THFNRKSSISNLSPDSRWWLHLQPNYGYQKGLTYEQLNTLED-EVETLLASDLSKNSEEF  119

Query  514  IEYVD  528
             E +D
Sbjct  120  QELMD  124



>ref|XP_006444815.1| hypothetical protein CICLE_v10019982mg [Citrus clementina]
 gb|ESR58055.1| hypothetical protein CICLE_v10019982mg [Citrus clementina]
Length=335

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 115/205 (56%), Gaps = 9/205 (4%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERAC  330
            +MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S S+K+VD GPA  A+  D   A 
Sbjct  3    VMAGAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSSSSKQVDAGPAGVADAPDHPAAG  62

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLS  504
            F+P N N  YS L  ++RWWL L+PNYG Q GL  E + +V+ EM+   + F NS SK S
Sbjct  63   FMPLNMNHLYSELPSDTRWWLQLQPNYGCQKGLTSEQISAVEAEMEALRAGFVNSPSKFS  122

Query  505  -EYEIEYVDEFTVDKSLLDSQV------KMSASVKNDLGIGDKKLDTAFGSDSLDDCLRL  663
             +  ++      VD S+ +         ++SA  +N      K+   A    +  + + L
Sbjct  123  GDPSLDSTGGTLVDGSINNDVSHDELYNRVSAVCRNKDPEVRKQNVEAVDCKTTQEFIEL  182

Query  664  ESIKNPTGFRMTESFDCPVSKPASE  738
              I+    F   +S  CP SK + E
Sbjct  183  MDIRENYEFIEMDSVGCPSSKTSKE  207



>ref|XP_003521812.1| PREDICTED: uncharacterized protein LOC100784190 [Glycine max]
Length=426

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +  ++K VD GPAS A+  D      
Sbjct  1    MAGAEARALWQRTANRCFVQEDAKRAPKLACCQSSCATSKSVDAGPASTADESDHTTVNV  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
               N  SS SNLSP+SRWWLHL+PNYGYQ GL  E L ++++ +  +   +  SK SE  
Sbjct  61   THFNRKSSISNLSPDSRWWLHLQPNYGYQKGLTYEQLNALED-EVETLLASDLSKNSEEF  119

Query  514  IEYVD  528
             E +D
Sbjct  120  QELMD  124



>ref|XP_011093988.1| PREDICTED: uncharacterized protein LOC105173804 [Sesamum indicum]
 ref|XP_011093996.1| PREDICTED: uncharacterized protein LOC105173804 [Sesamum indicum]
 ref|XP_011094003.1| PREDICTED: uncharacterized protein LOC105173804 [Sesamum indicum]
Length=454

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 102/176 (58%), Gaps = 12/176 (7%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERAC  330
            +MA+AEARAAWQRTANRCFVQEDAKRAPKLACC   +PS K+ +TG  +AA  QD     
Sbjct  1    MMALAEARAAWQRTANRCFVQEDAKRAPKLACCSSVTPSVKQAETGTNTAAAGQDTPSTG  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEY  510
             LP N   SYSNLSPNS+WWL L+P+Y YQ GL  E   S++   G+     S   L+  
Sbjct  61   SLPLNL-PSYSNLSPNSKWWLQLQPSYVYQKGLMDEQFNSLEANMGTCQMQESLGALARK  119

Query  511  EIE--YVDEFTVDKSLLDSQV-------KMSASVKNDLGIGDKKLDTAFGSDSLDD  651
            E +    ++ T +    DSQ        K    VK D  +G+ KL    G + L +
Sbjct  120  EDDPGLSNQMTSNTFSSDSQYRSFTTGDKKVFGVKED--VGELKLGGLVGDEVLKN  173



>ref|XP_010100718.1| hypothetical protein L484_023487 [Morus notabilis]
 gb|EXB83880.1| hypothetical protein L484_023487 [Morus notabilis]
Length=472

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 114/198 (58%), Gaps = 8/198 (4%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEARA WQR ANRCFVQEDAKRAPKLACC  +S S +    G A+A +  D     F
Sbjct  1    MAVAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSTSKQVEAGGHATATDGPDHPAVGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFG--NSTSKLSE  507
            +P+N   SYSNL P++RWWLH++PNYG Q G   E + +++  +G+   G  NSTS++SE
Sbjct  61   MPTNRCPSYSNLPPDTRWWLHMQPNYGCQKGFTYEQMNALENEEGTKNAGVVNSTSRISE  120

Query  508  YEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNPTG  687
                  D+   ++  +      +A+ K    +G K +    G D +++ + LE       
Sbjct  121  AHKRKGDK--NNECFVSVH---NAAQKKASEVGKKNVKALDGKD-IEELIGLEDSTVSWE  174

Query  688  FRMTESFDCPVSKPASEL  741
                +S DC  +K ++E+
Sbjct  175  IMQVDSIDCSDTKQSNEM  192



>ref|XP_012083190.1| PREDICTED: uncharacterized protein LOC105642829 isoform X3 [Jatropha 
curcas]
Length=352

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEARA WQR ANRCFVQEDAKRAPKLACC  +S S++++D G   AA+  D     F
Sbjct  1    MAVAEARAVWQRVANRCFVQEDAKRAPKLACCQSSSSSSRQIDGGSTDAADMTDNPGVGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLSE  507
            +P + N SYSNL P++RWWL L+PNYGYQ GL  E L +++ EM+   +   +STSK+ E
Sbjct  61   MPLHRNPSYSNLPPDTRWWLQLQPNYGYQKGLTYEQLNALEAEMESLRAEIADSTSKIGE  120



>gb|AGV54569.1| hypothetical protein [Phaseolus vulgaris]
Length=174

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +  ++K VDT PAS ++  D      
Sbjct  1    MAGAEARALWQRTANRCFVQEDAKRAPKLACCQSSCATSKLVDTEPASPSDESDHTAVNV  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
            +  N  SS SNLSP+ RWWLHL+PNYGYQ G   E L  ++E   + T  + +    E++
Sbjct  61   IHFNRKSSVSNLSPDCRWWLHLQPNYGYQKGSTYEQLNILEEEVETLTASDVSKNSQEFQ  120



>gb|KDO86507.1| hypothetical protein CISIN_1g011727mg [Citrus sinensis]
Length=478

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 115/205 (56%), Gaps = 9/205 (4%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERAC  330
            +MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S S+K+VD GPA  A+  D   A 
Sbjct  3    VMAGAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSSSSKQVDAGPAGVADAPDHPAAG  62

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLS  504
            F+P N N  YS L  ++RWWL L+PNYG Q GL  E + +V+ EM+   + F NS SK S
Sbjct  63   FMPLNMNHLYSELPSDTRWWLQLQPNYGCQKGLTSEQISAVEAEMEALRAGFVNSPSKFS  122

Query  505  -EYEIEYVDEFTVDKSLLDSQV------KMSASVKNDLGIGDKKLDTAFGSDSLDDCLRL  663
             +  ++      VD S+ +         ++SA  +N      K+   A    +  + + L
Sbjct  123  GDPSLDSTGGTLVDGSINNDVSHDELYNRVSAVCRNKDPEVRKQNVEAVDCKTTQEFIEL  182

Query  664  ESIKNPTGFRMTESFDCPVSKPASE  738
              I+    F   +S  CP SK + E
Sbjct  183  MDIRENYEFIEMDSVGCPSSKTSKE  207



>ref|XP_007217991.1| hypothetical protein PRUPE_ppa005611mg [Prunus persica]
 gb|EMJ19190.1| hypothetical protein PRUPE_ppa005611mg [Prunus persica]
Length=451

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 106/198 (54%), Gaps = 16/198 (8%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S + K+VD GPA+AA   D   A F
Sbjct  1    MAAAEARAVWQRVANRCFVQEDAKRAPKLACCQSSSSTTKQVDAGPATAAEGPDHPAAGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P N N SYS+L P++RWWL ++P+YGYQ     E L  L  D     + F  ST K SE
Sbjct  61   VPLNRNPSYSSLPPDARWWLQMQPSYGYQKDFTYEQLNALEADMETLRAGFVKSTPKTSE  120

Query  508  YEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNPTG  687
               +  +    D        K S   K D       ++  +G D + + ++ + ++    
Sbjct  121  VRQQKGECTDADGH------KNSKVQKQD-------VNAQYGKD-MKELVQYKDVREKYE  166

Query  688  FRMTESFDCPVSKPASEL  741
                ++ D P SK   E 
Sbjct  167  IMGMDTIDYPFSKQPEEF  184



>ref|XP_012083189.1| PREDICTED: uncharacterized protein LOC105642829 isoform X2 [Jatropha 
curcas]
Length=475

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEARA WQR ANRCFVQEDAKRAPKLACC  +S S++++D G   AA+  D     F
Sbjct  1    MAVAEARAVWQRVANRCFVQEDAKRAPKLACCQSSSSSSRQIDGGSTDAADMTDNPGVGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLSE  507
            +P + N SYSNL P++RWWL L+PNYGYQ GL  E L +++ EM+   +   +STSK+ E
Sbjct  61   MPLHRNPSYSNLPPDTRWWLQLQPNYGYQKGLTYEQLNALEAEMESLRAEIADSTSKIGE  120



>ref|XP_012083184.1| PREDICTED: uncharacterized protein LOC105642829 isoform X1 [Jatropha 
curcas]
 ref|XP_012083185.1| PREDICTED: uncharacterized protein LOC105642829 isoform X1 [Jatropha 
curcas]
 ref|XP_012083186.1| PREDICTED: uncharacterized protein LOC105642829 isoform X1 [Jatropha 
curcas]
 ref|XP_012083187.1| PREDICTED: uncharacterized protein LOC105642829 isoform X1 [Jatropha 
curcas]
 ref|XP_012083188.1| PREDICTED: uncharacterized protein LOC105642829 isoform X1 [Jatropha 
curcas]
 gb|KDP28470.1| hypothetical protein JCGZ_14241 [Jatropha curcas]
Length=480

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEARA WQR ANRCFVQEDAKRAPKLACC  +S S++++D G   AA+  D     F
Sbjct  1    MAVAEARAVWQRVANRCFVQEDAKRAPKLACCQSSSSSSRQIDGGSTDAADMTDNPGVGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLSE  507
            +P + N SYSNL P++RWWL L+PNYGYQ GL  E L +++ EM+   +   +STSK+ E
Sbjct  61   MPLHRNPSYSNLPPDTRWWLQLQPNYGYQKGLTYEQLNALEAEMESLRAEIADSTSKIGE  120



>ref|XP_010661958.1| PREDICTED: uncharacterized protein LOC100260339 isoform X1 [Vitis 
vinifera]
 ref|XP_010661959.1| PREDICTED: uncharacterized protein LOC100260339 isoform X1 [Vitis 
vinifera]
 ref|XP_010661960.1| PREDICTED: uncharacterized protein LOC100260339 isoform X1 [Vitis 
vinifera]
Length=479

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 113/206 (55%), Gaps = 14/206 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACCP +S S+K+ D G A+AA+  D     F
Sbjct  1    MAAAEARAVWQRAANRCFVQEDAKRAPKLACCPSSSSSSKQADAGHANAADGPDHPPVGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
            +P N  +SYSNL P++RWWL L+PNYGYQ GL  E L ++ E +       + SK SE +
Sbjct  61   MPLN-RTSYSNLPPDTRWWLQLQPNYGYQKGLTSEQLNAL-EAEVEMLIDGTASKTSELD  118

Query  514  IEY---------VDEFTVDKSLLD-SQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRL  663
              Y         VD     +S  D   +  +  V+ D   G ++++     ++ D  L +
Sbjct  119  GAYAQNEDGSGRVDGGKNTESFFDVDNINFAGCVEKDPDFGKQEVNALDSKNAQD--LEV  176

Query  664  ESIKNPTGFRMTESFDCPVSKPASEL  741
             ++        TE      SK  SEL
Sbjct  177  NNMWKYYELVETEPIGSSASKQPSEL  202



>ref|XP_002265230.1| PREDICTED: uncharacterized protein LOC100260339 isoform X2 [Vitis 
vinifera]
Length=478

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 113/206 (55%), Gaps = 14/206 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACCP +S S+K+ D G A+AA+  D     F
Sbjct  1    MAAAEARAVWQRAANRCFVQEDAKRAPKLACCPSSSSSSKQADAGHANAADGPDHPPVGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
            +P N  +SYSNL P++RWWL L+PNYGYQ GL  E L ++ E +       + SK SE +
Sbjct  61   MPLN-RTSYSNLPPDTRWWLQLQPNYGYQKGLTSEQLNAL-EAEVEMLIDGTASKTSELD  118

Query  514  IEY---------VDEFTVDKSLLD-SQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRL  663
              Y         VD     +S  D   +  +  V+ D   G ++++     ++ D  L +
Sbjct  119  GAYAQNEDGSGRVDGGKNTESFFDVDNINFAGCVEKDPDFGKQEVNALDSKNAQD--LEV  176

Query  664  ESIKNPTGFRMTESFDCPVSKPASEL  741
             ++        TE      SK  SEL
Sbjct  177  NNMWKYYELVETEPIGSSASKQPSEL  202



>ref|XP_006491300.1| PREDICTED: uncharacterized protein LOC102628391 isoform X1 [Citrus 
sinensis]
 ref|XP_006491301.1| PREDICTED: uncharacterized protein LOC102628391 isoform X2 [Citrus 
sinensis]
Length=475

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 114/204 (56%), Gaps = 9/204 (4%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S S+K+VD GPA  A+  D   A F
Sbjct  1    MAGAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSSSSKQVDAGPAGVADAPDHPAAGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLS-  504
            +P N N  YS L  ++RWWL L+PNYG Q GL  E + +V+ EM+   + F NS SK S 
Sbjct  61   MPLNMNHLYSELPSDTRWWLQLQPNYGCQKGLTSEQISAVEAEMEALRACFVNSPSKFSG  120

Query  505  EYEIEYVDEFTVDKSLLDSQV------KMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLE  666
            +  ++      VD S+ +         ++SA  +N      K+   A    +  + + L 
Sbjct  121  DPSLDSTGGTLVDGSINNDVSHDELYNRVSAVCRNKDPEVRKQNVEAVDCKTTQEFIELM  180

Query  667  SIKNPTGFRMTESFDCPVSKPASE  738
             I+    F   +S  CP SK + E
Sbjct  181  DIRENYEFIEMDSVGCPSSKTSKE  204



>emb|CBI40568.3| unnamed protein product [Vitis vinifera]
Length=419

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACCP +S S+K+ D G A+AA+  D     F
Sbjct  1    MAAAEARAVWQRAANRCFVQEDAKRAPKLACCPSSSSSSKQADAGHANAADGPDHPPVGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
            +P N  +SYSNL P++RWWL L+PNYGYQ GL  E L ++ E +       + SK SE +
Sbjct  61   MPLN-RTSYSNLPPDTRWWLQLQPNYGYQKGLTSEQLNAL-EAEVEMLIDGTASKTSELD  118

Query  514  IEYV  525
              Y 
Sbjct  119  GAYA  122



>gb|KDO86508.1| hypothetical protein CISIN_1g011727mg [Citrus sinensis]
 gb|KDO86509.1| hypothetical protein CISIN_1g011727mg [Citrus sinensis]
Length=475

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 114/204 (56%), Gaps = 9/204 (4%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S S+K+VD GPA  A+  D   A F
Sbjct  1    MAGAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSSSSKQVDAGPAGVADAPDHPAAGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLS-  504
            +P N N  YS L  ++RWWL L+PNYG Q GL  E + +V+ EM+   + F NS SK S 
Sbjct  61   MPLNMNHLYSELPSDTRWWLQLQPNYGCQKGLTSEQISAVEAEMEALRAGFVNSPSKFSG  120

Query  505  EYEIEYVDEFTVDKSLLDSQV------KMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLE  666
            +  ++      VD S+ +         ++SA  +N      K+   A    +  + + L 
Sbjct  121  DPSLDSTGGTLVDGSINNDVSHDELYNRVSAVCRNKDPEVRKQNVEAVDCKTTQEFIELM  180

Query  667  SIKNPTGFRMTESFDCPVSKPASE  738
             I+    F   +S  CP SK + E
Sbjct  181  DIRENYEFIEMDSVGCPSSKTSKE  204



>ref|XP_006444816.1| hypothetical protein CICLE_v10019982mg [Citrus clementina]
 ref|XP_006444817.1| hypothetical protein CICLE_v10019982mg [Citrus clementina]
 ref|XP_006444818.1| hypothetical protein CICLE_v10019982mg [Citrus clementina]
 gb|ESR58056.1| hypothetical protein CICLE_v10019982mg [Citrus clementina]
 gb|ESR58057.1| hypothetical protein CICLE_v10019982mg [Citrus clementina]
 gb|ESR58058.1| hypothetical protein CICLE_v10019982mg [Citrus clementina]
Length=475

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 114/204 (56%), Gaps = 9/204 (4%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S S+K+VD GPA  A+  D   A F
Sbjct  1    MAGAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSSSSKQVDAGPAGVADAPDHPAAGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLS-  504
            +P N N  YS L  ++RWWL L+PNYG Q GL  E + +V+ EM+   + F NS SK S 
Sbjct  61   MPLNMNHLYSELPSDTRWWLQLQPNYGCQKGLTSEQISAVEAEMEALRAGFVNSPSKFSG  120

Query  505  EYEIEYVDEFTVDKSLLDSQV------KMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLE  666
            +  ++      VD S+ +         ++SA  +N      K+   A    +  + + L 
Sbjct  121  DPSLDSTGGTLVDGSINNDVSHDELYNRVSAVCRNKDPEVRKQNVEAVDCKTTQEFIELM  180

Query  667  SIKNPTGFRMTESFDCPVSKPASE  738
             I+    F   +S  CP SK + E
Sbjct  181  DIRENYEFIEMDSVGCPSSKTSKE  204



>ref|XP_004306652.1| PREDICTED: uncharacterized protein LOC101307620 [Fragaria vesca 
subsp. vesca]
Length=442

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 95/164 (58%), Gaps = 14/164 (9%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLA C  +S + K+VD GPA+A    D   A F
Sbjct  1    MAGAEARAVWQRTANRCFVQEDAKRAPKLAYCQSSSSTTKQVDAGPATATEGLDHPGAAF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P + N SYSNL  ++RWWL ++PN+GYQ  L  E L  L  D     + F   TSK SE
Sbjct  61   MPISRNRSYSNLPADTRWWLQMQPNHGYQKDLTPEQLNALEADMETLRAGFVKPTSKNSE  120

Query  508  YEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSD  639
             + ++  EFT               VK    +  K +D A+G +
Sbjct  121  ID-QHKGEFTD-----------GDCVKTGYEVQKKDVDAAYGEN  152



>ref|XP_008233124.1| PREDICTED: uncharacterized protein LOC103332188 [Prunus mume]
Length=451

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 108/198 (55%), Gaps = 16/198 (8%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S + K+VD GPA+AA   D   A F
Sbjct  1    MAAAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSSTTKQVDAGPATAAEGPDHPAAGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P N N SYS+L  ++RWWL ++P+YGYQ     E L  L  D     + F  ST K SE
Sbjct  61   MPLNRNPSYSSLPLDARWWLQMQPSYGYQKDFTYEQLNALEADMETLRAGFVKSTPKTSE  120

Query  508  YEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNPTG  687
               +   E T      +S+V+     K D       ++  +G D + + ++ + I+    
Sbjct  121  VR-QQKGECTDADGRKNSKVQ-----KQD-------VNAQYGKD-MKELVQYKDIREKYE  166

Query  688  FRMTESFDCPVSKPASEL  741
                ++ D P SK   E 
Sbjct  167  IMGLDTIDYPFSKQPEEF  184



>ref|XP_002523322.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39038.1| conserved hypothetical protein [Ricinus communis]
Length=481

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MAVAEARAAWQRTANRCFVQEDAKRAPKLACC  +S S+K+VD GP +AA   +     F
Sbjct  1    MAVAEARAAWQRTANRCFVQEDAKRAPKLACCQSSSSSSKQVDGGPTNAAEMPENSAVGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL  444
            +P + N+SYS+L P++RWWL L+P+YGYQ G   E L
Sbjct  61   MPFHRNASYSSLPPDTRWWLQLQPSYGYQKGFTYEQL  97



>gb|KHN35389.1| hypothetical protein glysoja_029019 [Glycine soja]
Length=426

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +  ++K VDTGPAS A+  D      
Sbjct  1    MAGAEARALWQRTANRCFVQEDAKRAPKLACCQSSCATSKSVDTGPASTADESDHNTVNV  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
               N  SS SNLS + RWWLH +PNYGYQ GL  E L ++++ +  +   +  SK SE  
Sbjct  61   THFNRKSSISNLSSDCRWWLHSQPNYGYQKGLTYEQLNALED-EVETLLASDLSKNSEEF  119

Query  514  IEYVD  528
             E +D
Sbjct  120  HELMD  124



>ref|XP_007147328.1| hypothetical protein PHAVU_006G114600g [Phaseolus vulgaris]
 gb|ESW19322.1| hypothetical protein PHAVU_006G114600g [Phaseolus vulgaris]
Length=401

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +  ++K VDT PAS ++  D      
Sbjct  1    MAGAEARALWQRTANRCFVQEDAKRAPKLACCQSSCATSKLVDTEPASPSDESDHTAVNV  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
            +  N  SS SNLSP+ RWWLHL+PNYGYQ G   E L  ++E   + T  + +    E++
Sbjct  61   IHFNRKSSVSNLSPDCRWWLHLQPNYGYQKGSTYEQLNILEEEVETLTASDVSKNSQEFQ  120



>ref|XP_009375414.1| PREDICTED: uncharacterized protein LOC103964229 [Pyrus x bretschneideri]
 ref|XP_009375415.1| PREDICTED: uncharacterized protein LOC103964229 [Pyrus x bretschneideri]
Length=449

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 110/198 (56%), Gaps = 14/198 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S + ++VD GPA+ A   D   A F
Sbjct  1    MAAAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSSTTRQVDAGPATGAEGPDHPAAGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P N N  YS+  P++RWW  L+P+YGYQ     E L  L  D     + F  ST+  SE
Sbjct  61   MPINRN-PYSSRPPDTRWW--LQPSYGYQRDFTYEQLNALEADMETLRAGFVISTTNTSE  117

Query  508  YEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNPTG  687
               +   EFT      D+    +  +K D  +  + ++  +  +++ + L+ E +K    
Sbjct  118  VHQQKA-EFT------DADSISTVCMKTDYEVQKQDVNAKY-CENMQELLQYE-MKEKCE  168

Query  688  FRMTESFDCPVSKPASEL  741
              + ++ DCPVSK   E 
Sbjct  169  IMVMDTIDCPVSKKPKEF  186



>ref|XP_011038435.1| PREDICTED: uncharacterized protein LOC105135311 [Populus euphratica]
Length=480

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +S S+K++D GP SA +  D     F
Sbjct  1    MAAAEARAVWQRTANRCFVQEDAKRAPKLACCQSSSSSSKQLDGGPTSAQDMPDQSSGGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
            +P     SYS+L P++RWWL L+P+YGYQ     E L +++
Sbjct  61   MPLRRYPSYSSLPPDTRWWLQLQPSYGYQKCFTLEQLNALE  101



>ref|XP_002320873.1| hypothetical protein POPTR_0014s09580g [Populus trichocarpa]
 gb|EEE99188.1| hypothetical protein POPTR_0014s09580g [Populus trichocarpa]
Length=358

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +S S+K++D GP SAA+  D     F
Sbjct  1    MAAAEARAVWQRTANRCFVQEDAKRAPKLACCQSSSSSSKQLDGGPTSAADMPDQSSGGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGL  429
            +P     SYS+L P++RWWL L+P+YGYQ  L
Sbjct  61   MPLRRYPSYSSLPPDTRWWLQLQPSYGYQKFL  92



>ref|XP_010544849.1| PREDICTED: uncharacterized protein LOC104817374 [Tarenaya hassleriana]
 ref|XP_010544850.1| PREDICTED: uncharacterized protein LOC104817374 [Tarenaya hassleriana]
Length=439

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPP-TSPSAKEVDTGPASAA--NPQDAER  324
            MA AEARA WQR  NRCFVQEDAKRAPKLACC P +S SAK+VD+G  SA   +P+D   
Sbjct  1    MAAAEARAVWQRAVNRCFVQEDAKRAPKLACCQPSSSASAKQVDSGSGSAGVPDPRDQSS  60

Query  325  ACFLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGL  429
            ACF+P N N  + +LS ++RWW  +KP YG Q  L
Sbjct  61   ACFMPLNRNHRFPDLSSDTRWWAQMKPGYGNQNEL  95



>ref|XP_008352337.1| PREDICTED: uncharacterized protein LOC103415805 [Malus domestica]
 ref|XP_008352401.1| PREDICTED: uncharacterized protein LOC103415805 [Malus domestica]
Length=449

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 104/198 (53%), Gaps = 14/198 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQR ANRCFVQEDAKRAPKLACC  +S + ++VD GPA  A   D   A F
Sbjct  1    MAAAEARAVWQRAANRCFVQEDAKRAPKLACCQSSSSTTRQVDAGPAIGAEGPDHPAAGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P N N  YS+  P +RWW  L+P++G+Q     E L  L  D     + F  ST   SE
Sbjct  61   MPVNRN-PYSSRPPGTRWW--LQPSHGHQKDFTYEQLNALEADMETLRAGFVKSTPNTSE  117

Query  508  YEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNPTG  687
               +   EFT      D+    +   K    +  + + T +  +++ + L+ E +K    
Sbjct  118  VH-QXKAEFT------DADSISAVCTKTGYEVQKQDVSTKY-CENMQELLQYE-MKGKCE  168

Query  688  FRMTESFDCPVSKPASEL  741
                ++ DCPVSK   E 
Sbjct  169  IMGMDTIDCPVSKKPKEF  186



>gb|KJB09632.1| hypothetical protein B456_001G153700 [Gossypium raimondii]
 gb|KJB09633.1| hypothetical protein B456_001G153700 [Gossypium raimondii]
 gb|KJB09634.1| hypothetical protein B456_001G153700 [Gossypium raimondii]
Length=425

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +S   K+ D+ P   A+ +D      
Sbjct  1    MAAAEARAVWQRTANRCFVQEDAKRAPKLACC-QSSSHCKQADSSPTGVADARDHPAVDL  59

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDE  459
               N N SYSNL P+ RWWL L+P+YG Q GL  E L ++++
Sbjct  60   NALNRNPSYSNLPPDMRWWLQLQPSYGPQKGLKNEQLYALED  101



>gb|KJB41570.1| hypothetical protein B456_007G109800 [Gossypium raimondii]
 gb|KJB41571.1| hypothetical protein B456_007G109800 [Gossypium raimondii]
Length=436

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARAAWQRTANRCFVQEDAKRAPKLACC  +S S K+ D+ P+  A+  +     F
Sbjct  1    MAAAEARAAWQRTANRCFVQEDAKRAPKLACCQSSS-STKQADSNPSGVADKHNHPAIGF  59

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSV-DEMQGSSTFGNSTSKLSEY  510
            +P N N SYSNL P++RWWL L+PNYG Q GL  E L ++ DE++      NS+   S+ 
Sbjct  60   MPLNRNPSYSNLPPDTRWWLQLQPNYGPQMGLTNEQLNALEDEVESLKAEINSSKVSSDL  119

Query  511  EIEYVDEFTVDK  546
            + +  D    D+
Sbjct  120  QQDAHDSSITDR  131



>ref|NP_001062992.1| Os09g0363500 [Oryza sativa Japonica Group]
 dbj|BAD23412.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD33713.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24906.1| Os09g0363500 [Oryza sativa Japonica Group]
 gb|EAZ44460.1| hypothetical protein OsJ_29074 [Oryza sativa Japonica Group]
 dbj|BAG89462.1| unnamed protein product [Oryza sativa Japonica Group]
Length=463

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AE RAAWQR ANRC VQEDAKRAPKL CCP   PS ++ +T   +  NPQD     F
Sbjct  1    MAAAETRAAWQRAANRCRVQEDAKRAPKLGCCP---PSGQQHETNNGNQTNPQDCHIPNF  57

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL  444
            +P NWN+  SNL  +++WWL L+PN+G Q  LA E L
Sbjct  58   MPLNWNAMNSNLPKDTQWWLQLQPNFGCQNVLASEDL  94



>gb|EAZ08801.1| hypothetical protein OsI_31062 [Oryza sativa Indica Group]
Length=463

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AE RAAWQR ANRC VQEDAKRAPKL CCP   PS ++ +T   +  NPQD     F
Sbjct  1    MAAAETRAAWQRAANRCRVQEDAKRAPKLGCCP---PSGQQHETNNGNQTNPQDCHIPNF  57

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL  444
            +P NWN+  SNL  +++WWL L+PN+G Q  LA E L
Sbjct  58   MPLNWNAMNSNLPKDTQWWLQLQPNFGCQNVLASEDL  94



>gb|EYU38879.1| hypothetical protein MIMGU_mgv1a007152mg [Erythranthe guttata]
Length=417

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 70/100 (70%), Gaps = 7/100 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLA---CCPPTSPSAKEVDTGPASAANPQDA--  318
            MA+AEARAAWQRT NRC VQEDAKRAPKLA     PP  P +K  DTGP ++ +PQD   
Sbjct  1    MALAEARAAWQRTGNRCLVQEDAKRAPKLAYSSSLPP--PCSKPSDTGPTTSPSPQDIPP  58

Query  319  ERACFLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGE  438
              A   P + NSSYSNLSPNSRWWLHL+PNY  Q G   E
Sbjct  59   PSASSNPFDRNSSYSNLSPNSRWWLHLQPNYPCQKGFTDE  98



>gb|KEH24691.1| transmembrane protein, putative [Medicago truncatula]
Length=426

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AE R  WQRTANRCFVQEDAKRAPKLAC   ++ ++K+VD GPA+ A+  D      
Sbjct  1    MAAAEVRTLWQRTANRCFVQEDAKRAPKLACRQSSNATSKQVDAGPANTADESDCTAVNA  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDE  459
               N  SS+ + S + RWWLH +PNYGYQ G+  E L +++E
Sbjct  61   THFNSKSSFCHPSSDPRWWLHSQPNYGYQKGVTNEKLSALEE  102



>ref|XP_010267568.1| PREDICTED: uncharacterized protein LOC104604754 [Nelumbo nucifera]
 ref|XP_010267569.1| PREDICTED: uncharacterized protein LOC104604754 [Nelumbo nucifera]
Length=495

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 74/119 (62%), Gaps = 9/119 (8%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARAAWQRTANRCFVQEDAKRAPKLACCP  S S  +VD G     +  D     F
Sbjct  1    MAAAEARAAWQRTANRCFVQEDAKRAPKLACCPSASSSKPQVDVGAGDLPHGPDHPITGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL---------LSVDEMQGSSTFG  483
            +P NWN S SNL P+++WWL L+PN+GYQ     E L         L  +E+  +S  G
Sbjct  61   MPLNWNPSNSNLPPDTKWWLQLQPNFGYQKDFTYEQLNDSEAELEVLRAEEINQASILG  119



>ref|XP_006852588.1| PREDICTED: uncharacterized protein LOC18442303 [Amborella trichopoda]
 ref|XP_011626293.1| PREDICTED: uncharacterized protein LOC18442303 [Amborella trichopoda]
 ref|XP_011626294.1| PREDICTED: uncharacterized protein LOC18442303 [Amborella trichopoda]
 gb|ERN14055.1| hypothetical protein AMTR_s00021p00215510 [Amborella trichopoda]
Length=473

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 65/101 (64%), Gaps = 0/101 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANR FVQEDAKRAPKLACCP  S S  + +TG     N  D   A  
Sbjct  1    MATAEARAVWQRTANRYFVQEDAKRAPKLACCPSPSCSKTQSETGHGDHGNGPDHSSAIP  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
            +P NWN +  NLSP S+WWL L+PN+G       E + +++
Sbjct  61   VPLNWNPTNMNLSPESKWWLQLQPNFGNHKDFTYEQIKALE  101



>ref|XP_006660568.1| PREDICTED: uncharacterized protein LOC102720628 [Oryza brachyantha]
Length=456

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AE RAAWQR ANRC VQEDAKRAPKL CC P++    E++ GP    NPQD     F
Sbjct  1    MAAAETRAAWQRAANRCLVQEDAKRAPKLGCCLPSA-QQNEMNNGP---TNPQDCHIPNF  56

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL  444
            +P NWN+  SNL  +++WWL L+PN+G Q  LA E L
Sbjct  57   MPLNWNAMNSNLPKDTQWWLQLQPNFGCQNLLASEDL  93



>gb|KHG18669.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=436

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 109/190 (57%), Gaps = 29/190 (15%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARAAWQRTANRCFVQEDAKRAPKLACC  +S S K+ D+ P+  A+  +     F
Sbjct  1    MAAAEARAAWQRTANRCFVQEDAKRAPKLACC-QSSSSTKQADSNPSGVADKHNHPAIGF  59

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYE  513
            +P N   SYSNL P++RWWL L+PNYG Q  L  E L ++++                 E
Sbjct  60   MPLNRTPSYSNLPPDTRWWLQLQPNYGPQMSLTNEQLNALED-----------------E  102

Query  514  IEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNPTGFR  693
            +E + +  ++ S + S ++  A   +D+ I D+K + ++   SLD    +ES +    F 
Sbjct  103  VESL-KAEINSSKVSSDLQQDA---HDISITDRKKNNSY---SLDSKETMESFE----FL  151

Query  694  MTESFDCPVS  723
              ES +C  S
Sbjct  152  EMESVECRAS  161



>gb|KHN15921.1| hypothetical protein glysoja_013137 [Glycine soja]
Length=445

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AE RAAWQR  NRCFVQEDAKRAPKLACC  +  ++K  D G ASAA+  D   A  
Sbjct  1    MATAEVRAAWQRAVNRCFVQEDAKRAPKLACCQSSCATSKLFDAGAASAADEYDHAAASV  60

Query  334  LPSNWNSSYSNLSPNSRWW-LHLKPNYGYQGGLAGEHLLSVDE  459
               N  SS+SN+ P+SRWW L L+ NY +Q GL  E L ++++
Sbjct  61   THFNQKSSFSNVIPDSRWWLLQLQANYEFQKGLTYEQLNALED  103



>ref|XP_010055001.1| PREDICTED: uncharacterized protein LOC104443352 isoform X2 [Eucalyptus 
grandis]
 gb|KCW71487.1| hypothetical protein EUGRSUZ_E00042 [Eucalyptus grandis]
Length=465

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANR FVQEDAKRAPKLACC  +S ++K+VD GPA +    D     F
Sbjct  1    MAAAEARAVWQRTANRYFVQEDAKRAPKLACCQSSSSTSKQVDAGPAGSTEEGDRFGLGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
            +P N   S++NL P +RWWL  +P+  +  GLA E L ++D
Sbjct  61   MPFNRKPSFTNLPPEARWWLQQQPSSRFPRGLACEGLNALD  101



>ref|XP_010054998.1| PREDICTED: uncharacterized protein LOC104443352 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010054999.1| PREDICTED: uncharacterized protein LOC104443352 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010055000.1| PREDICTED: uncharacterized protein LOC104443352 isoform X1 [Eucalyptus 
grandis]
 gb|KCW71484.1| hypothetical protein EUGRSUZ_E00042 [Eucalyptus grandis]
 gb|KCW71485.1| hypothetical protein EUGRSUZ_E00042 [Eucalyptus grandis]
 gb|KCW71486.1| hypothetical protein EUGRSUZ_E00042 [Eucalyptus grandis]
Length=468

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANR FVQEDAKRAPKLACC  +S ++K+VD GPA +    D     F
Sbjct  1    MAAAEARAVWQRTANRYFVQEDAKRAPKLACCQSSSSTSKQVDAGPAGSTEEGDRFGLGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
            +P N   S++NL P +RWWL  +P+  +  GLA E L ++D
Sbjct  61   MPFNRKPSFTNLPPEARWWLQQQPSSRFPRGLACEGLNALD  101



>gb|KHG01749.1| hypothetical protein F383_21898 [Gossypium arboreum]
Length=432

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +S   K+ D+ P   A+ +D      
Sbjct  1    MAAAEARAVWQRTANRCFVQEDAKRAPKLACC-QSSSHCKQADSSPTGVADARDHPAVDL  59

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDE  459
               N N SYSNL  + RWWL L+P+YG Q GL  E L ++++
Sbjct  60   NALNRNPSYSNLPLDMRWWLQLQPSYGPQKGLTNEQLYALED  101



>ref|XP_009395815.1| PREDICTED: uncharacterized protein LOC103980983 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 67/104 (64%), Gaps = 4/104 (4%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEAR AWQRT NRC VQEDAKRAPKLACCP ++P   + D+   +AA+  D   A F
Sbjct  1    MAAAEARHAWQRTLNRCLVQEDAKRAPKLACCPSSTP---QTDSSNGNAASTHDCPVANF  57

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL-LSVDEM  462
            +P N N    NLSP ++WWL ++PNY Y      E L  S DE+
Sbjct  58   IPLNRNQMNPNLSPETKWWLQIQPNYVYHKDFICEQLCFSRDEV  101



>ref|XP_010266583.1| PREDICTED: uncharacterized protein LOC104604051 isoform X3 [Nelumbo 
nucifera]
Length=481

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAK-EVDTGPASAANPQDAERAC  330
            MA AE RAAWQR ANRCFVQEDAKRAPKLACCP +  S+K +VD G     N  D   A 
Sbjct  1    MAAAEVRAAWQRAANRCFVQEDAKRAPKLACCPSSPSSSKPQVDIGAGDLPNGPDHSIAG  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
            F+P NWN S SNL P+S+WWL L+PN+GYQ     E L +++
Sbjct  61   FIPLNWNISNSNLPPDSKWWLQLQPNFGYQKDFTCEQLNALE  102



>ref|XP_010266582.1| PREDICTED: uncharacterized protein LOC104604051 isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAK-EVDTGPASAANPQDAERAC  330
            MA AE RAAWQR ANRCFVQEDAKRAPKLACCP +  S+K +VD G     N  D   A 
Sbjct  1    MAAAEVRAAWQRAANRCFVQEDAKRAPKLACCPSSPSSSKPQVDIGAGDLPNGPDHSIAG  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
            F+P NWN S SNL P+S+WWL L+PN+GYQ     E L +++
Sbjct  61   FIPLNWNISNSNLPPDSKWWLQLQPNFGYQKDFTCEQLNALE  102



>ref|XP_010266580.1| PREDICTED: uncharacterized protein LOC104604051 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010266581.1| PREDICTED: uncharacterized protein LOC104604051 isoform X1 [Nelumbo 
nucifera]
Length=485

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAK-EVDTGPASAANPQDAERAC  330
            MA AE RAAWQR ANRCFVQEDAKRAPKLACCP +  S+K +VD G     N  D   A 
Sbjct  1    MAAAEVRAAWQRAANRCFVQEDAKRAPKLACCPSSPSSSKPQVDIGAGDLPNGPDHSIAG  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
            F+P NWN S SNL P+S+WWL L+PN+GYQ     E L +++
Sbjct  61   FIPLNWNISNSNLPPDSKWWLQLQPNFGYQKDFTCEQLNALE  102



>ref|XP_010053838.1| PREDICTED: uncharacterized protein LOC104442186 isoform X2 [Eucalyptus 
grandis]
 gb|KCW78195.1| hypothetical protein EUGRSUZ_D02384 [Eucalyptus grandis]
Length=416

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRT NR FVQEDAKRAPKLACC  +S ++K+VD GP + A+  D     F
Sbjct  1    MAAAEARAVWQRTINRYFVQEDAKRAPKLACCQSSSLTSKQVDAGPTNTADEGDQPDIGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQ  420
            LPSN    +S+L  ++RWWLHL+P  G+Q
Sbjct  61   LPSNGKPLFSDLCDDTRWWLHLQPIRGFQ  89



>ref|XP_010053834.1| PREDICTED: uncharacterized protein LOC104442186 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010053835.1| PREDICTED: uncharacterized protein LOC104442186 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010053836.1| PREDICTED: uncharacterized protein LOC104442186 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010053837.1| PREDICTED: uncharacterized protein LOC104442186 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78196.1| hypothetical protein EUGRSUZ_D02384 [Eucalyptus grandis]
Length=417

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRT NR FVQEDAKRAPKLACC  +S ++K+VD GP + A+  D     F
Sbjct  1    MAAAEARAVWQRTINRYFVQEDAKRAPKLACCQSSSLTSKQVDAGPTNTADEGDQPDIGF  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQ  420
            LPSN    +S+L  ++RWWLHL+P  G+Q
Sbjct  61   LPSNGKPLFSDLCDDTRWWLHLQPIRGFQ  89



>ref|XP_009410810.1| PREDICTED: uncharacterized protein LOC103992723 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410812.1| PREDICTED: uncharacterized protein LOC103992723 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410813.1| PREDICTED: uncharacterized protein LOC103992723 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410814.1| PREDICTED: uncharacterized protein LOC103992723 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410815.1| PREDICTED: uncharacterized protein LOC103992723 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410816.1| PREDICTED: uncharacterized protein LOC103992723 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410817.1| PREDICTED: uncharacterized protein LOC103992723 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410818.1| PREDICTED: uncharacterized protein LOC103992723 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 89/150 (59%), Gaps = 10/150 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARAAWQRTANRC VQEDAKRAPKLACCP ++P   + D G  + A  QD      
Sbjct  1    MAAAEARAAWQRTANRCLVQEDAKRAPKLACCPSSTP---QNDLGNGNTAIAQDNSVPNL  57

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLS----VDEMQGSSTFGNSTSKL  501
            +P N NS  +NLSP ++WWL L+PN+GYQ     E L S    VDE    +    S   L
Sbjct  58   MPLNRNSMNANLSPETKWWLQLQPNFGYQKDFIFEQLSSLEDEVDEKDTETMVPTSKLDL  117

Query  502  SEYEIEYVDEFTVDK--SLLDSQVKMSASV  585
                I++ + F + K  S+L+    +S++V
Sbjct  118  ESLPIDF-NNFALKKEESILEPPSMVSSTV  146



>ref|XP_011650672.1| PREDICTED: uncharacterized protein LOC101208119 [Cucumis sativus]
 ref|XP_011650673.1| PREDICTED: uncharacterized protein LOC101208119 [Cucumis sativus]
 gb|KGN56414.1| hypothetical protein Csa_3G119470 [Cucumis sativus]
Length=474

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 8/116 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPA-SAANPQDAERAC  330
            MA AEARAA+QRT NRCFVQEDAKRAP+LACC  +S ++K+VD+GPA +AA+  D     
Sbjct  1    MAAAEARAAFQRTVNRCFVQEDAKRAPRLACCQSSSSTSKQVDSGPANAAADGPDQPSTG  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSK  498
            F+PS+  SSYSNL P+S+WWL  + +YG+Q     EH+  ++        GN TSK
Sbjct  61   FMPSSRASSYSNLLPDSKWWLQTQSSYGFQKIFTLEHINPLEA-------GNETSK  109



>ref|XP_007051516.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX95673.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=396

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRTANRCFVQEDAKRAPKLACC  +S S+K+ D+ P  AA   D     F
Sbjct  1    MAAAEARAVWQRTANRCFVQEDAKRAPKLACC-QSSSSSKQADSSPNGAAGACDHPAVGF  59

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSV-DEMQGSSTFGNSTSKLSEY  510
            +P N + SYSNL P+ RWWL L+P+YG Q GL  E L ++ DE++       S SK+S  
Sbjct  60   MPLNRSPSYSNLPPDMRWWLQLQPSYGPQKGLTSEQLHALEDEVESLKAEIKSPSKVSGV  119

Query  511  EIE  519
             ++
Sbjct  120  HLQ  122



>ref|XP_008437876.1| PREDICTED: uncharacterized protein LOC103483175 isoform X2 [Cucumis 
melo]
Length=473

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 103/173 (60%), Gaps = 12/173 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPA-SAANPQDAERAC  330
            MA AEARAA+QRT NRCFVQEDAKRAP+LACC  +S ++K+VD+GPA +AA+  D     
Sbjct  1    MAAAEARAAFQRTVNRCFVQEDAKRAPRLACCQSSSSTSKQVDSGPANAAADGPDQPSIG  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLS--  504
            F+P +  SSYSNL P+S+WWL  +  YG+Q     EH+  ++    +S  G   S  S  
Sbjct  61   FMPFSRASSYSNLLPDSKWWLQTQSRYGFQKIFTLEHMNPLEAANETSKSGTEKSCTSSD  120

Query  505  ------EYEIEYVDEFTVDKSLLDSQVKMSA-SVKNDLGIGDKKLDTAFGSDS  642
                     +  VD+F+  +S LD+   +SA   K    I ++ + T  G+DS
Sbjct  121  IHRPEGSNSVCGVDDFS--RSSLDTDHGVSALCTKRVTRILNEDIKTLEGTDS  171



>ref|XP_008437874.1| PREDICTED: uncharacterized protein LOC103483175 isoform X1 [Cucumis 
melo]
 ref|XP_008437875.1| PREDICTED: uncharacterized protein LOC103483175 isoform X1 [Cucumis 
melo]
Length=478

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 103/173 (60%), Gaps = 12/173 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPA-SAANPQDAERAC  330
            MA AEARAA+QRT NRCFVQEDAKRAP+LACC  +S ++K+VD+GPA +AA+  D     
Sbjct  1    MAAAEARAAFQRTVNRCFVQEDAKRAPRLACCQSSSSTSKQVDSGPANAAADGPDQPSIG  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLS--  504
            F+P +  SSYSNL P+S+WWL  +  YG+Q     EH+  ++    +S  G   S  S  
Sbjct  61   FMPFSRASSYSNLLPDSKWWLQTQSRYGFQKIFTLEHMNPLEAANETSKSGTEKSCTSSD  120

Query  505  ------EYEIEYVDEFTVDKSLLDSQVKMSA-SVKNDLGIGDKKLDTAFGSDS  642
                     +  VD+F+  +S LD+   +SA   K    I ++ + T  G+DS
Sbjct  121  IHRPEGSNSVCGVDDFS--RSSLDTDHGVSALCTKRVTRILNEDIKTLEGTDS  171



>ref|XP_010523818.1| PREDICTED: uncharacterized protein LOC104802082 [Tarenaya hassleriana]
 ref|XP_010523819.1| PREDICTED: uncharacterized protein LOC104802082 [Tarenaya hassleriana]
Length=430

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 73/123 (59%), Gaps = 8/123 (7%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCP-PTSPSAKEVDTGPASAANP--QDAER  324
            MA AEAR  WQR  NRCFVQEDAKRAPKLACC   +S S K+ D+  ++   P   D   
Sbjct  1    MAAAEARTLWQRAVNRCFVQEDAKRAPKLACCQSSSSASTKQFDSSGSTGTAPDLHDQSS  60

Query  325  ACFLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEM-----QGSSTFGNS  489
            ACF+P N N  + +L P++RWW H++P Y  +  L  + +  ++       +GS+T   S
Sbjct  61   ACFMPLNRNPRFPDLPPDTRWWAHIQPGYPDRKDLVKDQMRPLEANADIPGEGSATVIRS  120

Query  490  TSK  498
             SK
Sbjct  121  PSK  123



>gb|EYU32264.1| hypothetical protein MIMGU_mgv1a008979mg [Erythranthe guttata]
Length=356

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 76/136 (56%), Gaps = 15/136 (11%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTS-PSAKEVDTGPASAANPQDAERAC  330
            MA+AEARAAWQRTANRC VQEDAKRAPKLA C     P   E+ T  +SA    D +   
Sbjct  1    MALAEARAAWQRTANRCLVQEDAKRAPKLAYCSSIKHPDYIEIATASSSA----DTQHIP  56

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKP---NYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKL  501
              P N NS Y NLSPNS+WWL  +    +  YQ G       S++  +   +  ++T   
Sbjct  57   NTPFNLNSPYPNLSPNSKWWLQQQQSNCSTSYQKG-------SMNRNEHFESMESNTEDK  109

Query  502  SEYEIEYVDEFTVDKS  549
             E E+  V +F V K+
Sbjct  110  FEVELLDVGDFGVSKN  125



>ref|XP_004956665.1| PREDICTED: uncharacterized protein LOC101784246 [Setaria italica]
Length=470

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C VQEDAKRAPKLACCP    S ++ D   A+  NPQD     F+P NWN   SNL  ++
Sbjct  17   CLVQEDAKRAPKLACCP---QSVQQHDMSGANPTNPQDPHIPNFMPINWNLMSSNLPTDT  73

Query  382  RWWLHLKPNYGYQGGLAGEHL  444
            +WWL L+PN+G Q  LA EHL
Sbjct  74   QWWLQLQPNFGCQMALAREHL  94



>ref|XP_008810689.1| PREDICTED: uncharacterized protein LOC103722046 [Phoenix dactylifera]
 ref|XP_008810690.1| PREDICTED: uncharacterized protein LOC103722046 [Phoenix dactylifera]
Length=478

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C VQEDAKRAPKLACCP  S SA + D+   +A N  D   + F+P NWN+  SNL P++
Sbjct  17   CLVQEDAKRAPKLACCP--SSSALQNDSSNGNATNSPDHSGSNFMPLNWNTMNSNLPPDT  74

Query  382  RWWLHLKPNYGYQ  420
            +WWLH++PN+GYQ
Sbjct  75   KWWLHMQPNFGYQ  87



>ref|XP_010924900.1| PREDICTED: uncharacterized protein LOC105047605 isoform X2 [Elaeis 
guineensis]
Length=348

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 87/150 (58%), Gaps = 12/150 (8%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C VQEDAKRAPKLACCP  S S  + D+   +A N QD     F+P NWN   SNL  ++
Sbjct  17   CLVQEDAKRAPKLACCP--SSSVLQNDSSNDNATNAQDHSAPYFMPLNWNPMNSNLPLDA  74

Query  382  RWWLHLKPNYGYQGGLAGEH--LL--SVDEMQGSSTFGNSTSKLSEYEI--EYVD-EFTV  540
            +WWL L+PN+G+Q G   E    L   +DEM+  +T    TSK +E  +  E +D +  V
Sbjct  75   KWWLQLQPNFGHQKGYVCEQPNFLEDELDEMRAETTV--PTSKFTEEPLLGESMDIDLKV  132

Query  541  DKSLLDSQVKMS-ASVKNDLGIGDKKLDTA  627
            ++  L+S   +S AS+++    G +++ T 
Sbjct  133  NECFLESPCMVSTASMRHYSESGVQEMKTV  162



>ref|XP_010924899.1| PREDICTED: uncharacterized protein LOC105047605 isoform X1 [Elaeis 
guineensis]
Length=490

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 87/150 (58%), Gaps = 12/150 (8%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C VQEDAKRAPKLACCP  S S  + D+   +A N QD     F+P NWN   SNL  ++
Sbjct  17   CLVQEDAKRAPKLACCP--SSSVLQNDSSNDNATNAQDHSAPYFMPLNWNPMNSNLPLDA  74

Query  382  RWWLHLKPNYGYQGGLAGEH--LL--SVDEMQGSSTFGNSTSKLSEYEI--EYVD-EFTV  540
            +WWL L+PN+G+Q G   E    L   +DEM+  +T    TSK +E  +  E +D +  V
Sbjct  75   KWWLQLQPNFGHQKGYVCEQPNFLEDELDEMRAETTV--PTSKFTEEPLLGESMDIDLKV  132

Query  541  DKSLLDSQVKMS-ASVKNDLGIGDKKLDTA  627
            ++  L+S   +S AS+++    G +++ T 
Sbjct  133  NECFLESPCMVSTASMRHYSESGVQEMKTV  162



>ref|XP_010912331.1| PREDICTED: uncharacterized protein LOC105038276 [Elaeis guineensis]
Length=481

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C VQEDAKRAPKLACCP  S SA + D+   +A N  D   + F+P NWN   SNL P++
Sbjct  17   CLVQEDAKRAPKLACCP--SSSALQNDSSNGNATNAPDNSGSNFVPLNWNPMNSNLPPDT  74

Query  382  RWWLHLKPNYGYQGGLAGEHLLSVDE  459
            +WWL L+PN+GYQ     E L  V++
Sbjct  75   KWWLQLQPNFGYQKEYMCEQLNFVED  100



>ref|XP_009394123.1| PREDICTED: uncharacterized protein LOC103979678 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394124.1| PREDICTED: uncharacterized protein LOC103979678 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394125.1| PREDICTED: uncharacterized protein LOC103979678 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARAAWQRTANR  VQEDAKRAPKLACC  ++P +   +   ASA   QD+    F
Sbjct  1    MAAAEARAAWQRTANRYLVQEDAKRAPKLACCSSSTPQSDSSNGNTASA---QDSPGPNF  57

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDE  459
            +P + N + + LSP ++WWL L+PN+GYQ  L  E L S+++
Sbjct  58   MPFSRNLTNAYLSPETKWWLQLQPNFGYQNELICEQLSSLED  99



>ref|NP_001061754.1| Os08g0400300 [Oryza sativa Japonica Group]
 dbj|BAC98668.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC99384.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23668.1| Os08g0400300 [Oryza sativa Japonica Group]
 gb|EAZ42655.1| hypothetical protein OsJ_27219 [Oryza sativa Japonica Group]
 dbj|BAG90502.1| unnamed protein product [Oryza sativa Japonica Group]
Length=481

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C VQED KRAPKLACCPP+S        G  +  N +D     F+P +WN   S+L P+ 
Sbjct  17   CIVQEDRKRAPKLACCPPSSEQQHVKSNG--NCRNSEDRPVPNFMPLSWNPMNSSLPPDI  74

Query  382  RWWLHLKPNYGYQGGLAGEHL  444
            RWWL L+PN G Q  LAGEHL
Sbjct  75   RWWLQLQPNLGGQKNLAGEHL  95



>gb|EAZ06915.1| hypothetical protein OsI_29154 [Oryza sativa Indica Group]
Length=481

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C VQED KRAPKLACCPP+S        G  +  N +D     F+P +WN   S+L P+ 
Sbjct  17   CIVQEDRKRAPKLACCPPSSEQQHVKSNG--NCRNSEDRPVPNFMPLSWNPMNSSLPPDI  74

Query  382  RWWLHLKPNYGYQGGLAGEHL  444
            RWWL L+PN G Q  LAGEHL
Sbjct  75   RWWLQLQPNLGGQKNLAGEHL  95



>ref|XP_002444305.1| hypothetical protein SORBIDRAFT_07g019910 [Sorghum bicolor]
 gb|EES13800.1| hypothetical protein SORBIDRAFT_07g019910 [Sorghum bicolor]
Length=479

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C VQED KRAPKLACCP   PSA++  T   +  N  D      +P  WN  +SNL P+ 
Sbjct  17   CLVQEDRKRAPKLACCP---PSAEQHGTNNGNCRNSADRPICSLVPLRWNPMHSNLPPDF  73

Query  382  RWWLHLKPNYGYQGGLAGEHLLSV  453
            RWW+  +PN+G Q  +  E L S+
Sbjct  74   RWWVQSQPNFGIQKDIVSERLRSL  97



>ref|XP_008667745.1| PREDICTED: uncharacterized protein LOC100278420 isoform X1 [Zea 
mays]
 tpg|DAA39958.1| TPA: hypothetical protein ZEAMMB73_839143 [Zea mays]
 tpg|DAA39959.1| TPA: hypothetical protein ZEAMMB73_839143 [Zea mays]
Length=466

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 51/86 (59%), Gaps = 5/86 (6%)
 Frame = +1

Query  190  TANRCFVQEDAKRAPKLACC-PPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSN  366
             ANRC VQEDAKRAP L CC PP  P     DT   +  +PQD     F+P NWN   S+
Sbjct  13   AANRCMVQEDAKRAPHLVCCSPPLQPH----DTSDGNPLSPQDLHVPTFVPINWNLMNSS  68

Query  367  LSPNSRWWLHLKPNYGYQGGLAGEHL  444
            L   ++WWL L+PN+G Q  LA E L
Sbjct  69   LPMETQWWLQLQPNFGCQAALARERL  94



>ref|NP_001145179.1| uncharacterized protein LOC100278420 [Zea mays]
 gb|ACG45644.1| hypothetical protein [Zea mays]
Length=468

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 51/86 (59%), Gaps = 5/86 (6%)
 Frame = +1

Query  190  TANRCFVQEDAKRAPKLACC-PPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSN  366
             ANRC VQEDAKRAP L CC PP  P     DT   +  +PQD     F+P NWN   S+
Sbjct  13   AANRCMVQEDAKRAPHLVCCSPPLQPH----DTSDGNPLSPQDLHVPTFVPINWNLMNSS  68

Query  367  LSPNSRWWLHLKPNYGYQGGLAGEHL  444
            L   ++WWL L+PN+G Q  LA E L
Sbjct  69   LPMETQWWLQLQPNFGCQAALARERL  94



>ref|XP_010506666.1| PREDICTED: uncharacterized protein LOC104783236 [Camelina sativa]
 ref|XP_010506667.1| PREDICTED: uncharacterized protein LOC104783236 [Camelina sativa]
Length=400

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 96/203 (47%), Gaps = 47/203 (23%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPP----TSPSAKEVD----TGPASAANP  309
            MA AEARA WQRT NRCFVQEDAKRAPK   C      T+PS K+V+    +   S+  P
Sbjct  1    MAAAEARAVWQRTVNRCFVQEDAKRAPKFTYCQSSSSSTAPSTKQVEDSGSSSRPSSLEP  60

Query  310  QDAERAC--FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFG  483
            Q  + +C  F+P + N ++ +L P             +  GL   H              
Sbjct  61   QHHQSSCAGFMPLHRNPNFPDLLP-------------HNTGLWSPH--------------  93

Query  484  NSTSKLSEYEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRL  663
                    +  + V++  +D + +++  ++    K +LG G+KK   ++ S+S  + + L
Sbjct  94   --------HPFQMVNKKPLDAAEVNNNNQVLPERKPELGGGEKKQGKSYNSESFQEFIEL  145

Query  664  ESIKNPTGFRMTESFDCPVSKPA  732
               +   G+   ES +  +++PA
Sbjct  146  METRESFGY--DESTEKKLNEPA  166



>ref|XP_010695879.1| PREDICTED: uncharacterized protein LOC104908232 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=462

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = +1

Query  205  FVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF--LPSNWNSSYSNLSPN  378
            FVQEDAKRAPKLACC  +S S+K VD GPA+ A   DA       +P N   SYSNL P+
Sbjct  18   FVQEDAKRAPKLACCQSSSSSSKVVDAGPANTA---DAPHRVVGRMPFNSIPSYSNLPPD  74

Query  379  SRWWLHLKPNYGYQGG  426
            ++WWL ++PN  +Q G
Sbjct  75   AKWWLQMQPNNDHQRG  90



>ref|XP_010695652.1| PREDICTED: uncharacterized protein LOC104908232 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010695702.1| PREDICTED: uncharacterized protein LOC104908232 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010695761.1| PREDICTED: uncharacterized protein LOC104908232 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010695824.1| PREDICTED: uncharacterized protein LOC104908232 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=464

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = +1

Query  205  FVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF--LPSNWNSSYSNLSPN  378
            FVQEDAKRAPKLACC  +S S+K VD GPA+ A   DA       +P N   SYSNL P+
Sbjct  18   FVQEDAKRAPKLACCQSSSSSSKVVDAGPANTA---DAPHRVVGRMPFNSIPSYSNLPPD  74

Query  379  SRWWLHLKPNYGYQGG  426
            ++WWL ++PN  +Q G
Sbjct  75   AKWWLQMQPNNDHQRG  90



>gb|EMS55815.1| hypothetical protein TRIUR3_07244 [Triticum urartu]
Length=376

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 55/111 (50%), Gaps = 13/111 (12%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C  QEDAKRAPKLACCPPT    +     P S   P+D     F+  NWN   SN  P  
Sbjct  17   CLFQEDAKRAPKLACCPPTMQQHEANSGNPTS---PRDCHIPNFMHLNWNPMNSN-QPID  72

Query  382  RWWLHLKPNYGYQGGLAGEHL---------LSVDEMQGSSTFGNSTSKLSE  507
             W+L L+PN+G    L+GEHL           VD     ST  +  +K SE
Sbjct  73   AWFLQLQPNFGCHKVLSGEHLNYMGGEANAKKVDSFSPVSTLDDINTKKSE  123



>ref|XP_003578029.1| PREDICTED: uncharacterized protein LOC100835776 [Brachypodium 
distachyon]
 ref|XP_010238100.1| PREDICTED: uncharacterized protein LOC100835776 [Brachypodium 
distachyon]
 ref|XP_010238101.1| PREDICTED: uncharacterized protein LOC100835776 [Brachypodium 
distachyon]
 ref|XP_010238102.1| PREDICTED: uncharacterized protein LOC100835776 [Brachypodium 
distachyon]
Length=466

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 61/121 (50%), Gaps = 23/121 (19%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPS------NWNSSYS  363
            C VQEDAKRAPKLACC P+S    E  +G  +  NPQD    C +P+      NWN   S
Sbjct  17   CLVQEDAKRAPKLACC-PSSVQQHEAKSG--NPTNPQD----CHIPNFMHLNLNWNPMNS  69

Query  364  NLSPNSRWWLHLKPNYGYQGGLAGEHL---------LSVDEMQGSSTFGNSTSKLSEYEI  516
            N  P   W+L  +P++G Q  +AGEHL           V+     ST  +   K SEY  
Sbjct  70   N-QPIDTWFLQFQPDFGCQKVIAGEHLNYMGGEVDSKKVESFSPVSTLEDINPKKSEYPF  128

Query  517  E  519
            E
Sbjct  129  E  129



>ref|XP_006397848.1| hypothetical protein EUTSA_v10001490mg [Eutrema salsugineum]
 gb|ESQ39301.1| hypothetical protein EUTSA_v10001490mg [Eutrema salsugineum]
Length=388

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 13/101 (13%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKLACCPP--TSPSAKEV-DTGPASAA--NPQD  315
            +MA AEARA WQRT NRCFVQEDAKRAPKL CC    ++ S K+V D+G   A    P  
Sbjct  1    MMAAAEARAVWQRTVNRCFVQEDAKRAPKLTCCQSSLSAASTKQVGDSGSTRALVDPPNQ  60

Query  316  AERACFLPSNWNSSYSNLSP-NSRWW-----LHLKPNYGYQ  420
            +  A F+P N N  + ++ P N+R W      H++PN+  Q
Sbjct  61   SSCAGFMPRNPN--FPDVLPHNARLWGHHHHHHIQPNHKEQ  99



>ref|XP_004973378.1| PREDICTED: uncharacterized protein LOC101780987 [Setaria italica]
Length=481

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +1

Query  190  TANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNL  369
             ANRC VQED KRAPKLAC P  S + ++  T   S  + +D   + F+P +WN   SNL
Sbjct  13   AANRCLVQEDRKRAPKLACYP--SSAEQQHGTNNGSCRHSEDHPISNFMPLSWNPMNSNL  70

Query  370  SPNSRWWLHLKPNYGYQGGLAGE  438
             P+ RWW+ L+P++G Q  LA E
Sbjct  71   PPDVRWWVQLQPSFGIQKDLASE  93



>gb|EMT30136.1| hypothetical protein F775_07795 [Aegilops tauschii]
Length=377

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 19/125 (15%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C  QEDAKRAPKLACCP   PS ++ +    +  +P+D     F+  NWN   SN  P  
Sbjct  17   CLFQEDAKRAPKLACCP---PSMQQHEANSGNPTSPRDCHIPNFMHLNWNPMNSN-QPID  72

Query  382  RWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEYEIEYVDEFTVDKSLLDS  561
             W+L L+PN+G    L+G+HL   + M G            E  ++ VD F+   +L D 
Sbjct  73   AWFLQLQPNFGCHKVLSGDHL---NYMGG------------EANVKKVDSFSPVSTLDDI  117

Query  562  QVKMS  576
              K S
Sbjct  118  NTKKS  122



>ref|XP_006659382.1| PREDICTED: uncharacterized protein LOC102700820 [Oryza brachyantha]
Length=477

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +1

Query  190  TANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNL  369
             ANRC VQED KRAPKLA CP +S      + G  +  N +D     F+P + N   SNL
Sbjct  13   AANRCLVQEDRKRAPKLAYCPSSSELQHGKNNG--NCRNSEDRPVPNFMPLSCNPMNSNL  70

Query  370  SPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
             P+ RWWL  +PN   Q  LAGEHL  +D
Sbjct  71   PPDIRWWLQSQPNLAGQKNLAGEHLYFLD  99



>ref|XP_009351984.1| PREDICTED: uncharacterized protein LOC103943406 [Pyrus x bretschneideri]
Length=450

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 90/171 (53%), Gaps = 19/171 (11%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA A ARA WQR AN CFVQEDA  APK + CP +S S  E D        P++ +  C 
Sbjct  16   MAAAGARATWQRRANCCFVQEDAWSAPKFSSCPSSSSSKAESDIA------PENLKPDC-  68

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKLSE  507
            +P N N     L+PN++WWL+L+PN G Q     E L  ++ E++  +S F + T  +S+
Sbjct  69   MPYNPNPE---LAPNTKWWLNLEPNRGLQKEFTYEQLAVLEAELEVLNSGFVHKTPIISD  125

Query  508  YEIE------YVDEFTVDKSLLDSQVKMSAS-VKNDLGIGDKKLDTAFGSD  639
            Y          +D      S ++   ++S +  K+D   G ++L+   G+D
Sbjct  126  YYQSNGVLGTQIDMKNSANSFVEKPCQVSVTCTKSDQNKGMQELNAGIGND  176



>ref|NP_566080.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD20166.1| expressed protein [Arabidopsis thaliana]
 gb|AEC10719.1| uncharacterized protein AT2G46550 [Arabidopsis thaliana]
Length=397

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 59/98 (60%), Gaps = 11/98 (11%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCP----PTSPSAKEVD---TGPASAANPQ  312
            MA AEARA WQRT NRCFVQEDAKRAPKL  C      T+ S K+V+   + P  +  P+
Sbjct  1    MAAAEARAVWQRTVNRCFVQEDAKRAPKLTYCQSSSSSTASSTKQVEVSGSSPRVSVEPR  60

Query  313  DAER-ACFLPSNWNSSYSNLSP-NSRWWLHLKPNYGYQ  420
                 A F+P   N ++ +L P N+R W H  P++ +Q
Sbjct  61   TQSSCAGFMPLPRNPNFPDLLPHNTRLWSH--PHHQFQ  96



>gb|AAM98127.1| expressed protein [Arabidopsis thaliana]
 gb|AAN72116.1| expressed protein [Arabidopsis thaliana]
Length=397

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 59/98 (60%), Gaps = 11/98 (11%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCP----PTSPSAKEVD---TGPASAANPQ  312
            MA AEARA WQRT NRCFVQEDAKRAPKL  C      T+ S K+V+   + P  +  P+
Sbjct  1    MAAAEARAVWQRTVNRCFVQEDAKRAPKLTYCQSSSSSTASSTKQVEVSGSSPRVSVEPR  60

Query  313  DAER-ACFLPSNWNSSYSNLSP-NSRWWLHLKPNYGYQ  420
                 A F+P   N ++ +L P N+R W H  P++ +Q
Sbjct  61   TQSSCAGFMPLPRNPNFPDLLPHNTRLWSH--PHHQFQ  96



>ref|XP_002272343.1| PREDICTED: uncharacterized protein LOC100243561 [Vitis vinifera]
 ref|XP_010662875.1| PREDICTED: uncharacterized protein LOC100243561 [Vitis vinifera]
Length=494

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 2/102 (2%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAK-EVDTGPASAANPQDAERAC  330
            MA AE+RA W+R  NRCF+ E+A RAP  +  P +S S+K + D  P  AA+  D     
Sbjct  1    MAAAESRAGWKRNTNRCFIHENASRAPNSSSFPSSSSSSKRQSDGRPGDAAHRSDHPSPD  60

Query  331  FLPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD  456
             +  N N    + +P+S+WWL+ +PN+G+Q G   E L +++
Sbjct  61   CMHQNCN-PLEDPAPDSKWWLYPQPNFGHQKGFEHEQLNTLE  101



>ref|NP_001144345.1| uncharacterized protein LOC100277248 [Zea mays]
 ref|XP_008671133.1| PREDICTED: uncharacterized protein LOC100277248 isoform X1 [Zea 
mays]
 gb|ACG39717.1| hypothetical protein [Zea mays]
 gb|ACN27706.1| unknown [Zea mays]
 gb|ACR38129.1| unknown [Zea mays]
 tpg|DAA49087.1| TPA: hypothetical protein ZEAMMB73_993443 [Zea mays]
 tpg|DAA49088.1| TPA: hypothetical protein ZEAMMB73_993443 [Zea mays]
Length=479

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 51/88 (58%), Gaps = 3/88 (3%)
 Frame = +1

Query  190  TANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNL  369
             ANRC VQED KRAPKLACCP    SA++  T   +  N  D      +P + N  +SNL
Sbjct  13   AANRCLVQEDRKRAPKLACCP---SSAEQHGTNNGNCRNSVDRPICSLMPLSCNPMHSNL  69

Query  370  SPNSRWWLHLKPNYGYQGGLAGEHLLSV  453
             P+ RWW+  +PN+G Q  +  + L S+
Sbjct  70   PPDVRWWVQSQPNFGIQKDIVSKRLCSL  97



>ref|XP_006294183.1| hypothetical protein CARUB_v10023177mg, partial [Capsella rubella]
 gb|EOA27081.1| hypothetical protein CARUB_v10023177mg, partial [Capsella rubella]
Length=457

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 69/127 (54%), Gaps = 16/127 (13%)
 Frame = +1

Query  79   SLFQTPTILSWFTLFQ*N-----VQKNGRIMAVAEARAAWQRTANRCFVQEDAKRAPKLA  243
            +L  T  IL +F+L +           G IMA AEARA WQRT NRCFVQEDAKRAPK  
Sbjct  36   TLIFTRRILIYFSLLKFFWCYSLFLSYGEIMAAAEARAVWQRTVNRCFVQEDAKRAPKFT  95

Query  244  CCP----PTSPSAKEVDTGPASAANPQ---DAERACFLPSNWNSSYSNLSP-NSRWWLHL  399
             C      ++ S K+V    +S A+ +    +  A F+P + N ++ +L P N+  W   
Sbjct  96   YCQSSSSSSTASTKQVQDSGSSRASLEPLNQSSLAGFMPLHRNPNFHDLLPHNTGLW---  152

Query  400  KPNYGYQ  420
             P++ +Q
Sbjct  153  SPHHPFQ  159



>dbj|BAJ85356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 57/111 (51%), Gaps = 12/111 (11%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C  QEDAKRAPKLACCPP+     E ++G  +  +P+D     F+  NWN   S+  P  
Sbjct  17   CLFQEDAKRAPKLACCPPSMQQQHEANSG--NPTSPRDCHIPNFMHLNWNPMNSS-QPID  73

Query  382  RWWLHLKPNYGYQGGLAGEHL---------LSVDEMQGSSTFGNSTSKLSE  507
             W+L L+PN+G    L+G+ L           VD     ST  +  +K SE
Sbjct  74   AWFLQLQPNFGSHKVLSGDRLNYMGGEASAKKVDSFSPVSTLDDINTKKSE  124



>dbj|BAJ93272.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 57/111 (51%), Gaps = 12/111 (11%)
 Frame = +1

Query  202  CFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNLSPNS  381
            C  QEDAKRAPKLACCPP+     E ++G  +  +P+D     F+  NWN   S+  P  
Sbjct  17   CLFQEDAKRAPKLACCPPSMQQQHEANSG--NPTSPRDCHIPNFMHLNWNPMNSS-QPID  73

Query  382  RWWLHLKPNYGYQGGLAGEHL---------LSVDEMQGSSTFGNSTSKLSE  507
             W+L L+PN+G    L+G+ L           VD     ST  +  +K SE
Sbjct  74   AWFLQLQPNFGSHKVLSGDRLNYMGGEASAKKVDSFSPVSTLDDINTKKSE  124



>ref|XP_002882075.1| hypothetical protein ARALYDRAFT_483815 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58334.1| hypothetical protein ARALYDRAFT_483815 [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCP-----PTSPSAKEVD---TGPASAANP  309
            MA AEARA WQRT NRCFVQEDAKRAPKL  C       T+PS K+VD   + P  + +P
Sbjct  1    MAAAEARAVWQRTVNRCFVQEDAKRAPKLTYCQSSSSSSTTPSTKQVDDSGSSPRVSVDP  60

Query  310  QDAER-ACFLPSNWNSSYSNLSP-NSRWWLHLKPNY  411
            +     A  +P + N ++ +L P N+R W H   ++
Sbjct  61   RKQSSCAGSMPLHRNPNFPDLLPHNTRLWSHHHHHF  96



>ref|XP_004510657.1| PREDICTED: uncharacterized protein LOC101490666 isoform X1 [Cicer 
arietinum]
 ref|XP_004510658.1| PREDICTED: uncharacterized protein LOC101490666 isoform X2 [Cicer 
arietinum]
Length=377

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAAN  306
            +MA  E RA W RT NRCFVQEDAKR PKLACC  +  ++K  D G A  A+
Sbjct  1    MMAATEVRAVWHRTVNRCFVQEDAKRVPKLACCQSSRATSKLNDLGLAIVAD  52



>ref|XP_008234716.1| PREDICTED: uncharacterized protein LOC103333621 [Prunus mume]
Length=461

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 93/173 (54%), Gaps = 18/173 (10%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEAR AWQ  AN  FVQED + AP+ +  P +S S  E D  P +A    D     F
Sbjct  1    MAAAEARTAWQCRANCRFVQEDVRIAPRFSSFPSSSSSKAESDIAPENAPEGIDH----F  56

Query  334  LPS--NWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVD-EMQG-SSTFGNSTSKL  501
             P   ++N S S L+PN++WWL+L+PN+G Q     E L  ++ E++  +S F N  + +
Sbjct  57   TPGCMSYNPS-SELAPNTKWWLNLEPNFGPQKEFTYEQLKLIEAELEDLNSGFVNKPAII  115

Query  502  SEYE-----IEYVDEF--TVDKSLLDSQVKMSAS-VKNDLGIGDKKLDTAFGS  636
            S+Y      I   ++   TVD S ++   K+S +  KND   G ++L    G+
Sbjct  116  SDYYQCNGVIRNQNDIKNTVD-SFVEQPCKVSVTCTKNDQSKGMQELKAETGN  167



>ref|XP_008381203.1| PREDICTED: uncharacterized protein LOC103444069 [Malus domestica]
Length=450

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 86/171 (50%), Gaps = 19/171 (11%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA A AR  WQR AN CFVQEDA  APK + CP +S S  E D        P++ +  C 
Sbjct  16   MAAAGARTTWQRRANCCFVQEDAWSAPKFSSCPSSSSSKTESDIA------PENLKPDC-  68

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P N N     L+PN++WWL+L+PN G Q     E L  L  +    +S F + T  +S+
Sbjct  69   MPYNPNPE---LAPNTKWWLNLEPNCGPQKEFTYEQLTVLGAELEALNSGFVHKTPIISD  125

Query  508  YEIE------YVDEFTVDKSLLDSQVKMSAS-VKNDLGIGDKKLDTAFGSD  639
            Y          +D      S ++   ++S +  K+D   G ++L+   G+D
Sbjct  126  YYQSNGVLGTQIDMKNSANSFVEQPCQVSVTCTKSDQNKGMQELNAGIGND  176



>gb|AAM61512.1| unknown [Arabidopsis thaliana]
Length=397

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCP----PTSPSAKEVD---TGPASAANPQ  312
            MA AEARA WQRT NR FVQEDAKRAPKL  C      T+ S K+V+   + P  +  P+
Sbjct  1    MAAAEARAVWQRTVNRSFVQEDAKRAPKLTYCQSSSSSTASSTKQVEVSGSSPRVSVEPR  60

Query  313  DAER-ACFLPSNWNSSYSNLSP-NSRWWLHLKPNYGYQ  420
                 A F+P   N ++ +L P N+R W H  P++ +Q
Sbjct  61   TQSSCAGFMPLPRNPNFPDLLPHNTRLWSH--PHHQFQ  96



>ref|XP_010518331.1| PREDICTED: uncharacterized protein LOC104793634 [Camelina sativa]
Length=401

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 10/86 (12%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCP----PTSPSAKEVD----TGPASAANP  309
            MA AEARA WQRT NRCFVQEDAKRAPK   C      T+ S K+V+    +   S+  P
Sbjct  1    MAAAEARAVWQRTVNRCFVQEDAKRAPKFTYCQSSSSSTASSTKQVEDSGSSSRPSSLEP  60

Query  310  QDAERAC--FLPSNWNSSYSNLSPNS  381
            Q  + +C  F+P + N ++ +L P+S
Sbjct  61   QHHQSSCAGFMPLHRNPNFPDLLPHS  86



>ref|XP_010053839.1| PREDICTED: uncharacterized protein LOC104442186 isoform X3 [Eucalyptus 
grandis]
 gb|KCW78194.1| hypothetical protein EUGRSUZ_D02384 [Eucalyptus grandis]
Length=368

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKE  276
            MA AEARA WQRT NR FVQEDAKRAPKLACC  +S ++K+
Sbjct  1    MAAAEARAVWQRTINRYFVQEDAKRAPKLACCQSSSLTSKQ  41



>ref|XP_010507999.1| PREDICTED: uncharacterized protein LOC104784655 isoform X1 [Camelina 
sativa]
 ref|XP_010508000.1| PREDICTED: uncharacterized protein LOC104784655 isoform X1 [Camelina 
sativa]
Length=403

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 79/197 (40%), Gaps = 35/197 (18%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEARA WQRT NRCFVQEDAKRAPK   C  +S S          + +      +  
Sbjct  1    MAAAEARAVWQRTVNRCFVQEDAKRAPKFTYCQSSSSSTPSSTKQVEDSGSSSSRPSSSL  60

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNY----GYQGGLAGEHLLSVDEMQGSSTFGNSTSKL  501
             P +  SS S   P     LH  PN+     +  GL   H  S   +       N+   L
Sbjct  61   EPQHHQSSCSGFMP-----LHRTPNFPDLLPHNTGLWTPHHPSFQMVNKKPLEVNNNEVL  115

Query  502  SEYEIEYVDEFTVDKSLLDSQVKMSASVKNDLGIGDKKLDTAFGSDSLDDCLRLESIKNP  681
            +E                          K +LG G+KK    + S+S  + + L   +  
Sbjct  116  TE-------------------------KKPELGAGEKKQVKTYNSESFQEFIELMETRES  150

Query  682  TGFRMTESFDCPVSKPA  732
             G    ES +  +++PA
Sbjct  151  YG-SYDESTEKKLNEPA  166



>ref|XP_006294182.1| hypothetical protein CARUB_v10023177mg [Capsella rubella]
 gb|EOA27080.1| hypothetical protein CARUB_v10023177mg [Capsella rubella]
Length=392

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 11/97 (11%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCP----PTSPSAKEVDTGPASAANPQ---  312
            MA AEARA WQRT NRCFVQEDAKRAPK   C      ++ S K+V    +S A+ +   
Sbjct  1    MAAAEARAVWQRTVNRCFVQEDAKRAPKFTYCQSSSSSSTASTKQVQDSGSSRASLEPLN  60

Query  313  DAERACFLPSNWNSSYSNLSP-NSRWWLHLKPNYGYQ  420
             +  A F+P + N ++ +L P N+  W    P++ +Q
Sbjct  61   QSSLAGFMPLHRNPNFHDLLPHNTGLW---SPHHPFQ  94



>ref|XP_007217977.1| hypothetical protein PRUPE_ppa005435mg [Prunus persica]
 gb|EMJ19176.1| hypothetical protein PRUPE_ppa005435mg [Prunus persica]
Length=461

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 90/174 (52%), Gaps = 18/174 (10%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEAR AWQ  AN  FVQED + AP+ +  P +S S  E D+ P +A    D     F
Sbjct  1    MAAAEARTAWQCRANCRFVQEDVRIAPRFSSFPSSSSSKAESDSAPENAPEGIDH----F  56

Query  334  LPS--NWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEH--LLSVDEMQGSSTFGNSTSKL  501
             P   ++N S S L+PN++WWL+L+PN+G       E   LL  +    +S F N  + +
Sbjct  57   TPGCMSYNPS-SELAPNTKWWLNLEPNFGPHKEFTYEQLKLLEAELEDLNSGFVNKPAII  115

Query  502  SEY-------EIEYVDEFTVDKSLLDSQVKMSASV-KNDLGIGDKKLDTAFGSD  639
            S+Y         +   + TVD S ++   K+S +  KND   G ++L    G+D
Sbjct  116  SDYYQCNGVIRNQNDRKNTVD-SFVEQPCKVSVTCSKNDQSKGMQELKAETGND  168



>ref|XP_009142627.1| PREDICTED: uncharacterized protein LOC103866456 [Brassica rapa]
 ref|XP_009142629.1| PREDICTED: uncharacterized protein LOC103866456 [Brassica rapa]
 ref|XP_009142630.1| PREDICTED: uncharacterized protein LOC103866456 [Brassica rapa]
 ref|XP_009142631.1| PREDICTED: uncharacterized protein LOC103866456 [Brassica rapa]
 emb|CDX80028.1| BnaA05g01280D [Brassica napus]
Length=389

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 54/92 (59%), Gaps = 10/92 (11%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKL----ACCPPTSPSAKEVDTGPAS--AANPQ  312
            +MA  EARA WQRT NR FVQEDAKRAPKL         ++ S+K+V+   +S    +P 
Sbjct  1    MMAAGEARAVWQRTVNRYFVQEDAKRAPKLTTSSCQSSSSTVSSKQVEDSGSSRPVVDPH  60

Query  313  DAERAC--FLPSNWNSSYSNLSPN--SRWWLH  396
            +    C  F+P + N ++ +LSPN  S W  H
Sbjct  61   NQSSICPSFMPRHPNPNFPHLSPNNTSLWGHH  92



>emb|CDY56879.1| BnaC04g52160D [Brassica napus]
Length=390

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 8/90 (9%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKL---ACCPPTSPSAKEVDTGPAS--AANPQD  315
            +MA  EARA WQRT NR FVQEDAKRAPKL        ++ S+K+V+   +S    +P +
Sbjct  1    MMAAGEARAVWQRTVNRYFVQEDAKRAPKLTTSCQSSSSTVSSKQVEDSGSSRPVVDPHN  60

Query  316  AERAC--FLPSNWNSSYSNLSP-NSRWWLH  396
               +C  F+P + N ++ +L P N+  W H
Sbjct  61   QSSSCAGFMPRHPNPNFPHLLPHNTSLWGH  90



>ref|XP_011470673.1| PREDICTED: uncharacterized protein LOC101306176 [Fragaria vesca 
subsp. vesca]
Length=446

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 67/119 (56%), Gaps = 4/119 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA AEAR AWQ  AN CF Q+D + A + +   P+S S+KE D+   +A+   D      
Sbjct  1    MAAAEARRAWQHRANCCFSQDDGRSAQRFSR-HPSSSSSKESDSAHENASYGIDHLIPER  59

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHLLSVDEMQGSSTFGNSTSKLSEY  510
             P N   S   L+P++RWWL+L+PN+G Q     +   S+D    +S + N T+ +++Y
Sbjct  60   TPYN---STPELTPSTRWWLNLEPNFGPQKEFIDDQRKSLDAEVLNSGYINKTAIINDY  115



>ref|XP_010480486.1| PREDICTED: uncharacterized protein LOC104759232 isoform X1 [Camelina 
sativa]
Length=351

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCF-VQEDAKRAPKLACC  249
            +M  AEARA WQRTA+RCF V EDAK AP+LACC
Sbjct  18   VMGAAEARALWQRTASRCFAVHEDAKMAPRLACC  51



>ref|XP_010457146.1| PREDICTED: uncharacterized protein LOC104738668 isoform X1 [Camelina 
sativa]
Length=348

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCF-VQEDAKRAPKLACC  249
            +M  AEARA WQRTA+RCF V EDAK AP+LACC
Sbjct  18   VMGAAEARALWQRTASRCFAVHEDAKMAPRLACC  51



>ref|XP_003574449.1| PREDICTED: uncharacterized protein LOC100831357 [Brachypodium 
distachyon]
 ref|XP_010235107.1| PREDICTED: uncharacterized protein LOC100831357 [Brachypodium 
distachyon]
Length=482

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 3/84 (4%)
 Frame = +1

Query  190  TANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACFLPSNWNSSYSNL  369
             ANRC VQED KRAPKLACCP +S   ++  T   ++   +    + F+P + N   SNL
Sbjct  13   AANRCMVQEDRKRAPKLACCPLSS---EQHGTNNGNSTTSEGRPISNFVPLSCNPINSNL  69

Query  370  SPNSRWWLHLKPNYGYQGGLAGEH  441
              + RW   L+PN+  Q  LA E 
Sbjct  70   PQDIRWRFQLQPNFRVQKDLASEQ  93



>ref|NP_563623.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_973735.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_973736.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF97320.1|AC023628_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL16213.1|AF428444_1 At1g01240/F6F3_11 [Arabidopsis thaliana]
 gb|AAL07020.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14135.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27258.1| uncharacterized protein AT1G01240 [Arabidopsis thaliana]
 gb|AEE27259.1| uncharacterized protein AT1G01240 [Arabidopsis thaliana]
 gb|AEE27260.1| uncharacterized protein AT1G01240 [Arabidopsis thaliana]
Length=331

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCF-VQEDAKRAPKLACCPPTSPSA  270
            M  AEARA WQRTA+RCF V EDAK AP+LACC     S+
Sbjct  1    MGAAEARALWQRTASRCFVVHEDAKMAPRLACCQHQQSSS  40



>gb|AAM64874.1| unknown [Arabidopsis thaliana]
Length=331

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCF-VQEDAKRAPKLACCPPTSPSA  270
            M  AEARA WQRTA+RCF V EDAK AP+LACC     S+
Sbjct  1    MGAAEARALWQRTASRCFVVHEDAKMAPRLACCQHQQSSS  40



>ref|XP_006305329.1| hypothetical protein CARUB_v10009708mg [Capsella rubella]
 ref|XP_006305330.1| hypothetical protein CARUB_v10009708mg [Capsella rubella]
 gb|EOA38227.1| hypothetical protein CARUB_v10009708mg [Capsella rubella]
 gb|EOA38228.1| hypothetical protein CARUB_v10009708mg [Capsella rubella]
Length=329

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCF-VQEDAKRAPKLACCPPTSPSA  270
            M  AEARA WQRTA+RCF V EDAK AP+LACC     S+
Sbjct  1    MGAAEARALWQRTASRCFAVHEDAKMAPRLACCQHQHSSS  40



>ref|XP_006418404.1| hypothetical protein EUTSA_v10008123mg [Eutrema salsugineum]
 gb|ESQ36757.1| hypothetical protein EUTSA_v10008123mg [Eutrema salsugineum]
Length=341

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFV-QEDAKRAPKLACCPPTSPSA  270
            M  AEARA WQRTA RCFV  EDAK AP+LACC     S+
Sbjct  1    MGAAEARAVWQRTATRCFVIHEDAKMAPRLACCHQKHSSS  40



>ref|XP_010480492.1| PREDICTED: uncharacterized protein LOC104759232 isoform X2 [Camelina 
sativa]
 ref|XP_010480498.1| PREDICTED: uncharacterized protein LOC104759232 isoform X2 [Camelina 
sativa]
Length=333

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCF-VQEDAKRAPKLACC  249
            M  AEARA WQRTA+RCF V EDAK AP+LACC
Sbjct  1    MGAAEARALWQRTASRCFAVHEDAKMAPRLACC  33



>ref|XP_002892078.1| hypothetical protein ARALYDRAFT_470152 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68337.1| hypothetical protein ARALYDRAFT_470152 [Arabidopsis lyrata subsp. 
lyrata]
Length=334

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCF-VQEDAKRAPKLACC  249
            M  AEARA WQRTA+RCF V EDAK AP+LACC
Sbjct  1    MGAAEARALWQRTASRCFIVHEDAKMAPRLACC  33



>ref|XP_010474714.1| PREDICTED: uncharacterized protein LOC104754270 [Camelina sativa]
 ref|XP_010474715.1| PREDICTED: uncharacterized protein LOC104754270 [Camelina sativa]
Length=327

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCF-VQEDAKRAPKLACC  249
            M  AEARA WQRTA+RCF V EDAK AP+LACC
Sbjct  1    MGAAEARALWQRTASRCFAVHEDAKMAPRLACC  33



>ref|XP_010457147.1| PREDICTED: uncharacterized protein LOC104738668 isoform X2 [Camelina 
sativa]
 ref|XP_010457148.1| PREDICTED: uncharacterized protein LOC104738668 isoform X2 [Camelina 
sativa]
 ref|XP_010457151.1| PREDICTED: uncharacterized protein LOC104738668 isoform X2 [Camelina 
sativa]
Length=330

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCF-VQEDAKRAPKLACC  249
            M  AEARA WQRTA+RCF V EDAK AP+LACC
Sbjct  1    MGAAEARALWQRTASRCFAVHEDAKMAPRLACC  33



>gb|KEH18627.1| transmembrane protein, putative [Medicago truncatula]
Length=372

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPAS  297
            MA  E R  W RT N  FV+EDAKR PK+ACC  +  ++K  D G  S
Sbjct  1    MAATEVRTVWHRTFNHYFVKEDAKRTPKIACCQSSCATSKLDDLGYVS  48



>ref|XP_008376756.1| PREDICTED: uncharacterized protein LOC103439891 isoform X2 [Malus 
domestica]
Length=434

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 12/121 (10%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA A A+ A    AN CFVQEDA+ AP+ +  P +S S  E D        P++ +  C 
Sbjct  1    MAEAGAQTACHCRANCCFVQEDARSAPRFSSYPSSSSSKAESDIA------PENIKPDC-  53

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P N       L+PN++WWL+L+PN G Q     E L  L  +    +S F + T  +S+
Sbjct  54   MPCN---PSPELAPNTKWWLNLEPNCGPQEEFTYEQLKVLEAELEVLNSGFVHRTPIISD  110

Query  508  Y  510
            Y
Sbjct  111  Y  111



>ref|XP_008376754.1| PREDICTED: uncharacterized protein LOC103439891 isoform X1 [Malus 
domestica]
 ref|XP_008376755.1| PREDICTED: uncharacterized protein LOC103439891 isoform X1 [Malus 
domestica]
Length=435

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 12/121 (10%)
 Frame = +1

Query  154  MAVAEARAAWQRTANRCFVQEDAKRAPKLACCPPTSPSAKEVDTGPASAANPQDAERACF  333
            MA A A+ A    AN CFVQEDA+ AP+ +  P +S S  E D        P++ +  C 
Sbjct  1    MAEAGAQTACHCRANCCFVQEDARSAPRFSSYPSSSSSKAESDIA------PENIKPDC-  53

Query  334  LPSNWNSSYSNLSPNSRWWLHLKPNYGYQGGLAGEHL--LSVDEMQGSSTFGNSTSKLSE  507
            +P N       L+PN++WWL+L+PN G Q     E L  L  +    +S F + T  +S+
Sbjct  54   MPCN---PSPELAPNTKWWLNLEPNCGPQEEFTYEQLKVLEAELEVLNSGFVHRTPIISD  110

Query  508  Y  510
            Y
Sbjct  111  Y  111



>emb|CDX85174.1| BnaC07g07320D [Brassica napus]
Length=204

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKL  240
            +MA  EARA WQRT NR  VQEDAKRAPK 
Sbjct  1    MMAAGEARAVWQRTVNRYLVQEDAKRAPKF  30



>emb|CDY27317.1| BnaC04g50880D [Brassica napus]
Length=325

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKL  240
            +MA  EARA WQRT NR  VQEDAKRAPK 
Sbjct  1    MMAAGEARAVWQRTVNRYLVQEDAKRAPKF  30



>emb|CDY61731.1| BnaA04g27190D [Brassica napus]
Length=313

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKL  240
            +MA  EARA WQRT NR  VQEDAKRAPK 
Sbjct  1    MMAGGEARAVWQRTVNRYLVQEDAKRAPKF  30



>ref|XP_009142425.1| PREDICTED: uncharacterized protein LOC103866284 isoform X1 [Brassica 
rapa]
Length=340

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  151  IMAVAEARAAWQRTANRCFVQEDAKRAPKL  240
            +MA  EARA WQRT NR  VQEDAKRAPK 
Sbjct  1    MMAGGEARAVWQRTVNRYLVQEDAKRAPKF  30



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1400076157675