BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5230

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU19975.1|  hypothetical protein MIMGU_mgv1a010541mg                274   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_010321446.1|  PREDICTED: probable sugar phosphate/phosphat...    269   1e-85   
ref|XP_009602684.1|  PREDICTED: probable sugar phosphate/phosphat...    269   2e-85   Nicotiana tomentosiformis
ref|XP_006355671.1|  PREDICTED: probable sugar phosphate/phosphat...    268   4e-85   Solanum tuberosum [potatoes]
ref|XP_011084967.1|  PREDICTED: probable sugar phosphate/phosphat...    266   1e-84   Sesamum indicum [beniseed]
ref|XP_011084965.1|  PREDICTED: probable sugar phosphate/phosphat...    266   1e-84   Sesamum indicum [beniseed]
ref|XP_011084966.1|  PREDICTED: probable sugar phosphate/phosphat...    266   2e-84   Sesamum indicum [beniseed]
ref|XP_009786378.1|  PREDICTED: probable sugar phosphate/phosphat...    265   3e-84   Nicotiana sylvestris
ref|XP_009587505.1|  PREDICTED: probable sugar phosphate/phosphat...    263   3e-83   Nicotiana tomentosiformis
gb|EYU41247.1|  hypothetical protein MIMGU_mgv1a010483mg                262   5e-83   Erythranthe guttata [common monkey flower]
dbj|BAD91177.1|  plastidic phosphate translocator-like protein2         262   8e-83   Mesembryanthemum crystallinum
ref|XP_002279987.1|  PREDICTED: probable sugar phosphate/phosphat...    260   3e-82   Vitis vinifera
ref|XP_010690286.1|  PREDICTED: probable sugar phosphate/phosphat...    259   9e-82   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB74200.1|  hypothetical protein B456_011G279000                    258   2e-81   Gossypium raimondii
ref|XP_010558089.1|  PREDICTED: probable sugar phosphate/phosphat...    257   7e-81   Tarenaya hassleriana [spider flower]
gb|KHG28840.1|  hypothetical protein F383_10338                         256   1e-80   Gossypium arboreum [tree cotton]
emb|CDY01011.1|  BnaC05g41890D                                          256   2e-80   
ref|XP_010256719.1|  PREDICTED: probable sugar phosphate/phosphat...    255   2e-80   Nelumbo nucifera [Indian lotus]
ref|NP_187740.2|  probable sugar phosphate/phosphate translocator       255   3e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494961.1|  PREDICTED: probable sugar phosphate/phosphat...    255   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_002884840.1|  organic anion transporter                          255   4e-80   
ref|XP_009135159.1|  PREDICTED: probable sugar phosphate/phosphat...    254   5e-80   Brassica rapa
ref|XP_004503221.1|  PREDICTED: probable sugar phosphate/phosphat...    258   5e-80   Cicer arietinum [garbanzo]
emb|CDX73882.1|  BnaA03g31650D                                          254   5e-80   
ref|XP_010552861.1|  PREDICTED: probable sugar phosphate/phosphat...    254   5e-80   Tarenaya hassleriana [spider flower]
ref|XP_006407457.1|  hypothetical protein EUTSA_v10021195mg             254   6e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010464838.1|  PREDICTED: probable sugar phosphate/phosphat...    254   7e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010543750.1|  PREDICTED: probable sugar phosphate/phosphat...    254   9e-80   Tarenaya hassleriana [spider flower]
ref|XP_006298193.1|  hypothetical protein CARUB_v10014239mg             254   1e-79   Capsella rubella
ref|XP_010262727.1|  PREDICTED: probable sugar phosphate/phosphat...    254   1e-79   Nelumbo nucifera [Indian lotus]
ref|XP_012088054.1|  PREDICTED: probable sugar phosphate/phosphat...    253   1e-79   Jatropha curcas
ref|XP_006378680.1|  hypothetical protein POPTR_0010s20130g             252   1e-79   
ref|XP_009766548.1|  PREDICTED: probable sugar phosphate/phosphat...    253   1e-79   Nicotiana sylvestris
gb|AAG50965.1|AC073395_7  integral membrane protein, putative; 85...    254   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010093497.1|  putative sugar phosphate/phosphate translocator    257   2e-79   
ref|XP_002316239.1|  phosphate translocator-related family protein      253   2e-79   Populus trichocarpa [western balsam poplar]
ref|XP_007009112.1|  Nucleotide-sugar transporter family protein        253   2e-79   
gb|KFK38518.1|  hypothetical protein AALP_AA3G123800                    253   2e-79   Arabis alpina [alpine rockcress]
emb|CDY00731.1|  BnaC03g37150D                                          253   3e-79   
emb|CDY08536.1|  BnaA05g27720D                                          253   3e-79   Brassica napus [oilseed rape]
ref|XP_009416272.1|  PREDICTED: probable sugar phosphate/phosphat...    253   3e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007163501.1|  hypothetical protein PHAVU_001G239500g             252   3e-79   Phaseolus vulgaris [French bean]
gb|KJB60714.1|  hypothetical protein B456_009G321700                    251   4e-79   Gossypium raimondii
gb|KJB78804.1|  hypothetical protein B456_013G019900                    248   5e-79   Gossypium raimondii
ref|XP_006399041.1|  hypothetical protein EUTSA_v10014183mg             252   7e-79   Eutrema salsugineum [saltwater cress]
gb|KJB60712.1|  hypothetical protein B456_009G321700                    251   7e-79   Gossypium raimondii
ref|XP_010423420.1|  PREDICTED: probable sugar phosphate/phosphat...    251   8e-79   Camelina sativa [gold-of-pleasure]
gb|KHG06744.1|  hypothetical protein F383_33861                         251   8e-79   Gossypium arboreum [tree cotton]
ref|XP_008463202.1|  PREDICTED: probable sugar phosphate/phosphat...    251   9e-79   Cucumis melo [Oriental melon]
ref|XP_010067486.1|  PREDICTED: probable sugar phosphate/phosphat...    251   1e-78   Eucalyptus grandis [rose gum]
ref|XP_010452490.1|  PREDICTED: probable sugar phosphate/phosphat...    251   1e-78   Camelina sativa [gold-of-pleasure]
gb|KJB78805.1|  hypothetical protein B456_013G019900                    249   1e-78   Gossypium raimondii
ref|XP_009351076.1|  PREDICTED: probable sugar phosphate/phosphat...    251   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_007218734.1|  hypothetical protein PRUPE_ppa009115mg             251   2e-78   
ref|XP_008392901.1|  PREDICTED: probable sugar phosphate/phosphat...    251   2e-78   
ref|XP_009146737.1|  PREDICTED: probable sugar phosphate/phosphat...    251   2e-78   Brassica rapa
ref|XP_011469879.1|  PREDICTED: probable sugar phosphate/phosphat...    250   2e-78   Fragaria vesca subsp. vesca
ref|XP_002873225.1|  hypothetical protein ARALYDRAFT_487383             250   2e-78   
emb|CDX70125.1|  BnaA10g24740D                                          250   2e-78   
emb|CDX98868.1|  BnaC09g49670D                                          250   2e-78   
gb|KHG27157.1|  hypothetical protein F383_03045                         250   3e-78   Gossypium arboreum [tree cotton]
gb|KJB78803.1|  hypothetical protein B456_013G019900                    250   3e-78   Gossypium raimondii
gb|KJB60713.1|  hypothetical protein B456_009G321700                    247   3e-78   Gossypium raimondii
ref|XP_011036021.1|  PREDICTED: probable sugar phosphate/phosphat...    249   4e-78   Populus euphratica
ref|XP_006288294.1|  hypothetical protein CARUB_v10001537mg             250   4e-78   Capsella rubella
ref|NP_196201.2|  nucleotide-sugar transporter family protein           249   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163500.1|  hypothetical protein PHAVU_001G239500g             253   5e-78   Phaseolus vulgaris [French bean]
dbj|BAB09676.1|  phosphate/phosphoenolpyruvate translocator prote...    249   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010685639.1|  PREDICTED: probable sugar phosphate/phosphat...    249   5e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003544134.1|  PREDICTED: probable sugar phosphate/phosphat...    249   9e-78   Glycine max [soybeans]
ref|XP_009122182.1|  PREDICTED: probable sugar phosphate/phosphat...    249   1e-77   Brassica rapa
ref|XP_011039452.1|  PREDICTED: probable sugar phosphate/phosphat...    249   1e-77   Populus euphratica
ref|XP_008441429.1|  PREDICTED: probable sugar phosphate/phosphat...    251   1e-77   
ref|XP_004138435.2|  PREDICTED: probable sugar phosphate/phosphat...    251   1e-77   Cucumis sativus [cucumbers]
gb|KHG03209.1|  hypothetical protein F383_26828                         244   1e-77   Gossypium arboreum [tree cotton]
ref|XP_002311199.1|  phosphate translocator-related family protein      248   2e-77   Populus trichocarpa [western balsam poplar]
gb|KGN45768.1|  hypothetical protein Csa_6G009470                       251   2e-77   Cucumis sativus [cucumbers]
ref|XP_008792285.1|  PREDICTED: probable sugar phosphate/phosphat...    248   2e-77   Phoenix dactylifera
ref|XP_010922503.1|  PREDICTED: probable sugar phosphate/phosphat...    248   2e-77   Elaeis guineensis
gb|KJB76143.1|  hypothetical protein B456_012G074900                    248   3e-77   Gossypium raimondii
ref|XP_010907522.1|  PREDICTED: probable sugar phosphate/phosphat...    248   3e-77   Elaeis guineensis
gb|KDO69266.1|  hypothetical protein CISIN_1g021864mg                   246   3e-77   Citrus sinensis [apfelsine]
ref|XP_009344409.1|  PREDICTED: probable sugar phosphate/phosphat...    250   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_009402357.1|  PREDICTED: probable sugar phosphate/phosphat...    248   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008381890.1|  PREDICTED: probable sugar phosphate/phosphat...    250   4e-77   Malus domestica [apple tree]
gb|KHG03208.1|  hypothetical protein F383_26828                         248   4e-77   Gossypium arboreum [tree cotton]
ref|XP_008381883.1|  PREDICTED: probable sugar phosphate/phosphat...    250   5e-77   
gb|KDO69265.1|  hypothetical protein CISIN_1g021864mg                   246   6e-77   Citrus sinensis [apfelsine]
ref|XP_009406945.1|  PREDICTED: probable sugar phosphate/phosphat...    247   7e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003552587.1|  PREDICTED: probable sugar phosphate/phosphat...    246   8e-77   Glycine max [soybeans]
ref|XP_009612002.1|  PREDICTED: probable sugar phosphate/phosphat...    246   8e-77   Nicotiana tomentosiformis
gb|KJB67541.1|  hypothetical protein B456_010G199400                    246   8e-77   Gossypium raimondii
gb|KJB67542.1|  hypothetical protein B456_010G199400                    245   8e-77   Gossypium raimondii
gb|KHG07850.1|  hypothetical protein F383_12851                         246   1e-76   Gossypium arboreum [tree cotton]
ref|XP_006435562.1|  hypothetical protein CICLE_v10032214mg             244   1e-76   
gb|ACU24623.1|  unknown                                                 246   1e-76   Glycine max [soybeans]
ref|XP_006843236.1|  PREDICTED: probable sugar phosphate/phosphat...    246   1e-76   Amborella trichopoda
ref|XP_006591369.1|  PREDICTED: probable sugar phosphate/phosphat...    249   1e-76   
gb|KHN17860.1|  Putative sugar phosphate/phosphate translocator         249   2e-76   Glycine soja [wild soybean]
ref|XP_006435561.1|  hypothetical protein CICLE_v10032214mg             245   2e-76   Citrus clementina [clementine]
ref|XP_003600842.1|  Solute carrier family 35 member E4                 245   3e-76   
ref|XP_010920931.1|  PREDICTED: probable sugar phosphate/phosphat...    245   3e-76   Elaeis guineensis
ref|XP_008789041.1|  PREDICTED: probable sugar phosphate/phosphat...    244   6e-76   Phoenix dactylifera
ref|XP_010907994.1|  PREDICTED: probable sugar phosphate/phosphat...    244   8e-76   Elaeis guineensis
ref|XP_003538441.2|  PREDICTED: probable sugar phosphate/phosphat...    248   8e-76   
gb|AGZ15400.1|  organic anion transporter                               244   9e-76   Phaseolus vulgaris [French bean]
ref|XP_007141807.1|  hypothetical protein PHAVU_008G227200g             243   1e-75   Phaseolus vulgaris [French bean]
ref|XP_008802329.1|  PREDICTED: probable sugar phosphate/phosphat...    244   1e-75   Phoenix dactylifera
ref|XP_008783674.1|  PREDICTED: probable sugar phosphate/phosphat...    243   2e-75   Phoenix dactylifera
ref|XP_010907993.1|  PREDICTED: probable sugar phosphate/phosphat...    243   2e-75   Elaeis guineensis
ref|XP_009410592.1|  PREDICTED: probable sugar phosphate/phosphat...    243   3e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381388.1|  PREDICTED: probable sugar phosphate/phosphat...    242   3e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004490944.1|  PREDICTED: probable sugar phosphate/phosphat...    241   6e-75   Cicer arietinum [garbanzo]
ref|NP_001242185.1|  uncharacterized protein LOC100817995               241   7e-75   Glycine max [soybeans]
ref|XP_002277359.1|  PREDICTED: probable sugar phosphate/phosphat...    241   1e-74   Vitis vinifera
ref|XP_009420353.1|  PREDICTED: probable sugar phosphate/phosphat...    241   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002965871.1|  hypothetical protein SELMODRAFT_85074              239   3e-74   
ref|XP_009130902.1|  PREDICTED: probable sugar phosphate/phosphat...    237   4e-73   Brassica rapa
emb|CDY11341.1|  BnaA03g01770D                                          237   4e-73   Brassica napus [oilseed rape]
emb|CDX80975.1|  BnaC03g02290D                                          236   5e-73   
ref|XP_004984826.1|  PREDICTED: probable sugar phosphate/phosphat...    237   7e-73   Setaria italica
ref|XP_003558175.1|  PREDICTED: probable sugar phosphate/phosphat...    236   8e-73   Brachypodium distachyon [annual false brome]
gb|EPS66893.1|  plastidic phosphate translocator-like protein2          235   2e-72   Genlisea aurea
ref|XP_012068417.1|  PREDICTED: probable sugar phosphate/phosphat...    235   2e-72   Jatropha curcas
ref|NP_001049773.1|  Os03g0286300                                       234   5e-72   
ref|XP_006586185.1|  PREDICTED: probable sugar phosphate/phosphat...    233   1e-71   Glycine max [soybeans]
ref|XP_003552971.1|  PREDICTED: probable sugar phosphate/phosphat...    233   2e-71   Glycine max [soybeans]
gb|EAY89543.1|  hypothetical protein OsI_11077                          233   3e-71   Oryza sativa Indica Group [Indian rice]
emb|CDP06527.1|  unnamed protein product                                232   3e-71   Coffea canephora [robusta coffee]
dbj|BAK01941.1|  predicted protein                                      233   3e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001151135.1|  organic anion transporter                          233   3e-71   Zea mays [maize]
gb|AFW88728.1|  hypothetical protein ZEAMMB73_781596                    232   5e-71   
dbj|BAJ91133.1|  predicted protein                                      232   5e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24351.1|  unknown                                                 231   6e-71   Picea sitchensis
gb|EMT07416.1|  hypothetical protein F775_28356                         232   1e-70   
ref|XP_002314133.1|  hypothetical protein POPTR_0009s04550g             231   1e-70   Populus trichocarpa [western balsam poplar]
gb|KEH34138.1|  triose-phosphate transporter family protein             231   1e-70   Medicago truncatula
ref|XP_004295729.1|  PREDICTED: probable sugar phosphate/phosphat...    229   2e-70   Fragaria vesca subsp. vesca
ref|XP_001781766.1|  predicted protein                                  229   3e-70   
gb|ACL52514.1|  unknown                                                 230   3e-70   Zea mays [maize]
ref|NP_001130193.1|  uncharacterized protein LOC100191287               230   3e-70   Zea mays [maize]
gb|AES99511.2|  triose-phosphate transporter family protein             229   5e-70   Medicago truncatula
ref|XP_011035212.1|  PREDICTED: probable sugar phosphate/phosphat...    228   7e-70   Populus euphratica
ref|XP_011032188.1|  PREDICTED: probable sugar phosphate/phosphat...    228   7e-70   Populus euphratica
ref|XP_007147595.1|  hypothetical protein PHAVU_006G137900g             228   8e-70   Phaseolus vulgaris [French bean]
ref|XP_006651269.1|  PREDICTED: probable sugar phosphate/phosphat...    228   1e-69   Oryza brachyantha
ref|XP_007206668.1|  hypothetical protein PRUPE_ppa022815mg             228   2e-69   
ref|XP_002463449.1|  hypothetical protein SORBIDRAFT_02g044050          228   2e-69   Sorghum bicolor [broomcorn]
ref|XP_002299832.1|  hypothetical protein POPTR_0001s25480g             227   3e-69   Populus trichocarpa [western balsam poplar]
ref|XP_008355494.1|  PREDICTED: probable sugar phosphate/phosphat...    224   2e-68   Malus domestica [apple tree]
ref|XP_004500210.1|  PREDICTED: probable sugar phosphate/phosphat...    224   3e-68   Cicer arietinum [garbanzo]
ref|XP_004958806.1|  PREDICTED: probable sugar phosphate/phosphat...    224   3e-68   Setaria italica
ref|XP_008221016.1|  PREDICTED: probable sugar phosphate/phosphat...    224   4e-68   Prunus mume [ume]
ref|XP_011076749.1|  PREDICTED: probable sugar phosphate/phosphat...    224   5e-68   Sesamum indicum [beniseed]
gb|EPS64971.1|  plastidic phosphate translocator-like protein2          224   6e-68   Genlisea aurea
ref|XP_006488450.1|  PREDICTED: probable sugar phosphate/phosphat...    223   9e-68   Citrus sinensis [apfelsine]
ref|XP_003616554.1|  Maturase                                           227   1e-67   
ref|XP_009374303.1|  PREDICTED: probable sugar phosphate/phosphat...    222   2e-67   Pyrus x bretschneideri [bai li]
gb|KDO66736.1|  hypothetical protein CISIN_1g021266mg                   222   3e-67   Citrus sinensis [apfelsine]
ref|XP_001765873.1|  predicted protein                                  222   4e-67   
gb|ADE76672.1|  unknown                                                 221   4e-67   Picea sitchensis
ref|XP_002281102.1|  PREDICTED: probable sugar phosphate/phosphat...    221   8e-67   Vitis vinifera
ref|XP_006424991.1|  hypothetical protein CICLE_v10029901mg             220   2e-66   
gb|KJB21651.1|  hypothetical protein B456_004G006600                    219   2e-66   Gossypium raimondii
ref|XP_003616553.1|  Maturase                                           226   2e-65   
ref|XP_007016212.1|  Nucleotide-sugar transporter family protein        214   2e-64   
ref|XP_010423621.1|  PREDICTED: probable sugar phosphate/phosphat...    214   4e-64   Camelina sativa [gold-of-pleasure]
gb|AAL32553.1|  phosphate/phosphoenolpyruvate translocator-like p...    214   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196036.1|  nucleotide-sugar transporter family protein           214   5e-64   Arabidopsis thaliana [mouse-ear cress]
gb|ERN05166.1|  hypothetical protein AMTR_s00053p00210710               213   8e-64   Amborella trichopoda
ref|XP_011622979.1|  PREDICTED: probable sugar phosphate/phosphat...    213   9e-64   Amborella trichopoda
ref|XP_006398872.1|  hypothetical protein EUTSA_v10014173mg             212   1e-63   Eutrema salsugineum [saltwater cress]
ref|XP_007026813.1|  Nucleotide-sugar transporter family protein        212   2e-63   Theobroma cacao [chocolate]
ref|XP_008239748.1|  PREDICTED: probable sugar phosphate/phosphat...    212   2e-63   Prunus mume [ume]
ref|XP_002873138.1|  hypothetical protein ARALYDRAFT_487196             211   3e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_006287792.1|  hypothetical protein CARUB_v10001004mg             215   3e-63   
gb|KDO42357.1|  hypothetical protein CISIN_1g038896mg                   212   4e-63   Citrus sinensis [apfelsine]
ref|XP_006421284.1|  hypothetical protein CICLE_v10005494mg             211   4e-63   Citrus clementina [clementine]
ref|XP_006492952.1|  PREDICTED: probable sugar phosphate/phosphat...    211   6e-63   Citrus sinensis [apfelsine]
gb|KFK24863.1|  hypothetical protein AALP_AA8G034800                    211   7e-63   Arabis alpina [alpine rockcress]
ref|XP_007028704.1|  Nucleotide-sugar transporter family protein        211   9e-63   
emb|CDY41396.1|  BnaCnng10320D                                          210   1e-62   Brassica napus [oilseed rape]
emb|CDY08614.1|  BnaA05g28500D                                          210   2e-62   Brassica napus [oilseed rape]
gb|KJB14848.1|  hypothetical protein B456_002G146200                    209   2e-62   Gossypium raimondii
ref|XP_002323269.1|  phosphate translocator-related family protein      209   3e-62   Populus trichocarpa [western balsam poplar]
emb|CDX70255.1|  BnaA10g26040D                                          209   3e-62   
ref|XP_010269676.1|  PREDICTED: probable sugar phosphate/phosphat...    208   4e-62   Nelumbo nucifera [Indian lotus]
gb|KJB35994.1|  hypothetical protein B456_006G135900                    205   5e-62   Gossypium raimondii
emb|CDY64269.1|  BnaA07g36400D                                          209   6e-62   Brassica napus [oilseed rape]
ref|XP_006407587.1|  hypothetical protein EUTSA_v10021139mg             208   6e-62   Eutrema salsugineum [saltwater cress]
gb|KJB35992.1|  hypothetical protein B456_006G135900                    205   7e-62   Gossypium raimondii
ref|XP_007208479.1|  hypothetical protein PRUPE_ppa018496mg             207   1e-61   
gb|KHG15284.1|  hypothetical protein F383_18505                         207   1e-61   Gossypium arboreum [tree cotton]
gb|KJB35995.1|  hypothetical protein B456_006G135900                    205   1e-61   Gossypium raimondii
ref|XP_010468092.1|  PREDICTED: probable sugar phosphate/phosphat...    209   1e-61   
ref|XP_010036656.1|  PREDICTED: probable sugar phosphate/phosphat...    207   1e-61   Eucalyptus grandis [rose gum]
ref|XP_010558137.1|  PREDICTED: probable sugar phosphate/phosphat...    207   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_002284451.1|  PREDICTED: probable sugar phosphate/phosphat...    207   2e-61   Vitis vinifera
gb|KJB35993.1|  hypothetical protein B456_006G135900                    206   2e-61   Gossypium raimondii
gb|KJB35997.1|  hypothetical protein B456_006G135900                    207   2e-61   Gossypium raimondii
emb|CDY42695.1|  BnaA03g53480D                                          209   2e-61   Brassica napus [oilseed rape]
ref|XP_010543907.1|  PREDICTED: probable sugar phosphate/phosphat...    209   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_009147173.1|  PREDICTED: probable sugar phosphate/phosphat...    208   3e-61   Brassica rapa
ref|XP_011033181.1|  PREDICTED: probable sugar phosphate/phosphat...    206   3e-61   Populus euphratica
ref|XP_010482250.1|  PREDICTED: probable sugar phosphate/phosphat...    207   4e-61   Camelina sativa [gold-of-pleasure]
emb|CDY53550.1|  BnaA09g57090D                                          209   4e-61   Brassica napus [oilseed rape]
gb|KHG01518.1|  hypothetical protein F383_22132                         206   4e-61   Gossypium arboreum [tree cotton]
ref|XP_010486629.1|  PREDICTED: probable sugar phosphate/phosphat...    206   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006298080.1|  hypothetical protein CARUB_v10014124mg             206   6e-61   
ref|XP_009122632.1|  PREDICTED: probable sugar phosphate/phosphat...    206   6e-61   Brassica rapa
gb|ACJ85182.1|  unknown                                                 201   6e-61   Medicago truncatula
ref|NP_187640.1|  nucleotide-sugar transporter-like protein             207   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007162163.1|  hypothetical protein PHAVU_001G129500g             205   8e-61   Phaseolus vulgaris [French bean]
gb|ABO87609.1|  chloroplast phosphoenolpyruvate/phosphate translo...    206   8e-61   Pisum sativum [garden pea]
gb|KJB13074.1|  hypothetical protein B456_002G0553001                   201   1e-60   Gossypium raimondii
ref|XP_007162162.1|  hypothetical protein PHAVU_001G129500g             206   1e-60   Phaseolus vulgaris [French bean]
gb|KDP26087.1|  hypothetical protein JCGZ_21120                         205   1e-60   Jatropha curcas
gb|KEH20816.1|  nucleotide/sugar transporter family protein             204   1e-60   Medicago truncatula
ref|XP_011466504.1|  PREDICTED: probable sugar phosphate/phosphat...    205   1e-60   Fragaria vesca subsp. vesca
gb|KHN14956.1|  Putative sugar phosphate/phosphate translocator         204   1e-60   Glycine soja [wild soybean]
ref|XP_003521163.1|  PREDICTED: probable sugar phosphate/phosphat...    206   2e-60   Glycine max [soybeans]
ref|XP_012086213.1|  PREDICTED: probable sugar phosphate/phosphat...    205   2e-60   Jatropha curcas
ref|XP_003554164.2|  PREDICTED: probable sugar phosphate/phosphat...    205   4e-60   Glycine max [soybeans]
ref|XP_011467379.1|  PREDICTED: probable sugar phosphate/phosphat...    202   5e-60   Fragaria vesca subsp. vesca
ref|XP_004504088.1|  PREDICTED: probable sugar phosphate/phosphat...    204   6e-60   Cicer arietinum [garbanzo]
ref|XP_002884788.1|  hypothetical protein ARALYDRAFT_897204             202   8e-60   
ref|XP_010090204.1|  hypothetical protein L484_016542                   203   2e-59   
ref|XP_009123021.1|  PREDICTED: probable sugar phosphate/phosphat...    202   2e-59   Brassica rapa
ref|XP_008359558.1|  PREDICTED: probable sugar phosphate/phosphat...    201   2e-59   
ref|XP_009334293.1|  PREDICTED: probable sugar phosphate/phosphat...    201   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_004136668.1|  PREDICTED: probable sugar phosphate/phosphat...    201   4e-59   Cucumis sativus [cucumbers]
ref|XP_009370230.1|  PREDICTED: probable sugar phosphate/phosphat...    201   4e-59   Pyrus x bretschneideri [bai li]
ref|XP_008244265.1|  PREDICTED: probable sugar phosphate/phosphat...    201   4e-59   Prunus mume [ume]
ref|XP_008443328.1|  PREDICTED: probable sugar phosphate/phosphat...    200   6e-59   Cucumis melo [Oriental melon]
ref|XP_007202335.1|  hypothetical protein PRUPE_ppa008167mg             201   9e-59   
ref|XP_008392288.1|  PREDICTED: probable sugar phosphate/phosphat...    199   1e-58   
ref|XP_009363221.1|  PREDICTED: probable sugar phosphate/phosphat...    199   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_011075351.1|  PREDICTED: probable sugar phosphate/phosphat...    199   2e-58   Sesamum indicum [beniseed]
ref|XP_003556842.1|  PREDICTED: probable sugar phosphate/phosphat...    198   2e-58   Glycine max [soybeans]
gb|KHN31567.1|  Putative sugar phosphate/phosphate translocator         193   1e-57   Glycine soja [wild soybean]
gb|EYU18703.1|  hypothetical protein MIMGU_mgv1a010140mg                197   2e-57   Erythranthe guttata [common monkey flower]
gb|EPS74176.1|  hypothetical protein M569_00572                         196   3e-57   Genlisea aurea
ref|XP_011078917.1|  PREDICTED: probable sugar phosphate/phosphat...    195   7e-57   Sesamum indicum [beniseed]
gb|EEE58836.1|  hypothetical protein OsJ_10410                          195   7e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_012086214.1|  PREDICTED: probable sugar phosphate/phosphat...    197   1e-56   Jatropha curcas
gb|KJB17017.1|  hypothetical protein B456_002G260500                    193   3e-56   Gossypium raimondii
ref|XP_008388183.1|  PREDICTED: probable sugar phosphate/phosphat...    188   4e-56   
ref|XP_010101830.1|  putative sugar phosphate/phosphate translocator    192   6e-56   
ref|XP_008350510.1|  PREDICTED: probable sugar phosphate/phosphat...    192   6e-56   
ref|XP_003516328.2|  PREDICTED: probable sugar phosphate/phosphat...    190   5e-55   Glycine max [soybeans]
ref|XP_011027338.1|  PREDICTED: probable sugar phosphate/phosphat...    190   6e-55   Populus euphratica
ref|XP_006358002.1|  PREDICTED: probable sugar phosphate/phosphat...    190   6e-55   Solanum tuberosum [potatoes]
ref|XP_009800980.1|  PREDICTED: probable sugar phosphate/phosphat...    189   9e-55   Nicotiana sylvestris
ref|XP_003520937.2|  PREDICTED: probable sugar phosphate/phosphat...    189   1e-54   Glycine max [soybeans]
ref|XP_009358832.1|  PREDICTED: probable sugar phosphate/phosphat...    189   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_004236589.1|  PREDICTED: probable sugar phosphate/phosphat...    189   2e-54   Solanum lycopersicum
ref|XP_002308922.1|  phosphate translocator-related family protein      188   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_009618187.1|  PREDICTED: probable sugar phosphate/phosphat...    188   4e-54   Nicotiana tomentosiformis
ref|XP_006351244.1|  PREDICTED: probable sugar phosphate/phosphat...    187   6e-54   Solanum tuberosum [potatoes]
ref|XP_004506656.1|  PREDICTED: probable sugar phosphate/phosphat...    187   8e-54   Cicer arietinum [garbanzo]
ref|XP_010672894.1|  PREDICTED: probable sugar phosphate/phosphat...    187   1e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004249242.1|  PREDICTED: probable sugar phosphate/phosphat...    187   1e-53   Solanum lycopersicum
ref|XP_007133968.1|  hypothetical protein PHAVU_010G007700g             186   1e-53   Phaseolus vulgaris [French bean]
ref|XP_006351293.1|  PREDICTED: probable sugar phosphate/phosphat...    186   2e-53   Solanum tuberosum [potatoes]
ref|XP_004249243.1|  PREDICTED: probable sugar phosphate/phosphat...    186   2e-53   Solanum lycopersicum
ref|XP_003604786.1|  Solute carrier family 35 member E4                 184   2e-52   Medicago truncatula
ref|XP_009800954.1|  PREDICTED: probable sugar phosphate/phosphat...    184   2e-52   Nicotiana sylvestris
ref|XP_009597744.1|  PREDICTED: probable sugar phosphate/phosphat...    184   2e-52   Nicotiana tomentosiformis
gb|ABO36629.1|  putative phosphate/phosphoenolpyruate translocator      176   8e-52   Solanum lycopersicum
ref|XP_009602046.1|  PREDICTED: probable sugar phosphate/phosphat...    181   2e-51   Nicotiana tomentosiformis
emb|CDP14071.1|  unnamed protein product                                178   6e-51   Coffea canephora [robusta coffee]
ref|XP_009782845.1|  PREDICTED: probable sugar phosphate/phosphat...    179   9e-51   Nicotiana sylvestris
ref|XP_011628400.1|  PREDICTED: probable sugar phosphate/phosphat...    180   9e-51   Amborella trichopoda
ref|XP_011029117.1|  PREDICTED: probable sugar phosphate/phosphat...    180   2e-50   Populus euphratica
gb|ABR17102.1|  unknown                                                 176   5e-50   Picea sitchensis
ref|XP_002304449.1|  phosphate translocator-related family protein      179   5e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002298084.1|  phosphate translocator-related family protein      178   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010276035.1|  PREDICTED: probable sugar phosphate/phosphat...    177   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010277445.1|  PREDICTED: probable sugar phosphate/phosphat...    177   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002972899.1|  hypothetical protein SELMODRAFT_97927              175   9e-49   
ref|XP_011071157.1|  PREDICTED: probable sugar phosphate/phosphat...    175   1e-48   
ref|XP_012087057.1|  PREDICTED: probable sugar phosphate/phosphat...    175   1e-48   
ref|XP_008437170.1|  PREDICTED: probable sugar phosphate/phosphat...    174   2e-48   
ref|XP_002281623.1|  PREDICTED: probable sugar phosphate/phosphat...    174   2e-48   
ref|XP_002988030.1|  hypothetical protein SELMODRAFT_46394              173   2e-48   
ref|XP_009586880.1|  PREDICTED: probable sugar phosphate/phosphat...    174   3e-48   
ref|XP_009765831.1|  PREDICTED: probable sugar phosphate/phosphat...    174   3e-48   
ref|XP_004147560.1|  PREDICTED: probable sugar phosphate/phosphat...    174   3e-48   
ref|XP_004147959.1|  PREDICTED: probable sugar phosphate/phosphat...    174   3e-48   
ref|XP_008238724.1|  PREDICTED: probable sugar phosphate/phosphat...    174   3e-48   
ref|XP_002509649.1|  Triose phosphate/phosphate translocator, chl...    174   4e-48   
emb|CDP09851.1|  unnamed protein product                                173   4e-48   
ref|XP_010053382.1|  PREDICTED: probable sugar phosphate/phosphat...    174   4e-48   
emb|CDY71741.1|  BnaAnng38660D                                          171   4e-48   
ref|XP_008448938.1|  PREDICTED: probable sugar phosphate/phosphat...    173   8e-48   
ref|XP_006440461.1|  hypothetical protein CICLE_v10020804mg             173   8e-48   
ref|XP_006477327.1|  PREDICTED: probable sugar phosphate/phosphat...    173   8e-48   
ref|XP_007209287.1|  hypothetical protein PRUPE_ppa007625mg             173   8e-48   
ref|XP_004245685.1|  PREDICTED: probable sugar phosphate/phosphat...    172   9e-48   
ref|XP_009373331.1|  PREDICTED: probable sugar phosphate/phosphat...    172   1e-47   
gb|EYU39041.1|  hypothetical protein MIMGU_mgv1a009435mg                171   2e-47   
gb|EPS69476.1|  hypothetical protein M569_05286                         171   2e-47   
ref|XP_008342569.1|  PREDICTED: probable sugar phosphate/phosphat...    172   2e-47   
gb|EYU40535.1|  hypothetical protein MIMGU_mgv1a026879mg                171   3e-47   
gb|EYU26091.1|  hypothetical protein MIMGU_mgv1a022201mg                171   3e-47   
ref|XP_004515747.1|  PREDICTED: probable sugar phosphate/phosphat...    171   4e-47   
gb|AAV31223.1|  putative phosphoenolpyruvate translocator               167   4e-47   
ref|XP_006363706.1|  PREDICTED: probable sugar phosphate/phosphat...    171   5e-47   
gb|ACJ84470.1|  unknown                                                 167   1e-46   
ref|XP_010108082.1|  putative sugar phosphate/phosphate translocator    169   1e-46   
ref|XP_007040046.1|  Nucleotide-sugar transporter family protein        169   2e-46   
gb|KJB25692.1|  hypothetical protein B456_004G204500                    169   2e-46   
gb|KJB52002.1|  hypothetical protein B456_008G241700                    169   2e-46   
ref|XP_008348890.1|  PREDICTED: LOW QUALITY PROTEIN: probable sug...    169   3e-46   
ref|XP_011463793.1|  PREDICTED: probable sugar phosphate/phosphat...    169   3e-46   
ref|XP_010940918.1|  PREDICTED: probable sugar phosphate/phosphat...    169   4e-46   
ref|XP_003549895.1|  PREDICTED: probable sugar phosphate/phosphat...    168   4e-46   
gb|KHN04324.1|  Putative sugar phosphate/phosphate translocator         167   4e-46   
ref|XP_006600824.1|  PREDICTED: probable sugar phosphate/phosphat...    168   4e-46   
ref|XP_006600823.1|  PREDICTED: probable sugar phosphate/phosphat...    168   6e-46   
ref|XP_007155615.1|  hypothetical protein PHAVU_003G216800g             167   7e-46   
ref|XP_006579620.1|  PREDICTED: probable sugar phosphate/phosphat...    167   8e-46   
gb|AFK44180.1|  unknown                                                 167   9e-46   
gb|AES90976.2|  triose-phosphate transporter family protein             167   9e-46   
ref|XP_008777151.1|  PREDICTED: probable sugar phosphate/phosphat...    167   2e-45   
ref|NP_001054502.1|  Os05g0121900                                       166   2e-45   
ref|XP_003608779.1|  Solute carrier family 35 member E4                 167   4e-45   
ref|XP_010676622.1|  PREDICTED: probable sugar phosphate/phosphat...    165   7e-45   
ref|XP_010533735.1|  PREDICTED: probable sugar phosphate/phosphat...    165   1e-44   
ref|XP_004960337.1|  PREDICTED: probable sugar phosphate/phosphat...    163   3e-44   
gb|KHN21415.1|  Putative sugar phosphate/phosphate translocator         158   5e-44   
gb|EAZ26521.1|  hypothetical protein OsJ_10416                          160   8e-44   
ref|XP_010546126.1|  PREDICTED: probable sugar phosphate/phosphat...    162   9e-44   
ref|XP_010553485.1|  PREDICTED: probable sugar phosphate/phosphat...    162   1e-43   
ref|XP_002468051.1|  hypothetical protein SORBIDRAFT_01g038730          159   1e-43   
tpg|DAA44805.1|  TPA: hypothetical protein ZEAMMB73_316977              159   1e-43   
ref|XP_010553487.1|  PREDICTED: probable sugar phosphate/phosphat...    162   1e-43   
gb|KHN01795.1|  Putative sugar phosphate/phosphate translocator         159   2e-43   
gb|EMS65015.1|  hypothetical protein TRIUR3_16520                       159   2e-43   
gb|KHN06272.1|  Putative sugar phosphate/phosphate translocator         158   4e-43   
gb|KJB20779.1|  hypothetical protein B456_003G164600                    160   7e-43   
ref|XP_009393278.1|  PREDICTED: probable sugar phosphate/phosphat...    160   8e-43   
ref|XP_003074717.1|  Putative phosphate/phosphoenolpyru (ISS)           160   1e-42   
ref|XP_009110641.1|  PREDICTED: probable sugar phosphate/phosphat...    158   3e-42   
emb|CDY21054.1|  BnaA08g24710D                                          158   3e-42   
emb|CDY58615.1|  BnaCnng33430D                                          158   3e-42   
ref|XP_006593524.1|  PREDICTED: probable sugar phosphate/phosphat...    151   5e-42   
emb|CEF96935.1|  Triose-phosphate transporter domain                    157   6e-42   
emb|CBI29804.3|  unnamed protein product                                155   6e-42   
ref|NP_172712.1|  Nucleotide-sugar transporter family protein           157   6e-42   
ref|XP_010476222.1|  PREDICTED: probable sugar phosphate/phosphat...    157   7e-42   
ref|XP_010458677.1|  PREDICTED: probable sugar phosphate/phosphat...    157   7e-42   
ref|XP_006417227.1|  hypothetical protein EUTSA_v10008006mg             157   7e-42   
ref|XP_009148584.1|  PREDICTED: probable sugar phosphate/phosphat...    157   8e-42   
gb|KFK43518.1|  hypothetical protein AALP_AA1G135900                    157   8e-42   
ref|XP_011033853.1|  PREDICTED: probable sugar phosphate/phosphat...    157   1e-41   
ref|XP_006305183.1|  hypothetical protein CARUB_v10009549mg             157   1e-41   
ref|XP_010494243.1|  PREDICTED: probable sugar phosphate/phosphat...    157   1e-41   
ref|XP_002892692.1|  hypothetical protein ARALYDRAFT_471399             156   1e-41   
gb|KHN09780.1|  Putative sugar phosphate/phosphate translocator         156   2e-41   
ref|XP_002520444.1|  Glucose-6-phosphate/phosphate translocator 1...    154   2e-41   
ref|XP_002440506.1|  hypothetical protein SORBIDRAFT_09g002110          155   3e-41   
gb|KFK38422.1|  hypothetical protein AALP_AA3G111200                    152   6e-41   
ref|XP_003566652.2|  PREDICTED: probable sugar phosphate/phosphat...    154   7e-41   
ref|XP_001415705.1|  DMT family transporter: phosphate/phosphoeno...    154   7e-41   
ref|NP_001152642.1|  LOC100286283                                       152   3e-40   
ref|XP_009362817.1|  PREDICTED: LOW QUALITY PROTEIN: probable sug...    152   3e-40   
ref|XP_008355131.1|  PREDICTED: probable sugar phosphate/phosphat...    146   6e-40   
emb|CDY30085.1|  BnaC05g09350D                                          152   7e-40   
emb|CDX98058.1|  BnaA06g08090D                                          152   9e-40   
gb|KDD76392.1|  hypothetical protein H632_c243p2                        151   1e-39   
ref|XP_002532128.1|  Glucose-6-phosphate/phosphate translocator 1...    149   1e-39   
emb|CDP14149.1|  unnamed protein product                                147   4e-39   
emb|CDX80906.1|  BnaC03g01600D                                          148   5e-39   
ref|XP_003059842.1|  Drug/Metabolite transporter superfamily            149   5e-39   
ref|XP_005849769.1|  hypothetical protein CHLNCDRAFT_20807              149   8e-39   
gb|ACU22906.1|  unknown                                                 143   1e-38   
ref|XP_002947867.1|  plastidic phosphate translocator                   149   1e-38   
ref|XP_002504537.1|  Drug/Metabolite transporter superfamily            148   2e-38   
gb|KDP46566.1|  hypothetical protein JCGZ_08538                         145   2e-38   
dbj|BAJ86999.1|  predicted protein                                      147   3e-38   
gb|KIZ00002.1|  hypothetical protein MNEG_7959                          145   7e-37   
ref|XP_002530408.1|  Glucose-6-phosphate/phosphate translocator 1...    138   1e-35   
ref|XP_011400497.1|  putative sugar phosphate/phosphate translocator    140   2e-35   
gb|KJB76142.1|  hypothetical protein B456_012G074900                    137   3e-35   
ref|XP_001690779.1|  phosphate/phosphoenolpyruvate translocator         138   6e-35   
ref|XP_001700696.1|  plastidic phosphate translocator                   137   1e-34   
gb|AFK46393.1|  unknown                                                 128   5e-33   
ref|XP_002506979.1|  Drug/Metabolite transporter superfamily            132   9e-33   
ref|XP_005651763.1|  TPT-domain-containing protein                      132   2e-32   
ref|XP_007509045.1|  predicted protein                                  130   3e-32   
gb|AFK41713.1|  unknown                                                 127   2e-31   
gb|KJB35996.1|  hypothetical protein B456_006G135900                    127   3e-31   
emb|CDX94857.1|  BnaC03g43310D                                          118   4e-30   
gb|EEE62153.1|  hypothetical protein OsJ_16940                          125   5e-30   
ref|XP_005844215.1|  hypothetical protein CHLNCDRAFT_139419             125   5e-30   
gb|KHN22543.1|  Putative sugar phosphate/phosphate translocator         122   1e-29   
ref|XP_011078918.1|  PREDICTED: probable sugar phosphate/phosphat...    118   4e-28   
emb|CBI31547.3|  unnamed protein product                                116   2e-27   
emb|CDY00919.1|  BnaC05g42810D                                          109   2e-26   
gb|KJB52003.1|  hypothetical protein B456_008G241700                    108   4e-24   
ref|XP_006589933.1|  PREDICTED: glycine-rich cell wall structural...    100   5e-22   
ref|XP_001690486.1|  hypothetical protein CHLREDRAFT_99830              101   1e-21   
ref|XP_001752875.1|  predicted protein                                89.7    1e-17   
ref|XP_009393454.1|  PREDICTED: UDP-galactose transporter 1-like      89.4    2e-17   
ref|XP_003288434.1|  hypothetical protein DICPUDRAFT_92094            89.0    2e-17   
ref|XP_637234.1|  hypothetical protein DDB_G0287319                   89.0    3e-17   
ref|XP_009772301.1|  PREDICTED: GDP-mannose transporter GONST5-like   85.9    9e-17   
gb|ACJ84445.1|  unknown                                               85.5    1e-16   
ref|XP_008783358.1|  PREDICTED: UDP-galactose transporter 1           87.0    1e-16   
ref|XP_010675128.1|  PREDICTED: UDP-galactose transporter 1-like      86.7    2e-16   
gb|ACU18851.1|  unknown                                               85.9    2e-16   
ref|XP_008344929.1|  PREDICTED: GDP-mannose transporter GONST5        84.7    2e-16   
gb|KEH34825.1|  nucleotide/sugar transporter family protein           85.5    2e-16   
ref|XP_010910958.1|  PREDICTED: UDP-galactose transporter 1-like      86.3    2e-16   
emb|CDX68051.1|  BnaA07g20910D                                        86.3    2e-16   
ref|XP_006646721.1|  PREDICTED: UDP-galactose transporter 1-like      86.3    2e-16   
ref|XP_009104611.1|  PREDICTED: UDP-galactose transporter 1           86.3    3e-16   
ref|NP_001149814.1|  organic anion transporter                        85.9    3e-16   
dbj|GAM21406.1|  hypothetical protein SAMD00019534_045810             85.5    3e-16   
gb|ACJ84961.1|  unknown                                               85.1    3e-16   
ref|XP_001763288.1|  predicted protein                                85.9    4e-16   
ref|XP_006659027.1|  PREDICTED: UDP-galactose transporter 1-like      85.5    4e-16   
gb|KHN47026.1|  UDP-galactose transporter 1                           85.5    4e-16   
ref|NP_001240217.1|  uncharacterized protein LOC100778350             85.5    4e-16   
ref|XP_003523447.1|  PREDICTED: UDP-galactose transporter 1           85.5    4e-16   
ref|XP_011069543.1|  PREDICTED: UDP-galactose transporter 1           85.5    4e-16   
ref|NP_001060782.1|  Os08g0104900                                     85.5    5e-16   
gb|KDO80669.1|  hypothetical protein CISIN_1g019514mg                 83.6    5e-16   
ref|XP_012078227.1|  PREDICTED: UDP-galactose transporter 1 isofo...  85.5    5e-16   
gb|EPS60049.1|  hypothetical protein M569_14755                       85.1    5e-16   
ref|XP_011074852.1|  PREDICTED: UDP-galactose transporter 1           85.1    5e-16   
ref|XP_008667845.1|  PREDICTED: uncharacterized protein LOC100280...  85.1    5e-16   
ref|XP_002862808.1|  hypothetical protein ARALYDRAFT_497286           85.1    5e-16   
ref|NP_001241718.1|  uncharacterized protein LOC100856896             85.1    6e-16   
ref|XP_004959938.1|  PREDICTED: UDP-galactose transporter 1-like      85.1    6e-16   
ref|XP_005776133.1|  hypothetical protein EMIHUDRAFT_74327            84.7    6e-16   
gb|ABK28407.1|  unknown                                               85.1    6e-16   
ref|NP_173605.1|  golgi nucleotide sugar transporter 5                85.1    6e-16   
emb|CDX87511.1|  BnaA07g33620D                                        85.1    6e-16   
ref|XP_010539639.1|  PREDICTED: UDP-galactose transporter 1           85.1    6e-16   
ref|XP_009106414.1|  PREDICTED: UDP-galactose transporter 1-like      85.1    6e-16   
ref|XP_008799180.1|  PREDICTED: UDP-galactose transporter 1-like      85.1    7e-16   
ref|XP_002448835.1|  hypothetical protein SORBIDRAFT_06g034090        85.1    7e-16   
ref|XP_006472769.1|  PREDICTED: UDP-galactose transporter 1-like      84.7    7e-16   
ref|NP_001054364.1|  Os04g0692000                                     85.1    7e-16   
gb|AFK33713.1|  unknown                                               84.7    7e-16   
ref|XP_003601041.1|  Solute carrier family 35 member E3               84.7    8e-16   
ref|XP_004972429.1|  PREDICTED: UDP-galactose transporter 1-like      84.7    8e-16   
ref|NP_565158.1|  UDP-galactose transporter 1                         84.7    8e-16   
ref|XP_010544741.1|  PREDICTED: GDP-mannose transporter GONST5-like   84.7    8e-16   
ref|XP_004500551.1|  PREDICTED: UDP-galactose transporter 1-like      84.7    8e-16   
ref|XP_006305534.1|  hypothetical protein CARUB_v10010023mg           84.0    8e-16   
ref|XP_003580896.1|  PREDICTED: UDP-galactose transporter 1-like      84.7    9e-16   
gb|EPS73985.1|  hypothetical protein M569_00765                       84.3    9e-16   
ref|XP_006302518.1|  hypothetical protein CARUB_v10020616mg           84.7    9e-16   
dbj|BAJ89907.1|  predicted protein                                    84.7    9e-16   
ref|XP_010416714.1|  PREDICTED: UDP-galactose transporter 1           84.3    9e-16   
ref|XP_006390072.1|  hypothetical protein EUTSA_v10018828mg           84.3    9e-16   
emb|CDX79213.1|  BnaC06g20900D                                        84.3    1e-15   
ref|XP_005761152.1|  hypothetical protein EMIHUDRAFT_258161           82.4    1e-15   
emb|CDX88379.1|  BnaC06g38230D                                        84.3    1e-15   
ref|XP_008388228.1|  PREDICTED: UDP-galactose transporter 1           84.3    1e-15   
ref|XP_010477436.1|  PREDICTED: GDP-mannose transporter GONST5        84.3    1e-15   
ref|XP_002516337.1|  conserved hypothetical protein                   84.3    1e-15   
ref|XP_009363168.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-galactos...  84.3    1e-15   
ref|XP_002890469.1|  hypothetical protein ARALYDRAFT_313079           84.3    1e-15   
dbj|BAJ91187.1|  predicted protein                                    84.3    1e-15   
emb|CDY38825.1|  BnaC08g19990D                                        84.3    1e-15   
emb|CDX96572.1|  BnaA08g21150D                                        84.3    1e-15   
ref|XP_009110167.1|  PREDICTED: GDP-mannose transporter GONST5        84.0    1e-15   
ref|XP_003573266.1|  PREDICTED: UDP-galactose transporter 1           84.0    1e-15   
ref|XP_010063386.1|  PREDICTED: UDP-galactose transporter 1           84.0    2e-15   
ref|XP_002976365.1|  hypothetical protein SELMODRAFT_104803           83.6    2e-15   
ref|XP_002987207.1|  hypothetical protein SELMODRAFT_235194           83.6    2e-15   
gb|KHN25220.1|  UDP-galactose transporter 1                           84.0    2e-15   
ref|XP_003544685.1|  PREDICTED: UDP-galactose transporter 1-like      83.6    2e-15   
ref|XP_003542929.1|  PREDICTED: UDP-galactose transporter 1           83.6    2e-15   
ref|XP_006653081.1|  PREDICTED: UDP-galactose transporter 1-like      84.0    2e-15   
ref|XP_004498335.1|  PREDICTED: UDP-galactose transporter 1-like      83.6    2e-15   
gb|KDO80668.1|  hypothetical protein CISIN_1g019514mg                 82.8    2e-15   
gb|KFK42150.1|  hypothetical protein AALP_AA2G217800                  83.6    2e-15   
ref|XP_007137409.1|  hypothetical protein PHAVU_009G124700g           83.6    2e-15   
ref|XP_010471958.1|  PREDICTED: UDP-galactose transporter 1-like      83.2    2e-15   
gb|EYU22959.1|  hypothetical protein MIMGU_mgv1a009793mg              83.2    2e-15   
ref|XP_002443701.1|  hypothetical protein SORBIDRAFT_07g000570        83.6    2e-15   
ref|XP_006416256.1|  hypothetical protein EUTSA_v10009473mg           83.2    2e-15   
gb|KJB29220.1|  hypothetical protein B456_005G089900                  82.4    3e-15   
ref|XP_003589584.1|  Solute carrier family 35 member E3               83.2    3e-15   
ref|XP_010521241.1|  PREDICTED: UDP-galactose transporter 1           83.2    3e-15   
ref|XP_009404973.1|  PREDICTED: UDP-galactose transporter 1-like      83.2    3e-15   
ref|XP_011027544.1|  PREDICTED: UDP-galactose transporter 1           83.2    3e-15   
ref|XP_004142623.1|  PREDICTED: UDP-galactose transporter 1           83.2    3e-15   
ref|XP_008219654.1|  PREDICTED: UDP-galactose transporter 1           82.8    3e-15   
ref|XP_008444148.1|  PREDICTED: UDP-galactose transporter 1           82.8    4e-15   
ref|XP_007222472.1|  hypothetical protein PRUPE_ppa008225mg           82.8    4e-15   
gb|AFK42237.1|  unknown                                               82.8    4e-15   
ref|XP_006434182.1|  hypothetical protein CICLE_v10001739mg           82.8    4e-15   
ref|XP_010459907.1|  PREDICTED: GDP-mannose transporter GONST5-like   82.8    4e-15   
gb|KJB29219.1|  hypothetical protein B456_005G089900                  82.4    5e-15   



>gb|EYU19975.1| hypothetical protein MIMGU_mgv1a010541mg [Erythranthe guttata]
Length=309

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MSAMK+TGRFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA
Sbjct  1    MSAMKSTGRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAWMKMVPMQTIRSRVQFMKISALSL+FCASVVSGNISL+YLPVSFNQAIGATTPFFTAV
Sbjct  61   IAWMKMVPMQTIRSRVQFMKISALSLIFCASVVSGNISLKYLPVSFNQAIGATTPFFTAV  120

Query  693  FAYLMTFKREAWLTYV  740
            FAYLMTFKREAWLTYV
Sbjct  121  FAYLMTFKREAWLTYV  136



>ref|XP_010321446.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Solanum lycopersicum]
Length=309

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MSAMK++G+FFTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA
Sbjct  1    MSAMKSSGQFFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAWMKMVPMQTIRSRVQFMKISALSL+FC SVVSGNISLRYLPVSFNQAIGATTPFFTAV
Sbjct  61   IAWMKMVPMQTIRSRVQFMKISALSLIFCTSVVSGNISLRYLPVSFNQAIGATTPFFTAV  120

Query  693  FAYLMTFKREAWLTYV  740
            FAYLMTFKREAWLTYV
Sbjct  121  FAYLMTFKREAWLTYV  136



>ref|XP_009602684.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Nicotiana tomentosiformis]
Length=309

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MSAMK TG+FFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA
Sbjct  1    MSAMKTTGKFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAWMKMVPMQTIRSRVQF+KISALS +FCASVVSGNISLRYLPVSFNQAIGATTPFFTAV
Sbjct  61   IAWMKMVPMQTIRSRVQFLKISALSAIFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  120

Query  693  FAYLMTFKREAWLTYV  740
            FAYL+TFKREAWLTYV
Sbjct  121  FAYLITFKREAWLTYV  136



>ref|XP_006355671.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Solanum tuberosum]
Length=309

 Score =   268 bits (684),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MSAMK++G+FFTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA
Sbjct  1    MSAMKSSGQFFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAWMK+VPMQTIRSRVQFMKISALSL+FC SVVSGNISLRYLPVSFNQAIGATTPFFTAV
Sbjct  61   IAWMKIVPMQTIRSRVQFMKISALSLIFCTSVVSGNISLRYLPVSFNQAIGATTPFFTAV  120

Query  693  FAYLMTFKREAWLTYV  740
            FAYLMTFKREAWLTYV
Sbjct  121  FAYLMTFKREAWLTYV  136



>ref|XP_011084967.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Sesamum indicum]
Length=309

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS MK++GRFFTI LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA
Sbjct  1    MSVMKSSGRFFTIALVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAWMKMVPMQTIRSRVQFMKISALS +FCASVVSGNISL+YLPVSFNQAIGATTPFFTAV
Sbjct  61   IAWMKMVPMQTIRSRVQFMKISALSFIFCASVVSGNISLKYLPVSFNQAIGATTPFFTAV  120

Query  693  FAYLMTFKREAWLTYV  740
            FAYLMT KREAWLTYV
Sbjct  121  FAYLMTLKREAWLTYV  136



>ref|XP_011084965.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
isoform X1 [Sesamum indicum]
Length=316

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IDRPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  500
            I   MS MK++GRFFTI LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL
Sbjct  4    IHFKMSVMKSSGRFFTIALVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  63

Query  501  SYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPF  680
            SYIAIAWMKMVPMQTIRSRVQFMKISALS +FCASVVSGN+SL+YLPVSFNQAIGATTPF
Sbjct  64   SYIAIAWMKMVPMQTIRSRVQFMKISALSFIFCASVVSGNVSLKYLPVSFNQAIGATTPF  123

Query  681  FTAVFAYLMTFKREAWLTYV  740
            FTAVFAYLMT KREAWLTYV
Sbjct  124  FTAVFAYLMTLKREAWLTYV  143



>ref|XP_011084966.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
isoform X2 [Sesamum indicum]
Length=309

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS MK++GRFFTI LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA
Sbjct  1    MSVMKSSGRFFTIALVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAWMKMVPMQTIRSRVQFMKISALS +FCASVVSGN+SL+YLPVSFNQAIGATTPFFTAV
Sbjct  61   IAWMKMVPMQTIRSRVQFMKISALSFIFCASVVSGNVSLKYLPVSFNQAIGATTPFFTAV  120

Query  693  FAYLMTFKREAWLTYV  740
            FAYLMT KREAWLTYV
Sbjct  121  FAYLMTLKREAWLTYV  136



>ref|XP_009786378.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Nicotiana sylvestris]
Length=306

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/133 (95%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK TG+FFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTTGKFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KISALS +FCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKISALSAIFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMTFKREAWLTYV
Sbjct  121  LMTFKREAWLTYV  133



>ref|XP_009587505.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Nicotiana tomentosiformis]
 ref|XP_009772451.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Nicotiana sylvestris]
Length=309

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS MK +G+FFTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA
Sbjct  1    MSTMKNSGQFFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAWMKMVPMQTIRSRVQF+KISALSLVFC SVVSGNISLRYLPVSFNQAIGATTPFFTA+
Sbjct  61   IAWMKMVPMQTIRSRVQFLKISALSLVFCTSVVSGNISLRYLPVSFNQAIGATTPFFTAI  120

Query  693  FAYLMTFKREAWLTYV  740
            FAYLMT KREAWLTY+
Sbjct  121  FAYLMTLKREAWLTYI  136



>gb|EYU41247.1| hypothetical protein MIMGU_mgv1a010483mg [Erythranthe guttata]
Length=311

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MSAMK++GR FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM ACSLLSYIA
Sbjct  1    MSAMKSSGRLFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMMACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAW+KMVPMQTIRSRVQFMKISALSL+FCASVVSGNISL+YLPVSFNQAIGATTPFFTAV
Sbjct  61   IAWLKMVPMQTIRSRVQFMKISALSLIFCASVVSGNISLKYLPVSFNQAIGATTPFFTAV  120

Query  693  FAYLMTFKREAWLTY  737
            FAY MT K+EAWLTY
Sbjct  121  FAYFMTLKKEAWLTY  135



>dbj|BAD91177.1| plastidic phosphate translocator-like protein2 [Mesembryanthemum 
crystallinum]
Length=306

 Score =   262 bits (669),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK T RFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNTSRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KI+ALSL+FCASVVSGNISL+YLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFFKITALSLIFCASVVSGNISLKYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMTFKREAWLTYV
Sbjct  121  LMTFKREAWLTYV  133



>ref|XP_002279987.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Vitis vinifera]
 emb|CAN81426.1| hypothetical protein VITISV_014591 [Vitis vinifera]
Length=306

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK + RFFTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKNSSRFFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>ref|XP_010690286.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Beta vulgaris subsp. vulgaris]
Length=309

 Score =   259 bits (662),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK T RFFTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTTNRFFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KI+ALSL+FCASVVSGNISL+YLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFFKIAALSLIFCASVVSGNISLKYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            +MTFKREAWLTY
Sbjct  121  IMTFKREAWLTY  132



>gb|KJB74200.1| hypothetical protein B456_011G279000 [Gossypium raimondii]
Length=306

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KISALSLVFC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKISALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>ref|XP_010558089.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Tarenaya hassleriana]
 ref|XP_010558090.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Tarenaya hassleriana]
Length=308

 Score =   257 bits (656),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GRFFTIGLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MAANGRFFTIGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KISALSLVFC SVV GN+SLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFLKISALSLVFCVSVVFGNVSLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  123  LMTLKREAWLTYI  135



>gb|KHG28840.1| hypothetical protein F383_10338 [Gossypium arboreum]
Length=306

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   RFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KISALSLVFC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKISALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>emb|CDY01011.1| BnaC05g41890D [Brassica napus]
Length=308

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQT+RSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTVRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTYV  740
            L+T KREAWLTYV
Sbjct  123  LITLKREAWLTYV  135



>ref|XP_010256719.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Nelumbo nucifera]
Length=306

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MKA+ R+FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKASNRWFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQFMKI+ALSL+FCASVVSGNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFMKIAALSLIFCASVVSGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            +MT KREAW+TYV
Sbjct  121  IMTVKREAWITYV  133



>ref|NP_187740.2| probable sugar phosphate/phosphate translocator [Arabidopsis 
thaliana]
 sp|Q5XF09.1|PT311_ARATH RecName: Full=Probable sugar phosphate/phosphate translocator 
At3g11320 [Arabidopsis thaliana]
 gb|AAU94370.1| At3g11320 [Arabidopsis thaliana]
 dbj|BAE99847.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75029.1| probable sugar phosphate/phosphate translocator [Arabidopsis 
thaliana]
 gb|AFI41200.1| putative nucleotide-sugar transporter, partial [Arabidopsis thaliana]
Length=308

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            + A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    IAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            L+TFKREAWLTY
Sbjct  123  LITFKREAWLTY  134



>ref|XP_010494961.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Camelina sativa]
 ref|XP_010486783.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Camelina sativa]
Length=308

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            + A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    IAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            L+TFKREAWLTY
Sbjct  123  LITFKREAWLTY  134



>ref|XP_002884840.1| organic anion transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61099.1| organic anion transporter [Arabidopsis lyrata subsp. lyrata]
Length=308

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            + A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    IAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            L+TFKREAWLTY
Sbjct  123  LITFKREAWLTY  134



>ref|XP_009135159.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Brassica rapa]
Length=308

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GRFFTIG+VASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MAANGRFFTIGIVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTYV  740
            L+T K+EAWLTYV
Sbjct  123  LITLKKEAWLTYV  135



>ref|XP_004503221.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Cicer arietinum]
Length=404

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  324  DRPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLS  503
            D+  S MK + RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL S
Sbjct  93   DQKGSKMKGSSRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFS  152

Query  504  YIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFF  683
            Y+AIAWMK+VPMQTIRSRVQF KISALSL+FC SVV GNISLRYLPVSFNQAIGATTPFF
Sbjct  153  YVAIAWMKVVPMQTIRSRVQFFKISALSLIFCVSVVFGNISLRYLPVSFNQAIGATTPFF  212

Query  684  TAVFAYLMTFKREAWLTYV  740
            TA+FAY+MTFKREAWLTY+
Sbjct  213  TAIFAYIMTFKREAWLTYL  231



>emb|CDX73882.1| BnaA03g31650D [Brassica napus]
Length=306

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GRFFTIG+VASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MAANGRFFTIGIVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            L+T K+EAWLTYV
Sbjct  121  LITLKKEAWLTYV  133



>ref|XP_010552861.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Tarenaya hassleriana]
Length=308

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GRFFTIGLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MAANGRFFTIGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSR+QF+KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRLQFLKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            LMT KREAWLTY
Sbjct  123  LMTLKREAWLTY  134



>ref|XP_006407457.1| hypothetical protein EUTSA_v10021195mg [Eutrema salsugineum]
 gb|ESQ48910.1| hypothetical protein EUTSA_v10021195mg [Eutrema salsugineum]
Length=308

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFFKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTYV  740
            L+T KREAWLTY+
Sbjct  123  LITLKREAWLTYI  135



>ref|XP_010464838.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Camelina sativa]
Length=308

 Score =   254 bits (649),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            + A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    IAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            ++TFKREAWLTY
Sbjct  123  IITFKREAWLTY  134



>ref|XP_010543750.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Tarenaya hassleriana]
Length=308

 Score =   254 bits (648),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GR FTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  3    MAANGRLFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KIS LSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFLKISTLSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  123  LMTLKREAWLTYV  135



>ref|XP_006298193.1| hypothetical protein CARUB_v10014239mg [Capsella rubella]
 gb|EOA31091.1| hypothetical protein CARUB_v10014239mg [Capsella rubella]
Length=308

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            + A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    IAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFFKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTYV  740
            L+TFKREAWLTY+
Sbjct  123  LITFKREAWLTYL  135



>ref|XP_010262727.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Nelumbo nucifera]
Length=306

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   RFFTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AI+W
Sbjct  1    MKGLSRFFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAISW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVP+QTIRSRVQFMKI+ALSLVFC SVVSGN+SLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPLQTIRSRVQFMKIAALSLVFCGSVVSGNVSLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            +MT KREAW+TYV
Sbjct  121  IMTVKREAWITYV  133



>ref|XP_012088054.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Jatropha curcas]
 gb|KDP44838.1| hypothetical protein JCGZ_01338 [Jatropha curcas]
Length=306

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK T R FTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKTTSRLFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSR+QF+KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTA+FAY
Sbjct  61   MKMVPMQTIRSRLQFLKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAIFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>ref|XP_006378680.1| hypothetical protein POPTR_0010s20130g [Populus trichocarpa]
 gb|ERP56477.1| hypothetical protein POPTR_0010s20130g [Populus trichocarpa]
Length=264

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK+T RFFTIGLV+SWY SNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKSTSRFFTIGLVSSWYCSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+ QF+KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKTQFIKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>ref|XP_009766548.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Nicotiana sylvestris]
Length=306

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK +G+FFTI LVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SYIAIAW
Sbjct  1    MKTSGKFFTIALVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MK+VPMQT+RSRVQFMKISALSLVFC SVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKIVPMQTMRSRVQFMKISALSLVFCGSVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            LMT +RE+WLTY
Sbjct  121  LMTMRRESWLTY  132



>gb|AAG50965.1|AC073395_7 integral membrane protein, putative; 85705-84183 [Arabidopsis 
thaliana]
Length=344

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            + A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    IAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            L+TFKREAWLTY
Sbjct  123  LITFKREAWLTY  134



>ref|XP_010093497.1| putative sugar phosphate/phosphate translocator [Morus notabilis]
 gb|EXB54150.1| putative sugar phosphate/phosphate translocator [Morus notabilis]
Length=428

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 131/140 (94%), Gaps = 1/140 (1%)
 Frame = +3

Query  324  DRPMSA-MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  500
            DR ++  MK++ R FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL
Sbjct  116  DRDLTVKMKSSSRLFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  175

Query  501  SYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPF  680
            SYIAIAWMKMVPMQTIRSRVQF+KISALS VFC SVV GNISLRYLPVSFNQAIGATTPF
Sbjct  176  SYIAIAWMKMVPMQTIRSRVQFLKISALSFVFCISVVFGNISLRYLPVSFNQAIGATTPF  235

Query  681  FTAVFAYLMTFKREAWLTYV  740
            FTAVFAYLMT KREAWLTYV
Sbjct  236  FTAVFAYLMTLKREAWLTYV  255



>ref|XP_002316239.1| phosphate translocator-related family protein [Populus trichocarpa]
 gb|EEF02410.1| phosphate translocator-related family protein [Populus trichocarpa]
Length=306

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK+T RFFTIGLV+SWY SNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKSTSRFFTIGLVSSWYCSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+ QF+KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKTQFIKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>ref|XP_007009112.1| Nucleotide-sugar transporter family protein [Theobroma cacao]
 gb|EOY17922.1| Nucleotide-sugar transporter family protein [Theobroma cacao]
Length=306

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   +FFTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNQSKFFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMTFKREAWLTY+
Sbjct  121  LMTFKREAWLTYL  133



>gb|KFK38518.1| hypothetical protein AALP_AA3G123800 [Arabis alpina]
Length=308

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQ +KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   MKMVPMQTIRSRVQLLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            L+T KREAWLTY
Sbjct  123  LITLKREAWLTY  134



>emb|CDY00731.1| BnaC03g37150D [Brassica napus]
Length=306

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A GR FTIG+VASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MAANGRLFTIGIVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            L+T K+EAWLTYV
Sbjct  121  LITLKKEAWLTYV  133



>emb|CDY08536.1| BnaA05g27720D [Brassica napus]
Length=310

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  339  AMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIA  518
            A    GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIA
Sbjct  4    AAAGNGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIA  63

Query  519  WMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFA  698
            WMKMVPMQT+RSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFA
Sbjct  64   WMKMVPMQTVRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFA  123

Query  699  YLMTFKREAWLTYV  740
            YL+T KREAWLTYV
Sbjct  124  YLITMKREAWLTYV  137



>ref|XP_009416272.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Musa acuminata subsp. malaccensis]
Length=315

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            +S   A GRFFT+GLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY A
Sbjct  7    LSTALANGRFFTVGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYAA  66

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAW+K+VPMQ++RSRVQF+KISALSLVFCASVVSGNISLRYLPVSFNQA+GATTPFFTAV
Sbjct  67   IAWLKLVPMQSVRSRVQFLKISALSLVFCASVVSGNISLRYLPVSFNQAVGATTPFFTAV  126

Query  693  FAYLMTFKREAWLTYV  740
            FAYLMT +RE+W+TY+
Sbjct  127  FAYLMTLRRESWITYI  142



>ref|XP_007163501.1| hypothetical protein PHAVU_001G239500g [Phaseolus vulgaris]
 gb|ESW35495.1| hypothetical protein PHAVU_001G239500g [Phaseolus vulgaris]
Length=306

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK + RFFTIGLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKGSNRFFTIGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MK+VP+QTIRSRVQF KISALSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKVVPLQTIRSRVQFFKISALSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            L+TFKREAWLTY+
Sbjct  121  LITFKREAWLTYL  133



>gb|KJB60714.1| hypothetical protein B456_009G321700 [Gossypium raimondii]
Length=259

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK T + FTIGLVASWYS+NIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNTSKLFTIGLVASWYSTNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTA+FAY
Sbjct  61   MKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAIFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>gb|KJB78804.1| hypothetical protein B456_013G019900 [Gossypium raimondii]
Length=182

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FT GLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSKLFTFGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+VQF+KISALSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKVQFLKISALSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYI  133



>ref|XP_006399041.1| hypothetical protein EUTSA_v10014183mg [Eutrema salsugineum]
 gb|ESQ40494.1| hypothetical protein EUTSA_v10014183mg [Eutrema salsugineum]
Length=308

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MATNGRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   LKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  123  LMTLKREAWLTYL  135



>gb|KJB60712.1| hypothetical protein B456_009G321700 [Gossypium raimondii]
Length=306

 Score =   251 bits (642),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK T + FTIGLVASWYS+NIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNTSKLFTIGLVASWYSTNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTA+FAY
Sbjct  61   MKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAIFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>ref|XP_010423420.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g05820 
[Camelina sativa]
 ref|XP_010491127.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g05820 
[Camelina sativa]
Length=308

 Score =   251 bits (642),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MATNGRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   LKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            LMT KREAWLTY
Sbjct  123  LMTLKREAWLTY  134



>gb|KHG06744.1| hypothetical protein F383_33861 [Gossypium arboreum]
Length=306

 Score =   251 bits (642),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK T + FTIGLVASWYS+NIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNTSKLFTIGLVASWYSTNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTA+FAY
Sbjct  61   MKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAIFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>ref|XP_008463202.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Cucumis melo]
 ref|XP_011654981.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Cucumis sativus]
 gb|KGN50625.1| hypothetical protein Csa_5G198150 [Cucumis sativus]
Length=306

 Score =   251 bits (642),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK + RFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKGSSRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSR+QF+KI+ALS VFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   LKMVPMQTIRSRIQFLKIAALSFVFCISVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTMKREAWLTYV  133



>ref|XP_010067486.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Eucalyptus grandis]
 gb|KCW65629.1| hypothetical protein EUGRSUZ_G03021 [Eucalyptus grandis]
Length=307

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK T RFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKPTSRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQ +KI+ALSLVFC SVV GN+SLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQLLKITALSLVFCVSVVFGNVSLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            L+T KREAWLTY+
Sbjct  121  LITLKREAWLTYL  133



>ref|XP_010452490.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g05820 
[Camelina sativa]
Length=308

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MATNGRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   LKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            LMT KREAWLTY
Sbjct  123  LMTLKREAWLTY  134



>gb|KJB78805.1| hypothetical protein B456_013G019900 [Gossypium raimondii]
Length=259

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FT GLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSKLFTFGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+VQF+KISALSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKVQFLKISALSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYI  133



>ref|XP_009351076.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Pyrus x bretschneideri]
Length=307

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   R FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKGKSRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
             MT KREAWLTY+
Sbjct  121  FMTLKREAWLTYL  133



>ref|XP_007218734.1| hypothetical protein PRUPE_ppa009115mg [Prunus persica]
 ref|XP_008233705.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Prunus mume]
 ref|XP_008233706.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Prunus mume]
 gb|EMJ19933.1| hypothetical protein PRUPE_ppa009115mg [Prunus persica]
Length=306

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   R FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKGKSRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKITALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
             MT KREAWLTY+
Sbjct  121  FMTLKREAWLTYL  133



>ref|XP_008392901.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Malus domestica]
 ref|XP_008360779.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Malus domestica]
Length=307

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   R FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKGKSRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKITALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
             MT KREAWLTY+
Sbjct  121  FMTLKREAWLTYL  133



>ref|XP_009146737.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Brassica rapa]
Length=313

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
              GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW+K
Sbjct  10   GNGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAWLK  69

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            MVPMQT+RSRVQF+KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAYL+
Sbjct  70   MVPMQTVRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAYLI  129

Query  708  TFKREAWLTYV  740
            T KREAWLTYV
Sbjct  130  TMKREAWLTYV  140



>ref|XP_011469879.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Fragaria vesca subsp. vesca]
Length=306

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   R FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKGKSRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF+KI+ALSLVFC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFLKITALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
             MT KREAWLTY+
Sbjct  121  FMTLKREAWLTYL  133



>ref|XP_002873225.1| hypothetical protein ARALYDRAFT_487383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49484.1| hypothetical protein ARALYDRAFT_487383 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MATNGRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   LKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            LMT K+EAWLTY
Sbjct  121  LMTLKKEAWLTY  132



>emb|CDX70125.1| BnaA10g24740D [Brassica napus]
Length=306

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFT+G+VASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MATNGRFFTMGIVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF+KISALSLVFC SVV GN+SLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   LKMVPMQTIRSRVQFLKISALSLVFCVSVVFGNVSLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            +MT KREAWLTY
Sbjct  121  VMTLKREAWLTY  132



>emb|CDX98868.1| BnaC09g49670D [Brassica napus]
Length=306

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFT+G+VASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MATNGRFFTMGIVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF+KISALSLVFC SVV GN+SLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   LKMVPMQTIRSRVQFLKISALSLVFCVSVVFGNVSLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            +MT KREAWLTY
Sbjct  121  VMTLKREAWLTY  132



>gb|KHG27157.1| hypothetical protein F383_03045 [Gossypium arboreum]
Length=306

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FT GLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSKLFTFGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+VQF+KISALSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKVQFLKISALSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYI  133



>gb|KJB78803.1| hypothetical protein B456_013G019900 [Gossypium raimondii]
Length=306

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FT GLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSKLFTFGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+VQF+KISALSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKVQFLKISALSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYI  133



>gb|KJB60713.1| hypothetical protein B456_009G321700 [Gossypium raimondii]
Length=222

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK T + FTIGLVASWYS+NIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNTSKLFTIGLVASWYSTNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTA+FAY
Sbjct  61   MKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAIFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>ref|XP_011036021.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Populus euphratica]
Length=306

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK++ R FTIGLV+SWY SNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKSSSRLFTIGLVSSWYCSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+ QF+KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKTQFIKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>ref|XP_006288294.1| hypothetical protein CARUB_v10001537mg [Capsella rubella]
 gb|EOA21192.1| hypothetical protein CARUB_v10001537mg [Capsella rubella]
Length=308

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MATNGRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVP+QTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   LKMVPIQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            LMT KREAWLTY
Sbjct  123  LMTLKREAWLTY  134



>ref|NP_196201.2| nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 sp|Q6DBP3.1|PT505_ARATH RecName: Full=Probable sugar phosphate/phosphate translocator 
At5g05820 [Arabidopsis thaliana]
 gb|AAT70430.1| At5g05820 [Arabidopsis thaliana]
 gb|AAU45213.1| At5g05820 [Arabidopsis thaliana]
 gb|AED90929.1| nucleotide-sugar transporter family protein [Arabidopsis thaliana]
Length=309

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MATNGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   LKMVPMQTIRSRVQFFKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            LMT K+EAWLTY
Sbjct  123  LMTRKKEAWLTY  134



>ref|XP_007163500.1| hypothetical protein PHAVU_001G239500g [Phaseolus vulgaris]
 gb|ESW35494.1| hypothetical protein PHAVU_001G239500g [Phaseolus vulgaris]
Length=401

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            ++ MK + RFFTIGLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+A
Sbjct  93   INRMKGSNRFFTIGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVA  152

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAWMK+VP+QTIRSRVQF KISALSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAV
Sbjct  153  IAWMKVVPLQTIRSRVQFFKISALSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAV  212

Query  693  FAYLMTFKREAWLTYV  740
            FAYL+TFKREAWLTY+
Sbjct  213  FAYLITFKREAWLTYL  228



>dbj|BAB09676.1| phosphate/phosphoenolpyruvate translocator protein-like [Arabidopsis 
thaliana]
Length=307

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MATNGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF KI+ALSLVFC SVV GNISLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  61   LKMVPMQTIRSRVQFFKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            LMT K+EAWLTY
Sbjct  121  LMTRKKEAWLTY  132



>ref|XP_010685639.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Beta vulgaris subsp. vulgaris]
Length=306

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK TG+ FT+GL+  WYSSNIGV+LLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTTGKLFTVGLITFWYSSNIGVILLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQTIRSRVQF KI+ALS +FCASVVSGNISLRYLPVSFNQA+GATTPFFTA+FAY
Sbjct  61   LKIVPMQTIRSRVQFAKIAALSAIFCASVVSGNISLRYLPVSFNQAVGATTPFFTAIFAY  120

Query  702  LMTFKREAWLTYV  740
            LMTFKRE WLTYV
Sbjct  121  LMTFKREGWLTYV  133



>ref|XP_003544134.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Glycine max]
Length=306

 Score =   249 bits (635),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK++ R FTIGLV++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAW
Sbjct  1    MKSSSRLFTIGLVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSR+QF+KI+ALSLVFC SVV GN+SLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   LKMVPMQTIRSRLQFLKIAALSLVFCVSVVFGNVSLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            +MTFKREAWLTY+
Sbjct  121  IMTFKREAWLTYL  133



>ref|XP_009122182.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Brassica rapa]
Length=308

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GRFFT+G+ ASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  3    MATNGRFFTMGIAASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSRVQF+KISALSLVFC SVV GN+SLR+LPVSFNQAIGATTPFFTAVFAY
Sbjct  63   LKMVPMQTIRSRVQFLKISALSLVFCVSVVFGNVSLRFLPVSFNQAIGATTPFFTAVFAY  122

Query  702  LMTFKREAWLTY  737
            +MT KREAWLTY
Sbjct  123  VMTLKREAWLTY  134



>ref|XP_011039452.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Populus euphratica]
Length=306

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK+T R FTI LVASWY SNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKSTSRLFTISLVASWYCSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+ QF+KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKTQFLKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            LMT KREAWLTY
Sbjct  121  LMTLKREAWLTY  132



>ref|XP_008441429.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Cucumis melo]
Length=401

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  330  PMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI  509
            P   MK T RFFTIGLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI
Sbjct  90   PPPKMKGTNRFFTIGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI  149

Query  510  AIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTA  689
            AIAW+K+VP+QTIRSRVQF KISALS +FC SVV GNISLRYLPVSFNQAIGATTPFFTA
Sbjct  150  AIAWLKLVPLQTIRSRVQFFKISALSFIFCISVVFGNISLRYLPVSFNQAIGATTPFFTA  209

Query  690  VFAYLMTFKREAWLTYV  740
            VFAYLMT KREAWLTYV
Sbjct  210  VFAYLMTLKREAWLTYV  226



>ref|XP_004138435.2| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Cucumis sativus]
Length=401

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  330  PMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI  509
            P   MK T RFFTIGLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI
Sbjct  90   PPPKMKGTSRFFTIGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI  149

Query  510  AIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTA  689
            AIAW+K+VP+QTIRSRVQF KISALS +FC SVV GNISLRYLPVSFNQAIGATTPFFTA
Sbjct  150  AIAWLKLVPLQTIRSRVQFFKISALSFIFCISVVFGNISLRYLPVSFNQAIGATTPFFTA  209

Query  690  VFAYLMTFKREAWLTYV  740
            VFAYLMT KREAWLTYV
Sbjct  210  VFAYLMTLKREAWLTYV  226



>gb|KHG03209.1| hypothetical protein F383_26828 [Gossypium arboreum]
Length=197

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FTIGLV +WYSSNIGVLLLNKYLLSNYGF+YPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSKLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFRYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>ref|XP_002311199.1| phosphate translocator-related family protein [Populus trichocarpa]
 gb|EEE88566.1| phosphate translocator-related family protein [Populus trichocarpa]
Length=306

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK+T RFFTI LVASWY SNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW
Sbjct  1    MKSTSRFFTISLVASWYCSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+ QF+KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKTQFLKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            LM  KREAWLTY
Sbjct  121  LMILKREAWLTY  132



>gb|KGN45768.1| hypothetical protein Csa_6G009470 [Cucumis sativus]
Length=419

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  330  PMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI  509
            P   MK T RFFTIGLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI
Sbjct  108  PPPKMKGTSRFFTIGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI  167

Query  510  AIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTA  689
            AIAW+K+VP+QTIRSRVQF KISALS +FC SVV GNISLRYLPVSFNQAIGATTPFFTA
Sbjct  168  AIAWLKLVPLQTIRSRVQFFKISALSFIFCISVVFGNISLRYLPVSFNQAIGATTPFFTA  227

Query  690  VFAYLMTFKREAWLTYV  740
            VFAYLMT KREAWLTYV
Sbjct  228  VFAYLMTLKREAWLTYV  244



>ref|XP_008792285.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Phoenix dactylifera]
Length=315

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            ATGR FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW+K
Sbjct  12   ATGRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAWLK  71

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VPMQT+RSRVQF+KISALSLVFC SVVSGNISLR+LPVSFNQA+GATTPFFTAVFAY+M
Sbjct  72   LVPMQTVRSRVQFLKISALSLVFCGSVVSGNISLRFLPVSFNQAVGATTPFFTAVFAYVM  131

Query  708  TFKREAWLTYV  740
            T +REAW+TY+
Sbjct  132  TVRREAWITYL  142



>ref|XP_010922503.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Elaeis guineensis]
Length=317

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  324  DRPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLS  503
            + P  A   TGR FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLS
Sbjct  6    NSPPPAPLMTGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLS  65

Query  504  YIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFF  683
            Y+AIAW+K+VPMQT+RSR+QF+KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFF
Sbjct  66   YVAIAWLKLVPMQTVRSRIQFLKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFF  125

Query  684  TAVFAYLMTFKREAWLTYV  740
            TAVFAY+MT +REAW+TY+
Sbjct  126  TAVFAYIMTVRREAWITYI  144



>gb|KJB76143.1| hypothetical protein B456_012G074900 [Gossypium raimondii]
Length=306

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSKLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRS+VQF KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSKVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>ref|XP_010907522.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Elaeis guineensis]
Length=318

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  339  AMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIA  518
            A+ ATGR FT+GLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM +CSLLSY AIA
Sbjct  12   ALLATGRLFTLGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMASCSLLSYAAIA  71

Query  519  WMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFA  698
            W+K+VPMQT+RSRVQF+KISALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFA
Sbjct  72   WLKLVPMQTVRSRVQFLKISALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFA  131

Query  699  YLMTFKREAWLTYV  740
            Y+MT +REAW+TY+
Sbjct  132  YIMTVRREAWITYL  145



>gb|KDO69266.1| hypothetical protein CISIN_1g021864mg [Citrus sinensis]
Length=263

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK++ + FT GLVA+WYSSNIGVLLLNKYLLSNYGF+YPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKSSSKLFTFGLVAAWYSSNIGVLLLNKYLLSNYGFRYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSR+QF+KISALS VFC SVV GN+SLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRLQFLKISALSFVFCISVVFGNVSLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>ref|XP_009344409.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Pyrus x bretschneideri]
Length=408

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  324  DR-PMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  500
            DR P   MK   R FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL
Sbjct  95   DRDPPRKMKGKSRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  154

Query  501  SYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPF  680
            SY+AIAWMKMVPMQTIRSRVQF+KI ALSLVFC SVV GNISLRYLPVSFNQAIGATTPF
Sbjct  155  SYVAIAWMKMVPMQTIRSRVQFLKIMALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPF  214

Query  681  FTAVFAYLMTFKREAWLTYV  740
            FTAVFAYLMT K+EAWLTY+
Sbjct  215  FTAVFAYLMTLKKEAWLTYL  234



>ref|XP_009402357.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Musa acuminata subsp. malaccensis]
Length=315

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            +S   ATGRFFTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+A
Sbjct  7    LSPALATGRFFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVA  66

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAW+K+VPMQ IRSR+QF+KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAV
Sbjct  67   IAWLKLVPMQAIRSRLQFLKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAV  126

Query  693  FAYLMTFKREAWLTYV  740
             AYLMT +RE+W+TY+
Sbjct  127  LAYLMTLRRESWITYI  142



>ref|XP_008381890.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
isoform X2 [Malus domestica]
Length=408

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  324  DR-PMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  500
            DR P   MK   R FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL
Sbjct  95   DRDPPRKMKGKSRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  154

Query  501  SYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPF  680
            SY+AIAWMKMVPMQTIRSRVQF+KI ALSLVFC SVV GNISLRYLPVSFNQAIGATTPF
Sbjct  155  SYVAIAWMKMVPMQTIRSRVQFLKIMALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPF  214

Query  681  FTAVFAYLMTFKREAWLTYV  740
            FTAVFAYLMT K+EAWLTY+
Sbjct  215  FTAVFAYLMTLKKEAWLTYL  234



>gb|KHG03208.1| hypothetical protein F383_26828 [Gossypium arboreum]
Length=317

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FTIGLV +WYSSNIGVLLLNKYLLSNYGF+YPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKTNSKLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFRYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KISALSLVFC SVV GNISLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFFKISALSLVFCVSVVFGNISLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTLKREAWLTYL  133



>ref|XP_008381883.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
isoform X1 [Malus domestica]
Length=409

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  324  DR-PMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  500
            DR P   MK   R FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL
Sbjct  96   DRDPPRKMKGKSRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLL  155

Query  501  SYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPF  680
            SY+AIAWMKMVPMQTIRSRVQF+KI ALSLVFC SVV GNISLRYLPVSFNQAIGATTPF
Sbjct  156  SYVAIAWMKMVPMQTIRSRVQFLKIMALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPF  215

Query  681  FTAVFAYLMTFKREAWLTYV  740
            FTAVFAYLMT K+EAWLTY+
Sbjct  216  FTAVFAYLMTLKKEAWLTYL  235



>gb|KDO69265.1| hypothetical protein CISIN_1g021864mg [Citrus sinensis]
Length=306

 Score =   246 bits (629),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK++ + FT GLVA+WYSSNIGVLLLNKYLLSNYGF+YPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKSSSKLFTFGLVAAWYSSNIGVLLLNKYLLSNYGFRYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSR+QF+KISALS VFC SVV GN+SLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRLQFLKISALSFVFCISVVFGNVSLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>ref|XP_009406945.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Musa acuminata subsp. malaccensis]
Length=315

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            +S   ATGRFFT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+A
Sbjct  7    LSPALATGRFFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVA  66

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAW+K+VPMQ IRSRVQ  KI+ LSLVFC SVVSGNISLRYLPVSFNQAIGATTPFFTAV
Sbjct  67   IAWLKVVPMQAIRSRVQLFKIATLSLVFCGSVVSGNISLRYLPVSFNQAIGATTPFFTAV  126

Query  693  FAYLMTFKREAWLTYV  740
            FAYLMT +RE+WLTY+
Sbjct  127  FAYLMTLRRESWLTYI  142



>ref|XP_003552587.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Glycine max]
 gb|KHN07634.1| Putative sugar phosphate/phosphate translocator [Glycine soja]
Length=307

 Score =   246 bits (629),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            +  RFFT+ LVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAWMK
Sbjct  4    SNNRFFTVALVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAWMK  63

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VP+Q+IRSRVQF KISALSLVFC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAYLM
Sbjct  64   VVPLQSIRSRVQFFKISALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  123

Query  708  TFKREAWLTYV  740
            TFKREAWLTY+
Sbjct  124  TFKREAWLTYL  134



>ref|XP_009612002.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Nicotiana tomentosiformis]
Length=304

 Score =   246 bits (629),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK +G+FFTI LVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMT CSL SYIAIA 
Sbjct  1    MKTSGKFFTIALVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTTCSLFSYIAIAL  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MK+VPMQTIR RVQFMKISALSLVFC SVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   MKIVPMQTIRFRVQFMKISALSLVFCGSVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            LMT +RE+WLTY
Sbjct  121  LMTLRRESWLTY  132



>gb|KJB67541.1| hypothetical protein B456_010G199400 [Gossypium raimondii]
Length=294

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FTIGLV++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNQSKMFTIGLVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KI+ LSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFFKITTLSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KRE WLTY+
Sbjct  121  LMTLKREGWLTYI  133



>gb|KJB67542.1| hypothetical protein B456_010G199400 [Gossypium raimondii]
Length=265

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FTIGLV++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNQSKMFTIGLVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KI+ LSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFFKITTLSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KRE WLTY+
Sbjct  121  LMTLKREGWLTYI  133



>gb|KHG07850.1| hypothetical protein F383_12851 [Gossypium arboreum]
 gb|KJB67540.1| hypothetical protein B456_010G199400 [Gossypium raimondii]
Length=306

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   + FTIGLV++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKNQSKMFTIGLVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSRVQF KI+ LSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRVQFFKITTLSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KRE WLTY+
Sbjct  121  LMTLKREGWLTYI  133



>ref|XP_006435562.1| hypothetical protein CICLE_v10032214mg [Citrus clementina]
 gb|ESR48802.1| hypothetical protein CICLE_v10032214mg [Citrus clementina]
Length=263

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK++ + FT GLVA+WYSSNIGVLLLNKYLLSNYGF+YPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKSSSKLFTFGLVAAWYSSNIGVLLLNKYLLSNYGFRYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSR QF+KISALS VFC SVV GN+SLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRHQFLKISALSFVFCISVVFGNVSLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>gb|ACU24623.1| unknown [Glycine max]
Length=307

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            +  RFFT+GLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAWMK
Sbjct  4    SNNRFFTVGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAWMK  63

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VP+QT+RS+VQF KISALSLVFC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAYLM
Sbjct  64   VVPLQTLRSKVQFFKISALSLVFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  123

Query  708  TFKREAWLTYV  740
            TFKREAWLTY+
Sbjct  124  TFKREAWLTYL  134



>ref|XP_006843236.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Amborella trichopoda]
 gb|ERN04911.1| hypothetical protein AMTR_s00080p00074790 [Amborella trichopoda]
Length=315

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  324  DRPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLS  503
              P+   K + + FT+GLV +WYSSNIGVLLLNKYLLSNYGF++PIFLTMCHMTACSLLS
Sbjct  4    QNPLQPGKPSSKMFTLGLVGAWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMTACSLLS  63

Query  504  YIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFF  683
            Y+AIAWMK+VPMQTIRSR+QF+KI+ALS +FCASVVSGN+SLRYLPVSFNQAIGATTPFF
Sbjct  64   YVAIAWMKIVPMQTIRSRIQFVKIAALSAIFCASVVSGNVSLRYLPVSFNQAIGATTPFF  123

Query  684  TAVFAYLMTFKREAWLTYV  740
            TAVFAY+MT KREAWLTYV
Sbjct  124  TAVFAYIMTVKREAWLTYV  142



>ref|XP_006591369.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
isoform X2 [Glycine max]
Length=408

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +3

Query  318  RIDRPMSAMKATG-RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  494
            +I   +  MK +  RFFT+GLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS
Sbjct  94   QISEGLKKMKGSNNRFFTVGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  153

Query  495  LLSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATT  674
            L SY+AIAWMK+VP+QT+RS+VQF KISALSLVFC SVV GNISLRYLPVSFNQAIGATT
Sbjct  154  LFSYVAIAWMKVVPLQTLRSKVQFFKISALSLVFCVSVVFGNISLRYLPVSFNQAIGATT  213

Query  675  PFFTAVFAYLMTFKREAWLTYV  740
            PFFTAVFAYLMTFKREAWLTY+
Sbjct  214  PFFTAVFAYLMTFKREAWLTYL  235



>gb|KHN17860.1| Putative sugar phosphate/phosphate translocator [Glycine soja]
Length=408

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +3

Query  318  RIDRPMSAMKATG-RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  494
            +I   +  MK +  RFFT+GLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS
Sbjct  94   QISEGLKKMKGSNNRFFTVGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  153

Query  495  LLSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATT  674
            L SY+AIAWMK+VP+QT+RS+VQF KISALSLVFC SVV GNISLRYLPVSFNQAIGATT
Sbjct  154  LFSYVAIAWMKVVPLQTLRSKVQFFKISALSLVFCVSVVFGNISLRYLPVSFNQAIGATT  213

Query  675  PFFTAVFAYLMTFKREAWLTYV  740
            PFFTAVFAYLMTFKREAWLTY+
Sbjct  214  PFFTAVFAYLMTFKREAWLTYL  235



>ref|XP_006435561.1| hypothetical protein CICLE_v10032214mg [Citrus clementina]
 ref|XP_006486458.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Citrus sinensis]
 gb|ESR48801.1| hypothetical protein CICLE_v10032214mg [Citrus clementina]
Length=306

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK++ + FT GLVA+WYSSNIGVLLLNKYLLSNYGF+YPIFLTMCHMTACSLLSYIAIAW
Sbjct  1    MKSSSKLFTFGLVAAWYSSNIGVLLLNKYLLSNYGFRYPIFLTMCHMTACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVPMQTIRSR QF+KISALS VFC SVV GN+SLR+LPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPMQTIRSRHQFLKISALSFVFCISVVFGNVSLRFLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTYV
Sbjct  121  LMTLKREAWLTYV  133



>ref|XP_003600842.1| Solute carrier family 35 member E4 [Medicago truncatula]
 gb|AES71093.1| triose-phosphate transporter family protein [Medicago truncatula]
Length=323

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            A+ RFFTIGLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAWMK
Sbjct  19   ASTRFFTIGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAWMK  78

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VPMQTIRSRVQF KISALSL+FC SVV GNISLRYLPVSFNQAIGATTPFFTA+FAY+M
Sbjct  79   IVPMQTIRSRVQFFKISALSLIFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAIFAYIM  138

Query  708  TFKREAWLTYV  740
            TFKREA LTY+
Sbjct  139  TFKREACLTYL  149



>ref|XP_010920931.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Elaeis guineensis]
Length=315

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            ATGR FTIGLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW+K
Sbjct  12   ATGRLFTIGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYLAIAWLK  71

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VP+Q +RSRVQF+KISALSLVFC SVVSGNISLR+LPVSFNQA+GATTPFFTAVFAY+M
Sbjct  72   LVPLQAVRSRVQFLKISALSLVFCGSVVSGNISLRFLPVSFNQAVGATTPFFTAVFAYIM  131

Query  708  TFKREAWLTYV  740
            T +REAW+TY+
Sbjct  132  TVRREAWITYL  142



>ref|XP_008789041.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Phoenix dactylifera]
Length=315

 Score =   244 bits (624),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            ATGR FT+GLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM +CSLLSY+AIAW+K
Sbjct  12   ATGRLFTLGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMASCSLLSYVAIAWLK  71

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VPMQT+RSR+QF+KISALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY++
Sbjct  72   VVPMQTVRSRIQFLKISALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYVI  131

Query  708  TFKREAWLTYV  740
            T +REAW+TY+
Sbjct  132  TVRREAWITYL  142



>ref|XP_010907994.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
isoform X2 [Elaeis guineensis]
Length=316

 Score =   244 bits (623),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  336  SAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAI  515
            SA   TGR FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMT+CSLLSY+AI
Sbjct  9    SASLVTGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTSCSLLSYVAI  68

Query  516  AWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVF  695
            AW+K+VPMQT+RSR+QF KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVF
Sbjct  69   AWLKLVPMQTVRSRLQFWKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVF  128

Query  696  AYLMTFKREAWLTYV  740
            AY+MT +REAW+TYV
Sbjct  129  AYIMTLRREAWITYV  143



>ref|XP_003538441.2| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
isoform X1 [Glycine max]
Length=447

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = +3

Query  318  RIDRPMSAMKATG-RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  494
            +I   +  MK +  RFFT+GLVA+WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS
Sbjct  133  QISEGLKKMKGSNNRFFTVGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  192

Query  495  LLSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATT  674
            L SY+AIAWMK+VP+QT+RS+VQF KISALSLVFC SVV GNISLRYLPVSFNQAIGATT
Sbjct  193  LFSYVAIAWMKVVPLQTLRSKVQFFKISALSLVFCVSVVFGNISLRYLPVSFNQAIGATT  252

Query  675  PFFTAVFAYLMTFKREAWLTYV  740
            PFFTAVFAYLMTFKREAWLTY+
Sbjct  253  PFFTAVFAYLMTFKREAWLTYL  274



>gb|AGZ15400.1| organic anion transporter [Phaseolus vulgaris]
Length=306

 Score =   244 bits (622),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   RFFTI LV++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAW
Sbjct  1    MKGGSRFFTIALVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQT+RSR+QF KI+ALSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   LKLVPMQTLRSRLQFFKIAALSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            L+TFKREAWLTY+
Sbjct  121  LITFKREAWLTYL  133



>ref|XP_007141807.1| hypothetical protein PHAVU_008G227200g [Phaseolus vulgaris]
 gb|ESW13801.1| hypothetical protein PHAVU_008G227200g [Phaseolus vulgaris]
Length=306

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK   RFFTI LV++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAW
Sbjct  1    MKGGSRFFTIALVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQT+RSR+QF KI+ALSLVFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   LKLVPMQTLRSRLQFFKIAALSLVFCVSVVFGNISLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            L+TFKREAWLTY+
Sbjct  121  LITFKREAWLTYL  133



>ref|XP_008802329.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Phoenix dactylifera]
Length=331

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = +3

Query  318  RIDRPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL  497
            R + P++++  TGR FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS 
Sbjct  19   RENSPLASL-VTGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSF  77

Query  498  LSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTP  677
            LSY+AIAW+K+VPMQT+RSR+QF KI+ALS VFC SVVSGN+SLRYLPVSFNQA+GATTP
Sbjct  78   LSYVAIAWLKLVPMQTVRSRLQFSKIAALSFVFCGSVVSGNVSLRYLPVSFNQAVGATTP  137

Query  678  FFTAVFAYLMTFKREAWLTYV  740
            FFTAVFAY+MT +REAW+TYV
Sbjct  138  FFTAVFAYVMTLRREAWVTYV  158



>ref|XP_008783674.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Phoenix dactylifera]
Length=316

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            + A   TGR FT+GLV +WYSSNIGVLLLNKYLLSNYGFK+PIFLTMCHMTACSLLSY+A
Sbjct  8    LPASLGTGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKFPIFLTMCHMTACSLLSYVA  67

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            IAW+K+VPMQT+RSR+QF+KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAV
Sbjct  68   IAWLKLVPMQTVRSRLQFLKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAV  127

Query  693  FAYLMTFKREAWLTYV  740
            FAY++T +REAW+TY+
Sbjct  128  FAYIITVRREAWITYI  143



>ref|XP_010907993.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
isoform X1 [Elaeis guineensis]
Length=319

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  336  SAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAI  515
            SA   TGR FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMT+CSLLSY+AI
Sbjct  9    SASLVTGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTSCSLLSYVAI  68

Query  516  AWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVF  695
            AW+K+VPMQT+RSR+QF KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVF
Sbjct  69   AWLKLVPMQTVRSRLQFWKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVF  128

Query  696  AYLMTFKREAWLTYV  740
            AY+MT +REAW+TYV
Sbjct  129  AYIMTLRREAWITYV  143



>ref|XP_009410592.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Musa acuminata subsp. malaccensis]
Length=315

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            +GR FT+GLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAWM++
Sbjct  13   SGRLFTLGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAWMRV  72

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQ +RSR+QF KI ALSLVFC SVVSGN+SL+YLPVSFNQA+GATTPFFTAVFAY+MT
Sbjct  73   VPMQAVRSRLQFAKIVALSLVFCGSVVSGNVSLKYLPVSFNQAVGATTPFFTAVFAYIMT  132

Query  711  FKREAWLTYV  740
             KREAW+TYV
Sbjct  133  VKREAWITYV  142



>ref|XP_009381388.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Musa acuminata subsp. malaccensis]
Length=315

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            +GR  T+GLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY+AIAW+++
Sbjct  13   SGRLVTLGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAWLRV  72

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQT+RSR+QF+KI+ALS+VFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY++T
Sbjct  73   VPMQTVRSRLQFVKIAALSVVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIIT  132

Query  711  FKREAWLTYV  740
             KREAWLTYV
Sbjct  133  VKREAWLTYV  142



>ref|XP_004490944.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Cicer arietinum]
Length=306

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK + R FTIGL++SWY SNIGVLLLNKYLL+NYGFKYPIFLTMCHMTACSL SY+AIAW
Sbjct  1    MKGSSRMFTIGLISSWYLSNIGVLLLNKYLLTNYGFKYPIFLTMCHMTACSLFSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQ+IRSR+QF+KI+ LSLVFC SVV GN+SLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   LKMVPMQSIRSRLQFLKIATLSLVFCVSVVFGNVSLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            +MTFKREAWLTY+
Sbjct  121  VMTFKREAWLTYL  133



>ref|NP_001242185.1| uncharacterized protein LOC100817995 [Glycine max]
 gb|ACU17902.1| unknown [Glycine max]
Length=306

 Score =   241 bits (616),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK++ R   IGLV++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAW
Sbjct  1    MKSSRRLLRIGLVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +KMVPMQTIRSR+QF+KI+ALSL+FC SVV GN+SLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   LKMVPMQTIRSRLQFLKIAALSLIFCFSVVFGNVSLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            +MTFKREAWLTY+
Sbjct  121  VMTFKREAWLTYL  133



>ref|XP_002277359.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Vitis vinifera]
 emb|CAN64197.1| hypothetical protein VITISV_014338 [Vitis vinifera]
 emb|CBI30441.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK + R+FTIGLV SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM ACSLLSYIAIAW
Sbjct  1    MKGSSRWFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMMACSLLSYIAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MKMVP+QTIRSR QF+KIS LSLVFC+SVV GN+SLRYLPVSFNQA+GATTPFFTAVFAY
Sbjct  61   MKMVPLQTIRSRAQFLKISCLSLVFCSSVVCGNVSLRYLPVSFNQAVGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            LM  KRE W+TY+
Sbjct  121  LMKEKREDWITYL  133



>ref|XP_009420353.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Musa acuminata subsp. malaccensis]
Length=315

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            +GR FT GLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM ACSLLSY+AIAW+++
Sbjct  13   SGRLFTFGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMAACSLLSYVAIAWLRV  72

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQT+RSR+QF+KI+ LSLVFC SVVSGN+SL+YLPVSFNQA+GATTPFFTAVFAYLMT
Sbjct  73   VPMQTVRSRLQFLKIATLSLVFCGSVVSGNVSLKYLPVSFNQAVGATTPFFTAVFAYLMT  132

Query  711  FKREAWLTYV  740
             KREAW+TY+
Sbjct  133  VKREAWITYI  142



>ref|XP_002965871.1| hypothetical protein SELMODRAFT_85074 [Selaginella moellendorffii]
 ref|XP_002983119.1| hypothetical protein SELMODRAFT_117478 [Selaginella moellendorffii]
 gb|EFJ15928.1| hypothetical protein SELMODRAFT_117478 [Selaginella moellendorffii]
 gb|EFJ33291.1| hypothetical protein SELMODRAFT_85074 [Selaginella moellendorffii]
Length=305

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            A G  FT+GL+ +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTAC+L SYI IAW+K
Sbjct  2    APGSVFTVGLIGAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACALFSYIGIAWLK  61

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VPMQ IRSR QF+KISALS++FCASVVSGNISLRYLPVSFNQA+GATTPFFTAVFAYLM
Sbjct  62   LVPMQAIRSRTQFVKISALSIIFCASVVSGNISLRYLPVSFNQAVGATTPFFTAVFAYLM  121

Query  708  TFKREAWLTYV  740
            T KREAW+TY+
Sbjct  122  TLKREAWVTYL  132



>ref|XP_009130902.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g05820 
[Brassica rapa]
Length=308

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GR FTIGLV SWY++NIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY A+AW
Sbjct  3    MATNGRVFTIGLVTSWYTANIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYAAVAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQT+RSRVQF KISALSLVFC SVV GN+SLR+LPVSF QAIGATTPFFTAVFA+
Sbjct  63   LKIVPMQTVRSRVQFAKISALSLVFCVSVVFGNVSLRFLPVSFTQAIGATTPFFTAVFAW  122

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  123  LMTMKREAWLTYL  135



>emb|CDY11341.1| BnaA03g01770D [Brassica napus]
Length=306

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GR FTIGLV SWY++NIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY A+AW
Sbjct  1    MATNGRVFTIGLVTSWYTANIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYAAVAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQT+RSRVQF KISALSLVFC SVV GN+SLR+LPVSF QAIGATTPFFTAVFA+
Sbjct  61   LKIVPMQTVRSRVQFAKISALSLVFCVSVVFGNVSLRFLPVSFTQAIGATTPFFTAVFAW  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTMKREAWLTYL  133



>emb|CDX80975.1| BnaC03g02290D [Brassica napus]
Length=306

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M   GR FTIGLV SWY++NIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY A+AW
Sbjct  1    MATNGRVFTIGLVTSWYTANIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYAAVAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQT+RSRVQF KISALSLVFC SVV GN+SLR+LPVSF QAIGATTPFFTAVFA+
Sbjct  61   LKIVPMQTVRSRVQFAKISALSLVFCVSVVFGNVSLRFLPVSFTQAIGATTPFFTAVFAW  120

Query  702  LMTFKREAWLTYV  740
            LMT KREAWLTY+
Sbjct  121  LMTMKREAWLTYL  133



>ref|XP_004984826.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Setaria italica]
Length=324

 Score =   237 bits (604),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            TGRFFT+GLV++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW+++
Sbjct  20   TGRFFTVGLVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLRV  79

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQ +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT
Sbjct  80   VPMQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMT  139

Query  711  FKREAWLTYV  740
             KRE+W+TY+
Sbjct  140  VKRESWVTYL  149



>ref|XP_003558175.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Brachypodium distachyon]
Length=322

 Score =   236 bits (603),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  354  GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMV  533
            GRFFT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW+++V
Sbjct  20   GRFFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLRIV  79

Query  534  PMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTF  713
            PMQ +RSRVQ  KISALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT 
Sbjct  80   PMQLVRSRVQLAKISALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTV  139

Query  714  KREAWLTYV  740
            KRE+W+TY+
Sbjct  140  KRESWITYL  148



>gb|EPS66893.1| plastidic phosphate translocator-like protein2, partial [Genlisea 
aurea]
Length=309

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MSA K +G+ FT+GLVASW+SSNIGVLLLNKYLLSNYGFKYPIF+T+CHMTACSLLSYIA
Sbjct  1    MSAAKPSGQLFTVGLVASWFSSNIGVLLLNKYLLSNYGFKYPIFMTLCHMTACSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I W+K+V +QTI+SR QFMKI+ALS +FC SVVSGN+SLRYLPVSFNQAIGATTPFFTA+
Sbjct  61   IVWIKIVRLQTIKSRKQFMKIAALSAIFCFSVVSGNVSLRYLPVSFNQAIGATTPFFTAI  120

Query  693  FAYLMTFKREAWLTYV  740
            FAY +TFK+EA+LTY+
Sbjct  121  FAYFITFKKEAFLTYI  136



>ref|XP_012068417.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
isoform X1 [Jatropha curcas]
Length=303

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  354  GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMV  533
            GRFFTIGL+ +WYSSNIGVLLLNKYLLS+YGFKYPIFLT+CHM ACS+LSYIAI+W+K+V
Sbjct  2    GRFFTIGLITAWYSSNIGVLLLNKYLLSSYGFKYPIFLTLCHMMACSMLSYIAISWLKVV  61

Query  534  PMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTF  713
            P+QT+RSRVQF+KISAL +VFC SVV+GN+SL+YLPVSFNQAIGATTPFFTAVFAYLMT 
Sbjct  62   PLQTLRSRVQFLKISALGVVFCLSVVTGNVSLKYLPVSFNQAIGATTPFFTAVFAYLMTL  121

Query  714  KREAWLTYV  740
            KRE W+TYV
Sbjct  122  KREGWVTYV  130



>ref|NP_001049773.1| Os03g0286300 [Oryza sativa Japonica Group]
 gb|AAO16996.1| Putative phosphate/phosphoenolpyruvate translocator protein [Oryza 
sativa Japonica Group]
 gb|ABF95358.1| plastidic phosphate translocator-like protein2, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11687.1| Os03g0286300 [Oryza sativa Japonica Group]
Length=322

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  354  GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMV  533
            GRFFT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW+++V
Sbjct  20   GRFFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLRVV  79

Query  534  PMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTF  713
            PMQ +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT 
Sbjct  80   PMQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTV  139

Query  714  KREAWLTYV  740
            KRE+W+TY+
Sbjct  140  KRESWVTYL  148



>ref|XP_006586185.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Glycine max]
Length=308

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            +G+ FT+GL++ WY+SNIGVLLLNKYLLSN+GF+YPIFLT+CHM ACS+LSY+AIAW+KM
Sbjct  6    SGKLFTLGLISFWYASNIGVLLLNKYLLSNHGFRYPIFLTLCHMMACSILSYVAIAWLKM  65

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQT+RSRVQF+KIS+L L+FC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAYLMT
Sbjct  66   VPMQTVRSRVQFVKISSLGLIFCLSVVGGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  125

Query  711  FKREAWLTYV  740
             +RE WLTYV
Sbjct  126  LRREGWLTYV  135



>ref|XP_003552971.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Glycine max]
Length=308

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            +G+ FT+GL++ WY+SNIGVLLLNKYLLSN+GF+YPIFLT+CHM ACS+LSY+AIAW+KM
Sbjct  6    SGKLFTVGLISFWYASNIGVLLLNKYLLSNHGFRYPIFLTLCHMMACSILSYVAIAWLKM  65

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQT+RSRVQF+KIS+L L+FC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAYLMT
Sbjct  66   VPMQTVRSRVQFVKISSLGLIFCLSVVGGNISLRYLPVSFNQAVGATTPFFTAVFAYLMT  125

Query  711  FKREAWLTYV  740
             +RE WLTYV
Sbjct  126  LRREGWLTYV  135



>gb|EAY89543.1| hypothetical protein OsI_11077 [Oryza sativa Indica Group]
Length=322

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            RFFT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW+++VP
Sbjct  21   RFFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLRVVP  80

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT K
Sbjct  81   MQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTVK  140

Query  717  REAWLTYV  740
            RE+W+TY+
Sbjct  141  RESWVTYL  148



>emb|CDP06527.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  336  SAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAI  515
            S  ++  R+FTIGLV++WY+SNIGVLLLNKYLLSNYGFKYP+FLTMCHM ACSL SYIAI
Sbjct  5    SQSQSQKRWFTIGLVSAWYASNIGVLLLNKYLLSNYGFKYPVFLTMCHMIACSLFSYIAI  64

Query  516  AWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVF  695
             W KMVP+QTIRSR+QF+KISAL L+FC SVVSGN+SLRYLPVSF QA+GATTPFFTA F
Sbjct  65   VWFKMVPLQTIRSRLQFLKISALGLIFCGSVVSGNVSLRYLPVSFTQAVGATTPFFTAFF  124

Query  696  AYLMTFKREAWLTYV  740
            AYLMT+KREAW+TYV
Sbjct  125  AYLMTWKREAWVTYV  139



>dbj|BAK01941.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            RFFT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+L SY AIAW+++VP
Sbjct  21   RFFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALFSYAAIAWLRIVP  80

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ +RSRVQ  KISALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT K
Sbjct  81   MQLVRSRVQLAKISALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTVK  140

Query  717  REAWLTYV  740
            RE+W+TY+
Sbjct  141  RESWITYL  148



>ref|NP_001151135.1| organic anion transporter [Zea mays]
 gb|ACG41728.1| organic anion transporter [Zea mays]
 gb|ACL53901.1| unknown [Zea mays]
 gb|AFW88726.1| organic anion transporter isoform 1 [Zea mays]
 gb|AFW88727.1| organic anion transporter isoform 2 [Zea mays]
Length=324

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
              GR FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW++
Sbjct  19   GNGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLR  78

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VPMQ +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+M
Sbjct  79   VVPMQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIM  138

Query  708  TFKREAWLTYV  740
            T KRE+W+TY+
Sbjct  139  TVKRESWITYL  149



>gb|AFW88728.1| hypothetical protein ZEAMMB73_781596 [Zea mays]
Length=327

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
              GR FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW++
Sbjct  19   GNGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLR  78

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VPMQ +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+M
Sbjct  79   VVPMQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIM  138

Query  708  TFKREAWLTYV  740
            T KRE+W+TY+
Sbjct  139  TVKRESWITYL  149



>dbj|BAJ91133.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            RFFT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+L SY AIAW+++VP
Sbjct  21   RFFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALFSYAAIAWLRIVP  80

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ +RSRVQ  KISALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT K
Sbjct  81   MQLVRSRVQLAKISALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTVK  140

Query  717  REAWLTYV  740
            RE+W+TY+
Sbjct  141  RESWITYL  148



>gb|ABK24351.1| unknown [Picea sitchensis]
 gb|ABK26440.1| unknown [Picea sitchensis]
Length=311

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 2/135 (1%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            + AMK  GR FTIGL++SWY SNIGVLLLNKYLLSNYGFKYPIFLTMCHMTAC+LLSYI 
Sbjct  5    LPAMK--GRLFTIGLISSWYFSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACALLSYIG  62

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I W+K+VPMQTIRSR Q MKI+ALS++F  SVV GNISLR+LPVSFNQA+GATTPFFTA+
Sbjct  63   IVWLKLVPMQTIRSRSQLMKIAALSVIFSTSVVGGNISLRFLPVSFNQAVGATTPFFTAL  122

Query  693  FAYLMTFKREAWLTY  737
            FAYL+TFKREAW+TY
Sbjct  123  FAYLVTFKREAWITY  137



>gb|EMT07416.1| hypothetical protein F775_28356 [Aegilops tauschii]
Length=337

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            RFFT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+L SY AIAW+++VP
Sbjct  21   RFFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALFSYAAIAWLRIVP  80

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ +RSRVQ  KISALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT K
Sbjct  81   MQLVRSRVQLAKISALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTVK  140

Query  717  REAWLTYV  740
            RE+W+TY+
Sbjct  141  RESWITYL  148



>ref|XP_002314133.1| hypothetical protein POPTR_0009s04550g [Populus trichocarpa]
 gb|EEE88088.1| hypothetical protein POPTR_0009s04550g [Populus trichocarpa]
Length=305

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R F++GL+ASWYSSNIGVLLLNKYLLSNYGFKYPIFLT+CHM ACSL SYIAI+W+K+VP
Sbjct  3    RLFSLGLIASWYSSNIGVLLLNKYLLSNYGFKYPIFLTLCHMMACSLFSYIAISWLKIVP  62

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            +QT+RS+ QF+KISAL ++FC+SVV+GNISLRYLPVSFNQAIGATTPFFTAVFAYLMT +
Sbjct  63   LQTMRSKSQFLKISALGIIFCSSVVAGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTLR  122

Query  717  REAWLTYV  740
            RE WLTYV
Sbjct  123  REGWLTYV  130



>gb|KEH34138.1| triose-phosphate transporter family protein [Medicago truncatula]
Length=310

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            +G+ FT+ L++ WY+SNIGVLLLNKYLLSNYGFKYPIFLT+CHM ACS+LSYIAI+WMK+
Sbjct  5    SGKLFTVSLISFWYASNIGVLLLNKYLLSNYGFKYPIFLTLCHMMACSMLSYIAISWMKV  64

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VP+QT+RSRVQF+KIS+L L+FC SVV GNISLRYLPVSFNQAIGATTPFFTAVFAYLMT
Sbjct  65   VPLQTVRSRVQFVKISSLGLIFCLSVVGGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  124

Query  711  FKREAWLTY  737
             KRE WLTY
Sbjct  125  LKREGWLTY  133



>ref|XP_004295729.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Fragaria vesca subsp. vesca]
Length=305

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            A+ R FT+GL+ +WYSSNIGVLLLNK+LL+NYGFKYPIFLT+CHM ACSLLSYIAIAW+K
Sbjct  2    ASSRVFTVGLITAWYSSNIGVLLLNKFLLTNYGFKYPIFLTLCHMLACSLLSYIAIAWLK  61

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VPMQ+IRSRVQFMKIS+L  +FC SVV GNISLRYL VSFNQA+GATTPFFTAVFAYLM
Sbjct  62   VVPMQSIRSRVQFMKISSLGFIFCLSVVGGNISLRYLAVSFNQAVGATTPFFTAVFAYLM  121

Query  708  TFKREAWLTYV  740
            T K+E WLTYV
Sbjct  122  TLKKEGWLTYV  132



>ref|XP_001781766.1| predicted protein [Physcomitrella patens]
 gb|EDQ53414.1| predicted protein [Physcomitrella patens]
Length=310

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  336  SAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAI  515
            + +K +   FT+GL+ +WY SNIGVLLLNKYLLSNYGF++PIFLTMCHMTAC+L SYIAI
Sbjct  3    AGLKMSTSVFTVGLIGAWYFSNIGVLLLNKYLLSNYGFRFPIFLTMCHMTACALFSYIAI  62

Query  516  AWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVF  695
            AWMK+VPMQTIRSR QF+KI ALS++FC SVVSGNISLR+LPVSFNQAIGATTPFFTAVF
Sbjct  63   AWMKVVPMQTIRSRTQFLKIVALSIIFCTSVVSGNISLRFLPVSFNQAIGATTPFFTAVF  122

Query  696  AYLMTFKREAWLTY  737
            AY+MTF++EAWL Y
Sbjct  123  AYIMTFRQEAWLVY  136



>gb|ACL52514.1| unknown [Zea mays]
Length=324

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW+++VP
Sbjct  22   RLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLRVVP  81

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT K
Sbjct  82   MQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTVK  141

Query  717  REAWLTYV  740
            RE+W+TY+
Sbjct  142  RESWVTYL  149



>ref|NP_001130193.1| uncharacterized protein LOC100191287 [Zea mays]
 gb|ACF78339.1| unknown [Zea mays]
 gb|ACL52573.1| unknown [Zea mays]
 gb|ACL54650.1| unknown [Zea mays]
 tpg|DAA44804.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_316977 
[Zea mays]
Length=324

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW+++VP
Sbjct  22   RLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLRVVP  81

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT K
Sbjct  82   MQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTVK  141

Query  717  REAWLTYV  740
            RE+W+TY+
Sbjct  142  RESWVTYL  149



>gb|AES99511.2| triose-phosphate transporter family protein [Medicago truncatula]
Length=306

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK + + FTI L+++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAW
Sbjct  1    MKESSKTFTITLISAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
             KMVPMQ +RSR+QF KI+ LS +FC SVV GN+SLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   FKMVPMQFMRSRLQFFKIATLSFIFCVSVVFGNVSLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
             MT KREAWLTY+
Sbjct  121  AMTLKREAWLTYL  133



>ref|XP_011035212.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Populus euphratica]
Length=305

 Score =   228 bits (582),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R F + L+ASWYSSNIGVLLLNKYLLSNYGFKYPIFLT+CHM ACSLLSYIAI+W+K+VP
Sbjct  3    RLFNVCLIASWYSSNIGVLLLNKYLLSNYGFKYPIFLTLCHMMACSLLSYIAISWLKIVP  62

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            +QTIRSR QF+KISAL ++FC+SVV+GN+SLRYLPVSFNQA+GATTPFFTAVFAYL+TF+
Sbjct  63   LQTIRSRWQFLKISALGVIFCSSVVTGNVSLRYLPVSFNQAVGATTPFFTAVFAYLLTFR  122

Query  717  REAWLTYV  740
            RE WLTYV
Sbjct  123  REGWLTYV  130



>ref|XP_011032188.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g05820 
[Populus euphratica]
Length=305

 Score =   228 bits (582),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R F++GL+ASWYSSNIGVLLLNKYLLSNYGFKYPIFLT+CHM ACS+ SYIAI+W+K+VP
Sbjct  3    RLFSLGLIASWYSSNIGVLLLNKYLLSNYGFKYPIFLTLCHMMACSMFSYIAISWLKIVP  62

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            +QT+RS+ QF+KISAL ++FC+SVV+GNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  
Sbjct  63   LQTMRSKSQFLKISALGIIFCSSVVAGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTLG  122

Query  717  REAWLTYV  740
            RE WLTYV
Sbjct  123  REGWLTYV  130



>ref|XP_007147595.1| hypothetical protein PHAVU_006G137900g [Phaseolus vulgaris]
 gb|ESW19589.1| hypothetical protein PHAVU_006G137900g [Phaseolus vulgaris]
Length=308

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            +  +G+ FT+GLV+ WYSSNIGVLLLNKYLLSN+GF+YPIFLT+CHM ACS+LSY+AIAW
Sbjct  3    VSVSGKVFTVGLVSFWYSSNIGVLLLNKYLLSNHGFRYPIFLTLCHMMACSILSYVAIAW  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQT+RS+VQF+KIS+L L+FC SVV GNISLRYLPVSFNQAIGATTPFFTA+FAY
Sbjct  63   LKVVPMQTVRSKVQFIKISSLGLIFCLSVVGGNISLRYLPVSFNQAIGATTPFFTAIFAY  122

Query  702  LMTFKREAWLTYV  740
            L+T +RE+WLTY+
Sbjct  123  LVTLRRESWLTYL  135



>ref|XP_006651269.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like, 
partial [Oryza brachyantha]
Length=300

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+AC+LLSY AIAW+++VPMQ
Sbjct  1    FTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLRVVPMQ  60

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFFTAVFAY+MT KRE
Sbjct  61   LVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTVKRE  120

Query  723  AWLTYV  740
            +W+TY+
Sbjct  121  SWVTYL  126



>ref|XP_007206668.1| hypothetical protein PRUPE_ppa022815mg [Prunus persica]
 gb|EMJ07867.1| hypothetical protein PRUPE_ppa022815mg [Prunus persica]
Length=304

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            + RFFT+GL+ +WYSSNIGVLLLNK+LLSNYGFKYPIFLT+CHM ACSLLSY+AI+W+K+
Sbjct  2    SDRFFTVGLITAWYSSNIGVLLLNKFLLSNYGFKYPIFLTLCHMLACSLLSYVAISWIKV  61

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQ+I+SRVQF+KIS+L  +FC SVV GNISLRYL VSFNQA+GATTPFFTAVFAYLMT
Sbjct  62   VPMQSIKSRVQFLKISSLGFIFCLSVVGGNISLRYLAVSFNQAVGATTPFFTAVFAYLMT  121

Query  711  FKREAWLTYV  740
             K+E WLTYV
Sbjct  122  LKKEGWLTYV  131



>ref|XP_002463449.1| hypothetical protein SORBIDRAFT_02g044050 [Sorghum bicolor]
 gb|EER99970.1| hypothetical protein SORBIDRAFT_02g044050 [Sorghum bicolor]
Length=317

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM+ACSL SY AIAW+++VP
Sbjct  16   RLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACSLFSYAAIAWLRIVP  75

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ  RSR+Q  KI+ALSLVFCASVVSGNISLRYLPVSFNQA+GATTPFFTAVFAYLMT K
Sbjct  76   MQLPRSRLQLAKIAALSLVFCASVVSGNISLRYLPVSFNQAVGATTPFFTAVFAYLMTVK  135

Query  717  REAWLTYV  740
            RE++LTY+
Sbjct  136  RESFLTYL  143



>ref|XP_002299832.1| hypothetical protein POPTR_0001s25480g [Populus trichocarpa]
 gb|EEE84637.1| hypothetical protein POPTR_0001s25480g [Populus trichocarpa]
Length=305

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R F + L+ASWYSSNIGVLLLNKYLLS+YGFKYPIFLT+CHM ACSLLSYIAI+W+K+VP
Sbjct  3    RLFNVCLIASWYSSNIGVLLLNKYLLSSYGFKYPIFLTLCHMMACSLLSYIAISWLKIVP  62

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            +QTIRSR QF+KISAL ++FC+SVV+GN+SLRYLPVSFNQA+GATTPFFTAVFAYL+TF+
Sbjct  63   LQTIRSRWQFLKISALGVIFCSSVVTGNVSLRYLPVSFNQAVGATTPFFTAVFAYLLTFR  122

Query  717  REAWLTYV  740
            RE WLTYV
Sbjct  123  REGWLTYV  130



>ref|XP_008355494.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Malus domestica]
Length=303

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            +F T+GL+ +WYSSNIGVLLLNK+LLSNYGFKYPIFLT+CHM ACSLLSY+AI+WMK+VP
Sbjct  3    KFVTVGLITAWYSSNIGVLLLNKFLLSNYGFKYPIFLTLCHMLACSLLSYVAISWMKVVP  62

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ+I+SRVQF KIS+L L+FC SVV GNISLRYL VSFNQAIGATTPFFTAVFAY+MT K
Sbjct  63   MQSIKSRVQFFKISSLGLIFCLSVVGGNISLRYLAVSFNQAIGATTPFFTAVFAYIMTLK  122

Query  717  REAWLTYV  740
            +E W+TYV
Sbjct  123  KEGWVTYV  130



>ref|XP_004500210.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Cicer arietinum]
Length=311

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            +G+ FT+ L++ WY+SNIGVLLLNKYLLSNYGFKYPIFLT+CHM ACS+LSYIA++WMK+
Sbjct  6    SGKVFTVSLISLWYASNIGVLLLNKYLLSNYGFKYPIFLTLCHMMACSILSYIAMSWMKV  65

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQT+RS+VQF+KIS+L L+FC SVV GNISL+YLPVSFNQA+G+TTPFFTA+FAY+MT
Sbjct  66   VPMQTVRSKVQFVKISSLGLIFCLSVVGGNISLKYLPVSFNQAVGSTTPFFTAIFAYIMT  125

Query  711  FKREAWLTYV  740
             KRE+WLTY+
Sbjct  126  RKRESWLTYL  135



>ref|XP_004958806.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Setaria italica]
Length=313

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R FT+GLV +WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM ACSL SY AIAW+++VP
Sbjct  12   RLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMGACSLFSYAAIAWLRLVP  71

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ  RSR+Q  KI+ALSLVFCASVVSGNISLRYLPVSFNQA+GATTPFFTAVFAYL+T K
Sbjct  72   MQLPRSRLQLAKIAALSLVFCASVVSGNISLRYLPVSFNQAVGATTPFFTAVFAYLITVK  131

Query  717  REAWLTYV  740
            RE+ LTY+
Sbjct  132  RESLLTYL  139



>ref|XP_008221016.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Prunus mume]
Length=304

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  351  TGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKM  530
            + + FT+GL+ +WYSSNIGVLLLNK+LLSNYGFKYPIFLT+CHM ACSLLSY+AI+W+K+
Sbjct  2    SDKVFTVGLITAWYSSNIGVLLLNKFLLSNYGFKYPIFLTLCHMLACSLLSYVAISWIKV  61

Query  531  VPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMT  710
            VPMQ+I+SRVQF+KIS+L  +FC SVV GNISLRYL VSFNQA+GATTPFFTAVFAYLMT
Sbjct  62   VPMQSIKSRVQFLKISSLGFIFCLSVVGGNISLRYLAVSFNQAVGATTPFFTAVFAYLMT  121

Query  711  FKREAWLTYV  740
             K+E WLTYV
Sbjct  122  LKKEGWLTYV  131



>ref|XP_011076749.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Sesamum indicum]
Length=309

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MSAMK++G  +T GLVA+WYSSNIG+LLLNKYLLSNYGFKYPIFLTMCHMT CSLLSYIA
Sbjct  1    MSAMKSSGWVYTFGLVAAWYSSNIGLLLLNKYLLSNYGFKYPIFLTMCHMTVCSLLSYIA  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I WMKMVPM ++ SRVQFMKISALSL+FCASVVS NISL+YLPVSFNQAIGATTPFFTAV
Sbjct  61   IVWMKMVPMHSVNSRVQFMKISALSLIFCASVVSANISLKYLPVSFNQAIGATTPFFTAV  120

Query  693  FAYLMTFKREAWLTYV  740
            FAYL+T K E+WLTYV
Sbjct  121  FAYLITLKMESWLTYV  136



>gb|EPS64971.1| plastidic phosphate translocator-like protein2, partial [Genlisea 
aurea]
Length=305

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            ++G  FT+GLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM ACSLLSYI+I WMK
Sbjct  2    SSGPLFTVGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMMACSLLSYISIVWMK  61

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
             V MQ ++SR Q MKI+ LS +FC SVVSGNISL+YLPVSFNQAIGATTPFFTAVFAY M
Sbjct  62   AVRMQALKSRKQLMKIAGLSAIFCFSVVSGNISLKYLPVSFNQAIGATTPFFTAVFAYFM  121

Query  708  TFKREAWLTYV  740
            TFK+EA LTY+
Sbjct  122  TFKKEALLTYI  132



>ref|XP_006488450.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Citrus sinensis]
Length=315

 Score =   223 bits (569),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +3

Query  321  IDRPMSAMKAT--GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  494
            +  P S+M+A   G FFT+GL+  WYSSNIGV+LLNKYLLS+YGFKYPIFLT+CHM ACS
Sbjct  1    MKAPFSSMQAPKYGSFFTLGLITIWYSSNIGVILLNKYLLSSYGFKYPIFLTLCHMMACS  60

Query  495  LLSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATT  674
            LLSY+A+AW+K+ PMQ ++SR QF KISAL ++FC SVV GN+SL+YLPVSFNQA+GATT
Sbjct  61   LLSYVAVAWLKVAPMQHLKSRKQFFKISALGIIFCLSVVGGNVSLKYLPVSFNQAVGATT  120

Query  675  PFFTAVFAYLMTFKREAWLTYV  740
            PFFTAV AYLMT KRE WLTYV
Sbjct  121  PFFTAVLAYLMTLKREGWLTYV  142



>ref|XP_003616554.1| Maturase [Medicago truncatula]
Length=456

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK + + FTI L+++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAW
Sbjct  151  MKESSKTFTITLISAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAW  210

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
             KMVPMQ +RSR+QF KI+ LS +FC SVV GN+SLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  211  FKMVPMQFMRSRLQFFKIATLSFIFCVSVVFGNVSLRYLPVSFNQAIGATTPFFTAVFAY  270

Query  702  LMTFKREAWLTYV  740
             MT KREAWLTY+
Sbjct  271  AMTLKREAWLTYL  283



>ref|XP_009374303.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Pyrus x bretschneideri]
Length=303

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            +F T+GL+ +WY SNIGVLLLNK+LLSNYGFKYPIFLT+CHM ACSLLSY+AI+WMK+VP
Sbjct  3    KFVTVGLITAWYLSNIGVLLLNKFLLSNYGFKYPIFLTLCHMLACSLLSYVAISWMKVVP  62

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            MQ+I+SRVQF KIS+L L+FC SVV GNISLRYL VSFNQAIGATTPFFTAVFAY+MT K
Sbjct  63   MQSIKSRVQFFKISSLGLIFCLSVVGGNISLRYLAVSFNQAIGATTPFFTAVFAYIMTLK  122

Query  717  REAWLTYV  740
            +E W+TYV
Sbjct  123  KEGWVTYV  130



>gb|KDO66736.1| hypothetical protein CISIN_1g021266mg [Citrus sinensis]
Length=315

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +3

Query  321  IDRPMSAMKAT--GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  494
            +  P S+M+A   G FFT+GL+  WYSSNIGV+LLNKYLLS+YGFKYPIFLT+CHM ACS
Sbjct  1    MKAPFSSMQAPKYGSFFTLGLITIWYSSNIGVILLNKYLLSSYGFKYPIFLTLCHMMACS  60

Query  495  LLSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATT  674
            LLSY+A+AW+K+ P+Q ++S+ QF KISAL ++FC SVV GN+SL+YLPVSFNQA+GATT
Sbjct  61   LLSYVAVAWLKVAPIQHLKSQKQFFKISALGIIFCLSVVGGNVSLKYLPVSFNQAVGATT  120

Query  675  PFFTAVFAYLMTFKREAWLTYV  740
            PFFTAVFAYLMT KRE WLTYV
Sbjct  121  PFFTAVFAYLMTLKREGWLTYV  142



>ref|XP_001765873.1| predicted protein [Physcomitrella patens]
 gb|EDQ69194.1| predicted protein [Physcomitrella patens]
Length=310

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  336  SAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAI  515
            +A K +   FT+GL+ +WY SNIGVLLLNKYLLSNYGF+YPIFLTMCHMTAC+L SY+AI
Sbjct  3    AAPKMSTSAFTVGLIGAWYFSNIGVLLLNKYLLSNYGFRYPIFLTMCHMTACALFSYVAI  62

Query  516  AWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVF  695
            AWMK+VP+QTIRSR QF+KI ALS++FC SVVSGNISLR+LPVSFNQAIGATTPFFTAVF
Sbjct  63   AWMKVVPLQTIRSRTQFLKIVALSVIFCTSVVSGNISLRFLPVSFNQAIGATTPFFTAVF  122

Query  696  AYLMTFKREAWLTY  737
            AY+MTF++EA   Y
Sbjct  123  AYMMTFRKEAGPVY  136



>gb|ADE76672.1| unknown [Picea sitchensis]
Length=309

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             FTIGLV +W+SSNIGV+LLNKYLLSNYGF++P+FLTMCHMTACSLLSY+ I W KMVPM
Sbjct  5    LFTIGLVGAWFSSNIGVILLNKYLLSNYGFRFPLFLTMCHMTACSLLSYLVIVWFKMVPM  64

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q IRSRVQF KI+ LS +FCASVV GNISLRYLPVSFNQA+GATTPFFTAV AYL+T +R
Sbjct  65   QPIRSRVQFTKIATLSAIFCASVVGGNISLRYLPVSFNQAVGATTPFFTAVLAYLITVQR  124

Query  720  EAWLTY  737
            EAWLTY
Sbjct  125  EAWLTY  130



>ref|XP_002281102.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Vitis vinifera]
 emb|CAN72063.1| hypothetical protein VITISV_031804 [Vitis vinifera]
 emb|CBI16019.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
             + R+FTIGL+ SWY+SNIGVLLLNKYLLSNYGF+YPIFLT+CHM ACSLLSY AIAW+K
Sbjct  2    GSSRWFTIGLITSWYASNIGVLLLNKYLLSNYGFRYPIFLTLCHMLACSLLSYAAIAWLK  61

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VP Q +RSR QF+KIS LSLVFCASVVSGN+SLR+LPVSFNQAIGATTPFFTAVFA +M
Sbjct  62   VVPRQNVRSRAQFVKISVLSLVFCASVVSGNVSLRFLPVSFNQAIGATTPFFTAVFACIM  121

Query  708  TFKREAWLTY  737
            T +REA LTY
Sbjct  122  TRRREALLTY  131



>ref|XP_006424991.1| hypothetical protein CICLE_v10029901mg [Citrus clementina]
 gb|ESR38231.1| hypothetical protein CICLE_v10029901mg [Citrus clementina]
Length=308

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +3

Query  354  GRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMV  533
            G FFT+GL+  WYSSNIGV+LLNKYLLS+YGFKYPIFLT+CHM ACSLLSY+A+AW+K+ 
Sbjct  7    GSFFTLGLITIWYSSNIGVILLNKYLLSSYGFKYPIFLTLCHMMACSLLSYVAVAWLKVA  66

Query  534  PMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTF  713
            PMQ ++SR QF KISAL ++FC SVV GN+SL+YLPVSFNQA+GATTPFFTAV AYLMT 
Sbjct  67   PMQHLKSRKQFFKISALGIIFCLSVVGGNVSLKYLPVSFNQAVGATTPFFTAVLAYLMTL  126

Query  714  KREAWLTYV  740
            KRE WLTYV
Sbjct  127  KREGWLTYV  135



>gb|KJB21651.1| hypothetical protein B456_004G006600 [Gossypium raimondii]
Length=303

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             FTIGL+ASWY+SNIGVLLLNK+LLSNYGFKYPIFLT+CHM ACSLLSYIAI W+K+ PM
Sbjct  4    LFTIGLIASWYASNIGVLLLNKFLLSNYGFKYPIFLTLCHMMACSLLSYIAIEWLKIAPM  63

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR+Q MKISAL  +FC SVV GNISLRYLPVSFNQA+GATTPFFTAVFA +MT KR
Sbjct  64   QRVKSRLQMMKISALGFIFCLSVVGGNISLRYLPVSFNQAVGATTPFFTAVFAVVMTSKR  123

Query  720  EAWLTYV  740
            E W+TYV
Sbjct  124  EGWITYV  130



>ref|XP_003616553.1| Maturase [Medicago truncatula]
Length=657

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK + + FTI L+++WYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSL SY+AIAW
Sbjct  352  MKESSKTFTITLISAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLFSYVAIAW  411

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
             KMVPMQ +RSR+QF KI+ LS +FC SVV GN+SLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  412  FKMVPMQFMRSRLQFFKIATLSFIFCVSVVFGNVSLRYLPVSFNQAIGATTPFFTAVFAY  471

Query  702  LMTFKREAWLTYV  740
             MT KREAWLTY+
Sbjct  472  AMTLKREAWLTYL  484



>ref|XP_007016212.1| Nucleotide-sugar transporter family protein [Theobroma cacao]
 gb|EOY33831.1| Nucleotide-sugar transporter family protein [Theobroma cacao]
Length=303

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
            R FT+GL+ SWYSSNIGVLLLNK+LLSNYGF+YPI LT+CHM ACS+ SY+AIAW+K+ P
Sbjct  3    RLFTVGLITSWYSSNIGVLLLNKFLLSNYGFRYPISLTLCHMLACSMFSYMAIAWLKVAP  62

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
            +Q IRSR+Q MKISAL ++FC SVV GNISLR+LPVSFNQA+GATTPFFTAVFAY+MT K
Sbjct  63   LQGIRSRLQLMKISALGVIFCLSVVGGNISLRFLPVSFNQAVGATTPFFTAVFAYVMTRK  122

Query  717  REAWLTY  737
            RE+W+TY
Sbjct  123  RESWVTY  129



>ref|XP_010423621.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Camelina sativa]
 ref|XP_010452312.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Camelina sativa]
 ref|XP_010490920.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Camelina sativa]
Length=309

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS+       F   L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSYI+
Sbjct  1    MSSSSKKQTLFISTLIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYIS  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I ++K+VP+Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+
Sbjct  61   IVFLKLVPLQHLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTAL  120

Query  693  FAYLMTFKREAWLTY  737
            FAYLMTFKREAW+TY
Sbjct  121  FAYLMTFKREAWVTY  135



>gb|AAL32553.1| phosphate/phosphoenolpyruvate translocator-like protein [Arabidopsis 
thaliana]
 gb|AAM13252.1| phosphate/phosphoenolpyruvate translocator-like protein [Arabidopsis 
thaliana]
Length=309

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS+       F   L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSYI+
Sbjct  1    MSSSAKKQTLFISTLIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYIS  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I ++K+VP+Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+
Sbjct  61   IVFLKLVPLQHLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTAL  120

Query  693  FAYLMTFKREAWLTY  737
            FAYLMTFKREAW+TY
Sbjct  121  FAYLMTFKREAWVTY  135



>ref|NP_196036.1| nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 sp|Q9FYE5.1|PT504_ARATH RecName: Full=Probable sugar phosphate/phosphate translocator 
At5g04160 [Arabidopsis thaliana]
 emb|CAC05498.1| phosphate/phosphoenolpyruvate translocator-like protein [Arabidopsis 
thaliana]
 gb|AAM60836.1| phosphate/phosphoenolpyruvate translocator-like protein [Arabidopsis 
thaliana]
 gb|AED90706.1| nucleotide-sugar transporter family protein [Arabidopsis thaliana]
Length=309

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS+       F   L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSYI+
Sbjct  1    MSSSAKKQTLFISTLIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYIS  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I ++K+VP+Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+
Sbjct  61   IVFLKLVPLQHLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTAL  120

Query  693  FAYLMTFKREAWLTY  737
            FAYLMTFKREAW+TY
Sbjct  121  FAYLMTFKREAWVTY  135



>gb|ERN05166.1| hypothetical protein AMTR_s00053p00210710 [Amborella trichopoda]
Length=310

 Score =   213 bits (542),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNKYLLSNYGF+YPIFLTMCHM AC+LLSY++I W+KMVP+Q
Sbjct  9    FISSLIICWYSSNIGVLLLNKYLLSNYGFRYPIFLTMCHMGACALLSYLSIVWLKMVPLQ  68

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+S  QF+KI ALS+VFC SVV GNISLR+LPVSFNQA+GATTPFFTA+FAYLMTFKRE
Sbjct  69   AIKSWTQFLKIGALSVVFCGSVVGGNISLRFLPVSFNQAVGATTPFFTALFAYLMTFKRE  128

Query  723  AWLTY  737
            AWLTY
Sbjct  129  AWLTY  133



>ref|XP_011622979.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Amborella trichopoda]
Length=306

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WYSSNIGVLLLNKYLLSNYGF+YPIFLTMCHM AC+LLSY++I W+KMVP+
Sbjct  8    LFISSLIICWYSSNIGVLLLNKYLLSNYGFRYPIFLTMCHMGACALLSYLSIVWLKMVPL  67

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q I+S  QF+KI ALS+VFC SVV GNISLR+LPVSFNQA+GATTPFFTA+FAYLMTFKR
Sbjct  68   QAIKSWTQFLKIGALSVVFCGSVVGGNISLRFLPVSFNQAVGATTPFFTALFAYLMTFKR  127

Query  720  EAWLTY  737
            EAWLTY
Sbjct  128  EAWLTY  133



>ref|XP_006398872.1| hypothetical protein EUTSA_v10014173mg [Eutrema salsugineum]
 gb|ESQ40325.1| hypothetical protein EUTSA_v10014173mg [Eutrema salsugineum]
Length=310

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSYI+I ++K+VP+Q+++S
Sbjct  16   LIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYISIVFLKLVPLQSLKS  75

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+K+S LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAYLMT KREAW+T
Sbjct  76   RSQFLKVSTLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTLKREAWVT  135

Query  735  Y  737
            Y
Sbjct  136  Y  136



>ref|XP_007026813.1| Nucleotide-sugar transporter family protein [Theobroma cacao]
 gb|EOY07315.1| Nucleotide-sugar transporter family protein [Theobroma cacao]
Length=306

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK    + T+ +V SWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM ACSLLSY+AIAW
Sbjct  1    MKTVIPWTTVWIVISWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMLACSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQ+I SR QF+KI+ LSLVFC SVV GN+SLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   IKVVPMQSIGSRKQFLKITGLSLVFCFSVVLGNVSLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            +M+ K E W+TY+
Sbjct  121  VMSKKMERWVTYL  133



>ref|XP_008239748.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Prunus mume]
Length=311

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  366  TIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQT  545
            TIG+V +WY SNIGVLLLNKYLL+NYGFKYPIFLT+CHMTAC+L SYIAIA MK+VP+QT
Sbjct  14   TIGMVVAWYGSNIGVLLLNKYLLTNYGFKYPIFLTLCHMTACTLFSYIAIALMKVVPLQT  73

Query  546  IRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREA  725
            ++S+VQF KIS LS+VFC SVV GN+SLRYLPVSFNQAIGATTPFFTAVFA+ +  KREA
Sbjct  74   LKSKVQFAKISGLSVVFCFSVVCGNVSLRYLPVSFNQAIGATTPFFTAVFAFFIIKKREA  133

Query  726  WLTY  737
            WLTY
Sbjct  134  WLTY  137



>ref|XP_002873138.1| hypothetical protein ARALYDRAFT_487196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49397.1| hypothetical protein ARALYDRAFT_487196 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS+       F   L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSYI+
Sbjct  1    MSSSSKKQTLFISTLIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYIS  60

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I ++K+VP+Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+
Sbjct  61   IVFLKLVPLQHLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTAL  120

Query  693  FAYLMTFKREAWLTY  737
            FAYLMT KREAW+TY
Sbjct  121  FAYLMTLKREAWVTY  135



>ref|XP_006287792.1| hypothetical protein CARUB_v10001004mg [Capsella rubella]
 gb|EOA20690.1| hypothetical protein CARUB_v10001004mg [Capsella rubella]
Length=432

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  327  RPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY  506
            + MS+       F   L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY
Sbjct  122  KTMSSSSKKQTLFISTLIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSY  181

Query  507  IAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFT  686
            I+I ++K+VP+Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFT
Sbjct  182  ISIVFLKLVPLQHLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFT  241

Query  687  AVFAYLMTFKREAWLTY  737
            A+FAYLMTFKREAW+TY
Sbjct  242  ALFAYLMTFKREAWVTY  258



>gb|KDO42357.1| hypothetical protein CISIN_1g038896mg, partial [Citrus sinensis]
Length=334

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = +3

Query  324  DRPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLS  503
            ++ MS  K T   F + LV  WYSSNIGVLLLNKYLLSNYGF++PIFLTMCHM+AC++LS
Sbjct  25   NKKMSQRKQT--LFILSLVLLWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMSACAILS  82

Query  504  YIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFF  683
            Y++I ++K+VP+QT++SR Q  KI+ LS VFC SVV GNISLRYLPVSFNQA+GATTPFF
Sbjct  83   YVSIVFLKIVPLQTVKSRSQLAKIATLSTVFCGSVVGGNISLRYLPVSFNQAVGATTPFF  142

Query  684  TAVFAYLMTFKREAWLTY  737
            TA+FAYLMTFKREAW+TY
Sbjct  143  TALFAYLMTFKREAWVTY  160



>ref|XP_006421284.1| hypothetical protein CICLE_v10005494mg [Citrus clementina]
 gb|ESR34524.1| hypothetical protein CICLE_v10005494mg [Citrus clementina]
Length=307

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS  K T   F + LV  WYSSNIGVLLLNKYLLSNYGF++PIFLTMCHM+AC++LSY++
Sbjct  1    MSQRKQT--LFILSLVLLWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMSACAILSYVS  58

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I ++K+VP+QT++SR Q  KI+ LS VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+
Sbjct  59   IVFLKIVPLQTVKSRSQLAKIATLSTVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTAL  118

Query  693  FAYLMTFKREAWLTY  737
            FAYLMTFKREAW+TY
Sbjct  119  FAYLMTFKREAWVTY  133



>ref|XP_006492952.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g10290-like 
[Citrus sinensis]
Length=307

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS  K T   F + LV  WYSSNIGVLLLNKYLLSNYGF++PIFLTMCHM+AC++LSY++
Sbjct  1    MSQRKQT--LFILSLVLLWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMSACAILSYVS  58

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I ++K+VP+QT++SR Q  KI+ LS VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+
Sbjct  59   IVFLKIVPLQTVKSRSQLAKIATLSTVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTAL  118

Query  693  FAYLMTFKREAWLTY  737
            FAYLMTFKREAW+TY
Sbjct  119  FAYLMTFKREAWVTY  133



>gb|KFK24863.1| hypothetical protein AALP_AA8G034800 [Arabis alpina]
Length=307

 Score =   211 bits (536),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS+ K T   F   L+ SWY+SNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC++LSYI+
Sbjct  1    MSSKKQT--LFISTLIISWYTSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAILSYIS  58

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I ++K+VP+Q+++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+
Sbjct  59   IVFLKLVPLQSLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTAL  118

Query  693  FAYLMTFKREAWLTY  737
            FAYLMT KREAW+TY
Sbjct  119  FAYLMTLKREAWVTY  133



>ref|XP_007028704.1| Nucleotide-sugar transporter family protein [Theobroma cacao]
 gb|EOY09206.1| Nucleotide-sugar transporter family protein [Theobroma cacao]
Length=317

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   LV  WYSSNIGVLLLNKYLLSNYGFK+PIFLTMCHM+AC+ LSYI+I +MK+VP+
Sbjct  18   LFITSLVVLWYSSNIGVLLLNKYLLSNYGFKFPIFLTMCHMSACAFLSYISIVFMKLVPL  77

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q I+SR Q +KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAYLMTFKR
Sbjct  78   QPIKSRPQLLKIATLSVVFCCSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTFKR  137

Query  720  EAWLTY  737
            EAW+TY
Sbjct  138  EAWVTY  143



>emb|CDY41396.1| BnaCnng10320D [Brassica napus]
Length=311

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSYI+I ++K+VP+Q ++S
Sbjct  17   LIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYISIVFLKLVPLQHLKS  76

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAYLMT KREAW+T
Sbjct  77   RSQFLKVATLSVVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTLKREAWVT  136

Query  735  Y  737
            Y
Sbjct  137  Y  137



>emb|CDY08614.1| BnaA05g28500D [Brassica napus]
Length=316

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F + L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  17   LFILSLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYLSIVFLKLVPL  76

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QFMK++ LS+VFCASVV GN+SLRYLPVSFNQA+GATTPFFTA+FAYLMTFKR
Sbjct  77   QHLKSRSQFMKVATLSVVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKR  136

Query  720  EAWLTY  737
            EAW+TY
Sbjct  137  EAWITY  142



>gb|KJB14848.1| hypothetical protein B456_002G146200 [Gossypium raimondii]
Length=313

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 117/134 (87%), Gaps = 2/134 (1%)
 Frame = +3

Query  336  SAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAI  515
            S+ K T   F   L+  WYSSNIGVLLLNKYLLSNYGFK+PIFLTMCHM+AC+ LSYI+I
Sbjct  8    SSKKQT--LFIASLIILWYSSNIGVLLLNKYLLSNYGFKFPIFLTMCHMSACAFLSYISI  65

Query  516  AWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVF  695
             ++K+VP+Q I+SR QF+KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+F
Sbjct  66   VFIKLVPLQPIKSRPQFLKIATLSVVFCCSVVGGNISLRYLPVSFNQAVGATTPFFTALF  125

Query  696  AYLMTFKREAWLTY  737
            AYLMTFKREAW+TY
Sbjct  126  AYLMTFKREAWVTY  139



>ref|XP_002323269.1| phosphate translocator-related family protein [Populus trichocarpa]
 gb|EEF05030.1| phosphate translocator-related family protein [Populus trichocarpa]
Length=308

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 118/136 (87%), Gaps = 3/136 (2%)
 Frame = +3

Query  330  PMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYI  509
            P S  +A    F   L+A WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC++LSY+
Sbjct  2    PSSKKEA---LFIASLIALWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAILSYL  58

Query  510  AIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTA  689
            +I ++K+VP+Q ++SR Q +KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA
Sbjct  59   SIVFLKIVPLQVVKSRPQLLKIATLSVVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTA  118

Query  690  VFAYLMTFKREAWLTY  737
            VFAYLMTFKREAW+TY
Sbjct  119  VFAYLMTFKREAWVTY  134



>emb|CDX70255.1| BnaA10g26040D [Brassica napus]
Length=311

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC+ LSYI+I ++K+VP+Q ++S
Sbjct  17   LIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAFLSYISIVFLKLVPLQHLKS  76

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAYLMT KREAW+T
Sbjct  77   RSQFLKVATLSVVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTLKREAWVT  136

Query  735  Y  737
            Y
Sbjct  137  Y  137



>ref|XP_010269676.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g10290 
[Nelumbo nucifera]
Length=304

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
            FF   LV  WYSSNIGVLLLNKYLLSNYGF++PIFLTMCHMTAC++LSYI+I   K VP+
Sbjct  5    FFISSLVVLWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMTACAVLSYISIVLFKFVPL  64

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QF KI+ LS+VFC SVV GNISLR+LPVSFNQA+GATTPFFTA+FAY MTFKR
Sbjct  65   QAVKSRTQFFKIATLSVVFCGSVVGGNISLRFLPVSFNQAVGATTPFFTALFAYFMTFKR  124

Query  720  EAWLTY  737
            EAW+TY
Sbjct  125  EAWITY  130



>gb|KJB35994.1| hypothetical protein B456_006G135900 [Gossypium raimondii]
Length=206

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC+ LSY++I +MK+VP+Q
Sbjct  16   FIASLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAFLSYVSIVFMKLVPLQ  75

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF+KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAY MTFKRE
Sbjct  76   PIKSRPQFLKIATLSVVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYFMTFKRE  135

Query  723  AWLTY  737
            AW+TY
Sbjct  136  AWVTY  140



>emb|CDY64269.1| BnaA07g36400D [Brassica napus]
 emb|CDY63119.1| BnaA09g53280D [Brassica napus]
 emb|CDY56711.1| BnaC01g38690D [Brassica napus]
 emb|CDY43207.1| BnaA07g07470D [Brassica napus]
 emb|CDY41333.1| BnaA01g31860D [Brassica napus]
 emb|CDY40726.1| BnaAnng05890D [Brassica napus]
 emb|CDY38198.1| BnaA09g11910D [Brassica napus]
 emb|CDY32060.1| BnaA07g03920D [Brassica napus]
 emb|CDY30718.1| BnaA02g33400D [Brassica napus]
 emb|CDY19068.1| BnaA04g18080D [Brassica napus]
 emb|CDY16783.1| BnaA09g05990D [Brassica napus]
 emb|CDY06070.1| BnaA09g37100D [Brassica napus]
 emb|CDX88102.1| BnaA06g26930D [Brassica napus]
 emb|CDX76352.1| BnaA08g10480D [Brassica napus]
Length=324

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  25   LFISSLILLWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPL  84

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QFMK++ LS+VFCASVV GN+SLRYLPVSFNQA+GATTPFFTA+FAYLMTFKR
Sbjct  85   QHLKSRSQFMKVATLSIVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKR  144

Query  720  EAWLTY  737
            EAW+TY
Sbjct  145  EAWVTY  150



>ref|XP_006407587.1| hypothetical protein EUTSA_v10021139mg [Eutrema salsugineum]
 gb|ESQ49040.1| hypothetical protein EUTSA_v10021139mg [Eutrema salsugineum]
Length=323

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  24   LFISSLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPL  83

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QFMK++ LS+VFCASVV GN+SLRYLPVSFNQA+GATTPFFTA+FAYLMTFKR
Sbjct  84   QYLKSRTQFMKVATLSIVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKR  143

Query  720  EAWLTY  737
            EAW+TY
Sbjct  144  EAWVTY  149



>gb|KJB35992.1| hypothetical protein B456_006G135900 [Gossypium raimondii]
Length=222

 Score =   205 bits (522),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC+ LSY++I +MK+VP+Q
Sbjct  16   FIASLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAFLSYVSIVFMKLVPLQ  75

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF+KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAY MTFKRE
Sbjct  76   PIKSRPQFLKIATLSVVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYFMTFKRE  135

Query  723  AWLTY  737
            AW+TY
Sbjct  136  AWVTY  140



>ref|XP_007208479.1| hypothetical protein PRUPE_ppa018496mg [Prunus persica]
 gb|EMJ09678.1| hypothetical protein PRUPE_ppa018496mg [Prunus persica]
Length=295

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            +V +WY SNIGVLLLNKYLL+NYGFKYPIFLT+CHMTAC+L SYIAIA MK+VP+QT++S
Sbjct  1    MVVAWYGSNIGVLLLNKYLLTNYGFKYPIFLTLCHMTACTLFSYIAIALMKVVPLQTVKS  60

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            +VQF KIS LS+VFC SVV GN+SLRYLPVSFNQAIGATTPFFTAVFA+ +  KREAWLT
Sbjct  61   KVQFAKISGLSVVFCFSVVCGNVSLRYLPVSFNQAIGATTPFFTAVFAFFIIKKREAWLT  120

Query  735  Y  737
            Y
Sbjct  121  Y  121



>gb|KHG15284.1| hypothetical protein F383_18505 [Gossypium arboreum]
Length=313

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNKYLLSNYGFK+PIFLTMCHM+AC+  SYI+I ++K+VP+Q
Sbjct  15   FLASLIILWYSSNIGVLLLNKYLLSNYGFKFPIFLTMCHMSACAFFSYISIVFIKLVPLQ  74

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF+KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAYLMTFKRE
Sbjct  75   PIKSRPQFLKIATLSVVFCCSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTFKRE  134

Query  723  AWLTY  737
            AW+TY
Sbjct  135  AWVTY  139



>gb|KJB35995.1| hypothetical protein B456_006G135900 [Gossypium raimondii]
Length=224

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC+ LSY++I +MK+VP+Q
Sbjct  16   FIASLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAFLSYVSIVFMKLVPLQ  75

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF+KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAY MTFKRE
Sbjct  76   PIKSRPQFLKIATLSVVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYFMTFKRE  135

Query  723  AWLTY  737
            AW+TY
Sbjct  136  AWVTY  140



>ref|XP_010468092.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160, 
partial [Camelina sativa]
Length=358

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = +3

Query  303  RNWGFRIDRPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHM  482
            +N   + D   S+ K    F +  L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM
Sbjct  41   KNPDQKSDMSSSSQKKQTLFIS-SLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHM  99

Query  483  TACSLLSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAI  662
            +AC++LSY++I ++K+VP+Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+
Sbjct  100  SACAILSYVSIVFLKLVPLQYLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAV  159

Query  663  GATTPFFTAVFAYLMTFKREAWLTY  737
            GATTPFFTA+FAY+MTFKREAW+TY
Sbjct  160  GATTPFFTALFAYIMTFKREAWVTY  184



>ref|XP_010036656.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g10290 
[Eucalyptus grandis]
 gb|KCW48284.1| hypothetical protein EUGRSUZ_K02017 [Eucalyptus grandis]
Length=308

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            MS+ K    F    L+  WYSSNIGV+LLNK+LLSNYGF+YPIFLTMCHM+AC+  SY++
Sbjct  1    MSSPKKQALFIA-SLITLWYSSNIGVILLNKFLLSNYGFRYPIFLTMCHMSACAAFSYVS  59

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I ++K+VP+Q I+SR QF+KI+ LS+VFCASVV GN+SLRYLPVSFNQA+GATTPFFTAV
Sbjct  60   IVFLKLVPLQLIKSRPQFIKIATLSVVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTAV  119

Query  693  FAYLMTFKREAWLTY  737
            FAYL+TFKREAW+TY
Sbjct  120  FAYLVTFKREAWITY  134



>ref|XP_010558137.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g10290 
[Tarenaya hassleriana]
Length=310

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  11   LFISSLIVLWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPL  70

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q+++SR QF+K++ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAY MTFKR
Sbjct  71   QSLKSRSQFLKVTTLSIVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYFMTFKR  130

Query  720  EAWLTY  737
            EAW+TY
Sbjct  131  EAWVTY  136



>ref|XP_002284451.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Vitis vinifera]
 emb|CAN61104.1| hypothetical protein VITISV_024947 [Vitis vinifera]
Length=317

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WYSSNIGV+LLNK+LLSNYGF +PIFLTMCHM+AC++LSY++I ++K+ P+
Sbjct  18   LFISSLIILWYSSNIGVILLNKFLLSNYGFSFPIFLTMCHMSACAILSYVSIVFLKIAPL  77

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QF+KI+ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTAVFAYLMT KR
Sbjct  78   QALKSRAQFLKIATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTAVFAYLMTLKR  137

Query  720  EAWLTYV  740
            EAW+TYV
Sbjct  138  EAWVTYV  144



>gb|KJB35993.1| hypothetical protein B456_006G135900 [Gossypium raimondii]
Length=290

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC+ LSY++I +MK+VP+Q
Sbjct  16   FIASLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAFLSYVSIVFMKLVPLQ  75

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF+KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAY MTFKRE
Sbjct  76   PIKSRPQFLKIATLSVVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYFMTFKRE  135

Query  723  AWLTY  737
            AW+TY
Sbjct  136  AWVTY  140



>gb|KJB35997.1| hypothetical protein B456_006G135900 [Gossypium raimondii]
Length=314

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC+ LSY++I +MK+VP+Q
Sbjct  16   FIASLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAFLSYVSIVFMKLVPLQ  75

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF+KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAY MTFKRE
Sbjct  76   PIKSRPQFLKIATLSVVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYFMTFKRE  135

Query  723  AWLTY  737
            AW+TY
Sbjct  136  AWVTY  140



>emb|CDY42695.1| BnaA03g53480D [Brassica napus]
Length=400

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+Q
Sbjct  102  FISSLILLWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPLQ  161

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             ++SR QFMK++ LS+VFCASVV GN+SLRYLPVSFNQA+GATTPFFTA+FAYLMTFKRE
Sbjct  162  HLKSRSQFMKVATLSIVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKRE  221

Query  723  AWLTY  737
            AW+TY
Sbjct  222  AWVTY  226



>ref|XP_010543907.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Tarenaya hassleriana]
Length=387

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGFK+PIFLTMCHM+ACS+LSY++I ++K+VP+Q
Sbjct  89   FLSSLIILWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACSILSYVSIVFLKLVPLQ  148

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
            +++SR QF+K+S LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAY+MTFKRE
Sbjct  149  SLKSRSQFLKVSTLSIVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYIMTFKRE  208

Query  723  AWLTY  737
            AW+TY
Sbjct  209  AWVTY  213



>ref|XP_009147173.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Brassica rapa]
Length=378

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F + L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K VP+Q
Sbjct  80   FILSLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYLSIVFLKHVPLQ  139

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             ++SR QFMK++ LS+VFCASVV GN+SLRYLPVSFNQA+GATTPFFTA+FAYLMTFKRE
Sbjct  140  HLKSRSQFMKVATLSVVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKRE  199

Query  723  AWLTY  737
            AW+TY
Sbjct  200  AWVTY  204



>ref|XP_011033181.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Populus euphratica]
Length=308

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+A WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  9    LFIASLIALWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAILSYLSIVFLKIVPL  68

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR Q +KI+ LS+VFC SVV GNISL YLPVSFNQA+GATTPFFTAVFAYLMTFKR
Sbjct  69   QVVKSRPQLIKIATLSVVFCGSVVGGNISLSYLPVSFNQAVGATTPFFTAVFAYLMTFKR  128

Query  720  EAWLTY  737
            EAW+TY
Sbjct  129  EAWVTY  134



>ref|XP_010482250.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Camelina sativa]
Length=324

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  25   LFISSLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPL  84

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAY+MTFKR
Sbjct  85   QYLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYIMTFKR  144

Query  720  EAWLTY  737
            EAW+TY
Sbjct  145  EAWVTY  150



>emb|CDY53550.1| BnaA09g57090D [Brassica napus]
Length=398

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  99   LFISSLILLWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPL  158

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QFMK++ LS+VFCASVV GN+SLRYLPVSFNQA+GATTPFFTA+FAYLMTFKR
Sbjct  159  QHLKSRSQFMKVATLSIVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKR  218

Query  720  EAWLTY  737
            EAW+TY
Sbjct  219  EAWVTY  224



>gb|KHG01518.1| hypothetical protein F383_22132 [Gossypium arboreum]
Length=323

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC+ LSY++I +MK+VP+Q
Sbjct  16   FIASLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAFLSYVSIVFMKLVPLQ  75

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF+KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTA+FAY MTFKRE
Sbjct  76   PIKSRPQFLKIATLSVVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYFMTFKRE  135

Query  723  AWLTY  737
            AW+TY
Sbjct  136  AWVTY  140



>ref|XP_010486629.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g10290 
[Camelina sativa]
Length=320

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  21   LFISSLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPL  80

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAY+MTFKR
Sbjct  81   QYLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYIMTFKR  140

Query  720  EAWLTY  737
            EAW+TY
Sbjct  141  EAWVTY  146



>ref|XP_006298080.1| hypothetical protein CARUB_v10014124mg, partial [Capsella rubella]
 gb|EOA30978.1| hypothetical protein CARUB_v10014124mg, partial [Capsella rubella]
Length=337

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  38   LFISSLIVFWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPL  97

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAY+MTFKR
Sbjct  98   QYLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYIMTFKR  157

Query  720  EAWLTY  737
            EAW+TY
Sbjct  158  EAWVTY  163



>ref|XP_009122632.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Brassica rapa]
Length=311

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            L+ SWYSSNIGVLLLNK+LLSNYGFK+PIFL MCHM AC+ LSYI+I ++K+VP+Q ++S
Sbjct  17   LIISWYSSNIGVLLLNKFLLSNYGFKFPIFLPMCHMPACAFLSYISIVFLKLVPLQHLKS  76

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAYLMT KREAW+T
Sbjct  77   RSQFLKVATLSVVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTLKREAWVT  136

Query  735  Y  737
            Y
Sbjct  137  Y  137



>gb|ACJ85182.1| unknown [Medicago truncatula]
Length=182

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            LVA WYSSNIGV+LLNKYL+SNYGFK+PIFLTMCHMTAC++ SYI+I + K+VP Q I+S
Sbjct  15   LVALWYSSNIGVILLNKYLISNYGFKFPIFLTMCHMTACAIFSYISIVFFKIVPQQMIKS  74

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+K++ LS VFC SVV GNISL+YL VSFNQA+GATTPFFTAV+AYL TFKREAW+T
Sbjct  75   RSQFLKVATLSFVFCGSVVGGNISLKYLAVSFNQAVGATTPFFTAVYAYLATFKREAWIT  134

Query  735  YV  740
            YV
Sbjct  135  YV  136



>ref|NP_187640.1| nucleotide-sugar transporter-like protein [Arabidopsis thaliana]
 sp|Q9SS40.1|PT310_ARATH RecName: Full=Probable sugar phosphate/phosphate translocator 
At3g10290 [Arabidopsis thaliana]
 gb|AAF02813.1|AC009400_9 unknown protein [Arabidopsis thaliana]
 gb|AEE74884.1| nucleotide-sugar transporter-like protein [Arabidopsis thaliana]
Length=355

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+
Sbjct  56   LFISSLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPL  115

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAY+MTFKR
Sbjct  116  QYLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYIMTFKR  175

Query  720  EAWLTY  737
            EAW+TY
Sbjct  176  EAWVTY  181



>ref|XP_007162163.1| hypothetical protein PHAVU_001G129500g [Phaseolus vulgaris]
 gb|ESW34157.1| hypothetical protein PHAVU_001G129500g [Phaseolus vulgaris]
Length=308

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            LV  WYSSNIGV+LLNKYLLSNYGFK+PIFLTMCHM+AC++LSYI+I + K+VP Q I+S
Sbjct  14   LVTLWYSSNIGVILLNKYLLSNYGFKFPIFLTMCHMSACAVLSYISIVFFKVVPQQMIKS  73

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QFMKI+ LSLVFCASVV GN+SLRYL VSFNQA+GATTPFFTAVFAYL T KREAW+T
Sbjct  74   RSQFMKIATLSLVFCASVVGGNVSLRYLAVSFNQAVGATTPFFTAVFAYLATLKREAWVT  133

Query  735  Y  737
            Y
Sbjct  134  Y  134



>gb|ABO87609.1| chloroplast phosphoenolpyruvate/phosphate translocator [Pisum 
sativum]
Length=329

 Score =   206 bits (523),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            LV+ WYSSNIGV+LLNKYLLSNYGFK+PIFLTMCHM+AC++ SYI+I + K+VP Q I+S
Sbjct  35   LVSLWYSSNIGVILLNKYLLSNYGFKFPIFLTMCHMSACAIFSYISIVFFKVVPQQMIKS  94

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+KI+ LS+VFCASVV GNISLRYL VSFNQA+GATTPFFTAVFAYL TFKREAW+T
Sbjct  95   RSQFLKIATLSIVFCASVVGGNISLRYLAVSFNQAVGATTPFFTAVFAYLATFKREAWIT  154

Query  735  Y  737
            Y
Sbjct  155  Y  155



>gb|KJB13074.1| hypothetical protein B456_002G0553001, partial [Gossypium raimondii]
Length=183

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  423  KYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCA  602
            +YLLSNYGFKYPIFLTMCHMTACSLLSY AIAWMKMVPMQTIRSRVQF KI+ LSLVFC 
Sbjct  64   RYLLSNYGFKYPIFLTMCHMTACSLLSYFAIAWMKMVPMQTIRSRVQFFKITTLSLVFCV  123

Query  603  SVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLTYV  740
            SV+ GNISLRYLPVSFNQAIGATTPFFTAVFAYLMT KRE WLTY+
Sbjct  124  SVLFGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTLKREGWLTYI  169



>ref|XP_007162162.1| hypothetical protein PHAVU_001G129500g [Phaseolus vulgaris]
 gb|ESW34156.1| hypothetical protein PHAVU_001G129500g [Phaseolus vulgaris]
Length=346

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            LV  WYSSNIGV+LLNKYLLSNYGFK+PIFLTMCHM+AC++LSYI+I + K+VP Q I+S
Sbjct  52   LVTLWYSSNIGVILLNKYLLSNYGFKFPIFLTMCHMSACAVLSYISIVFFKVVPQQMIKS  111

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QFMKI+ LSLVFCASVV GN+SLRYL VSFNQA+GATTPFFTAVFAYL T KREAW+T
Sbjct  112  RSQFMKIATLSLVFCASVVGGNVSLRYLAVSFNQAVGATTPFFTAVFAYLATLKREAWVT  171

Query  735  Y  737
            Y
Sbjct  172  Y  172



>gb|KDP26087.1| hypothetical protein JCGZ_21120 [Jatropha curcas]
Length=317

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WYSSNIGVLLLNKYLLSNYGF++PIFLTMCHM+AC++LSY++I + K+VP+
Sbjct  18   LFITSLIILWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMSACAILSYLSIVFFKIVPL  77

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++S  Q +KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAYLMTFKR
Sbjct  78   QAVKSSPQLLKIATLSIVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTAVFAYLMTFKR  137

Query  720  EAWLTY  737
            EAW+TY
Sbjct  138  EAWVTY  143



>gb|KEH20816.1| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=309

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            LVA WYSSNIGV+LLNKYL+SNYGFK+PIFLTMCHMTAC++ SYI+I + K+VP Q I+S
Sbjct  15   LVALWYSSNIGVILLNKYLISNYGFKFPIFLTMCHMTACAIFSYISIVFFKIVPQQMIKS  74

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+K++ LS VFC SVV GNISL+YL VSFNQA+GATTPFFTAVFAYL TFKREAW+T
Sbjct  75   RSQFLKVATLSFVFCGSVVGGNISLKYLAVSFNQAVGATTPFFTAVFAYLATFKREAWIT  134

Query  735  YV  740
            YV
Sbjct  135  YV  136



>ref|XP_011466504.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Fragaria vesca subsp. vesca]
Length=310

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  366  TIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQT  545
            TIG VASWY SNIGVLLLNKYLLSNYGFKYPIFLT+CHMTACS+LSY+AIA MK+ P+QT
Sbjct  13   TIGWVASWYGSNIGVLLLNKYLLSNYGFKYPIFLTLCHMTACSVLSYVAIALMKVAPLQT  72

Query  546  IRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREA  725
            ++S+VQ  KI+ LS+VFC SVV GN+SLRYLPVSFNQA+GATTPFFTAV A+LM   RE 
Sbjct  73   LKSKVQLAKIAGLSVVFCFSVVCGNVSLRYLPVSFNQAVGATTPFFTAVLAFLMIKNREE  132

Query  726  WLTY  737
            W+TY
Sbjct  133  WVTY  136



>gb|KHN14956.1| Putative sugar phosphate/phosphate translocator [Glycine soja]
Length=308

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
              F + LV  WYSSNIGV+LLNKYLLSNYGFK+PIFLTMCHM+AC++LSYI+I + K+VP
Sbjct  8    NLFIVFLVTLWYSSNIGVILLNKYLLSNYGFKFPIFLTMCHMSACAVLSYISIVFFKVVP  67

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
             Q I+SR QF+KI+ LSLVFCASVV GNISL+YL VSFNQA+GATTPFFTAVFAYL T K
Sbjct  68   QQMIKSRSQFIKIATLSLVFCASVVGGNISLKYLAVSFNQAVGATTPFFTAVFAYLATLK  127

Query  717  REAWLTY  737
            REAW+TY
Sbjct  128  REAWVTY  134



>ref|XP_003521163.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Glycine max]
 gb|KHN07344.1| Putative sugar phosphate/phosphate translocator [Glycine soja]
Length=348

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
              F + LV  WYSSNIGV+LLNKYLLSNYGFK+PIFLTMCHM+AC++LSY++I + K+VP
Sbjct  48   NLFIVFLVTLWYSSNIGVILLNKYLLSNYGFKFPIFLTMCHMSACAVLSYVSIVFFKVVP  107

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
             Q I+SR QF+KI+ LSLVFCASVV GNISLRYL VSFNQA+GATTPFFTAVFAYL T K
Sbjct  108  QQMIKSRSQFIKIATLSLVFCASVVGGNISLRYLAVSFNQAVGATTPFFTAVFAYLATLK  167

Query  717  REAWLTY  737
            REAW+TY
Sbjct  168  REAWVTY  174



>ref|XP_012086213.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Jatropha curcas]
Length=327

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WYSSNIGVLLLNKYLLSNYGF++PIFLTMCHM+AC++LSY++I + K+VP+
Sbjct  28   LFITSLIILWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMSACAILSYLSIVFFKIVPL  87

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++S  Q +KI+ LS+VFC SVV GNISLRYLPVSFNQA+GATTPFFTAVFAYLMTFKR
Sbjct  88   QAVKSSPQLLKIATLSIVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTAVFAYLMTFKR  147

Query  720  EAWLTY  737
            EAW+TY
Sbjct  148  EAWVTY  153



>ref|XP_003554164.2| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Glycine max]
Length=350

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  357  RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVP  536
              F + LV  WYSSNIGV+LLNKYLLSNYGFK+PIFLTMCHM+AC++LSYI+I + K+VP
Sbjct  50   NLFIVFLVTLWYSSNIGVILLNKYLLSNYGFKFPIFLTMCHMSACAVLSYISIVFFKVVP  109

Query  537  MQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFK  716
             Q I+SR QF+KI+ LSLVFCASVV GNISL+YL VSFNQA+GATTPFFTAVFAYL T K
Sbjct  110  QQMIKSRSQFIKIATLSLVFCASVVGGNISLKYLAVSFNQAVGATTPFFTAVFAYLATLK  169

Query  717  REAWLTY  737
            REAW+TY
Sbjct  170  REAWVTY  176



>ref|XP_011467379.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Fragaria vesca subsp. vesca]
Length=271

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC++LSYI+I ++K+VP+Q
Sbjct  9    FICSLIVLWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAILSYISIVFLKVVPLQ  68

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
            T++SR QF+KI+ LS+VFC SVV GNISLRYL +SFNQA+GATTPFFTA+FAYL T KRE
Sbjct  69   TLKSRSQFLKIATLSVVFCGSVVGGNISLRYLAISFNQAVGATTPFFTALFAYLATLKRE  128

Query  723  AWLTY  737
            AW+TY
Sbjct  129  AWVTY  133



>ref|XP_004504088.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g10290-like 
[Cicer arietinum]
Length=342

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            LV+ WYSSNIGV+LLNKYLLSNYGFK+PIFLTMCHM+AC++ SYI+I + K+VP Q I+S
Sbjct  48   LVSLWYSSNIGVILLNKYLLSNYGFKFPIFLTMCHMSACAVFSYISIVFFKVVPQQMIKS  107

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+KI+ LS+VFC SVV GNISLRYL VSFNQA+GATTPFFTAVFAYL TFKREAW+T
Sbjct  108  RSQFIKIATLSIVFCGSVVGGNISLRYLAVSFNQAVGATTPFFTAVFAYLATFKREAWIT  167

Query  735  Y  737
            Y
Sbjct  168  Y  168



>ref|XP_002884788.1| hypothetical protein ARALYDRAFT_897204 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61047.1| hypothetical protein ARALYDRAFT_897204 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score =   202 bits (515),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            L+  WY+SNIGVLLLNK+LLSNYGFK+PIFLTMCHM+AC++LSY++I ++K+VP+Q ++S
Sbjct  14   LIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPLQYLKS  73

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
            R QF+K++ LS+VFCASVV GNISLRYLPVSFNQA+GATTPFFTA+FAY+MTFK EAW+T
Sbjct  74   RSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYIMTFKGEAWVT  133

Query  735  Y  737
            Y
Sbjct  134  Y  134



>ref|XP_010090204.1| hypothetical protein L484_016542 [Morus notabilis]
 gb|EXB39073.1| hypothetical protein L484_016542 [Morus notabilis]
Length=362

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   LV  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC++LSY +I ++K+VP+Q
Sbjct  9    FISSLVILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAILSYFSIVFLKVVPLQ  68

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
            T++S+ Q +KI+ LSLVFCASVV GNISLRYL VSFNQA+GATTPFFTA+FAYL+TFKRE
Sbjct  69   TLKSKPQLLKIATLSLVFCASVVGGNISLRYLAVSFNQAVGATTPFFTALFAYLVTFKRE  128

Query  723  AWLTY  737
            AWLTY
Sbjct  129  AWLTY  133



>ref|XP_009123021.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Brassica rapa]
Length=324

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  360  FFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPM  539
             F   L+  WY+SNIGVLLLNK+LLSNY FK+PI L+MCHM+AC++LSY++I ++K+VP+
Sbjct  25   LFISSLILLWYTSNIGVLLLNKFLLSNYAFKFPIILSMCHMSACAILSYLSIVFLKLVPL  84

Query  540  QTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKR  719
            Q ++SR QFMK++ LS+VFCASVV GN+SLRYLPVSFNQA+GATTPFFTA+FAYLMTFKR
Sbjct  85   QHLKSRSQFMKVATLSIVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKR  144

Query  720  EAWLTY  737
            EAW+TY
Sbjct  145  EAWVTY  150



>ref|XP_008359558.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Malus domestica]
Length=307

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM AC++LSY++I ++K+VP+Q
Sbjct  9    FISSLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMAACAVLSYLSIVFLKIVPLQ  68

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
            TI+SR QF+KI+ LS+VFC SVV GNISLRYL VSFNQA+GATTPFFTA+FAYL T KRE
Sbjct  69   TIKSRSQFLKIATLSVVFCGSVVGGNISLRYLAVSFNQAVGATTPFFTALFAYLATLKRE  128

Query  723  AWLTY  737
            AW+TY
Sbjct  129  AWVTY  133



>ref|XP_009334293.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Pyrus x bretschneideri]
Length=307

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM AC++LSY++I ++K+VP+Q
Sbjct  9    FISSLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMAACAVLSYLSIVFLKIVPLQ  68

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
            TI+SR QF+KI+ LS+VFC SVV GNISLRYL VSFNQA+GATTPFFTA+FAYL T KRE
Sbjct  69   TIKSRSQFLKIATLSVVFCGSVVGGNISLRYLAVSFNQAVGATTPFFTALFAYLATLKRE  128

Query  723  AWLTY  737
            AW+TY
Sbjct  129  AWVTY  133



>ref|XP_004136668.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Cucumis sativus]
 gb|KGN59501.1| hypothetical protein Csa_3G822510 [Cucumis sativus]
Length=307

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            M++ K T  FF + LV  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC++LSY +
Sbjct  1    MASNKQT--FFILSLVIFWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAILSYFS  58

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I   K+VP+Q ++SR QF KI+ L LVFCASVV GN+SLRYL VSFNQA+GATTPFFTA+
Sbjct  59   IVVFKIVPIQMLKSRSQFFKIATLGLVFCASVVGGNVSLRYLAVSFNQAVGATTPFFTAL  118

Query  693  FAYLMTFKREAWLTY  737
            FAYLMT KREAW+TY
Sbjct  119  FAYLMTLKREAWVTY  133



>ref|XP_009370230.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Pyrus x bretschneideri]
 ref|XP_009370263.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Pyrus x bretschneideri]
Length=310

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A  ++ T+G+VA+WY SNIGVLLLNKYLL+NYGF++PIFLT+ HMTACS+LSY+AIA 
Sbjct  1    MSAAIQWTTVGMVAAWYGSNIGVLLLNKYLLTNYGFRFPIFLTLSHMTACSVLSYVAIAV  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MK+ P+Q+++S+VQF KIS LS+VFC SVV GN+SL+YLPVSFNQA+GATTPFFTAVF++
Sbjct  61   MKVTPLQSVKSKVQFAKISGLSVVFCFSVVCGNVSLKYLPVSFNQAVGATTPFFTAVFSF  120

Query  702  LMTFKREAWLTY  737
            L+  KREA LTY
Sbjct  121  LIIKKREASLTY  132



>ref|XP_008244265.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Prunus mume]
Length=307

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   LV  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM AC++LSYI+I ++K+VP+Q
Sbjct  9    FISSLVILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMAACAILSYISIVFLKIVPLQ  68

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
            T++S+ QF+KI+ LS+VFC SVV GNISLRYL VSFNQA+GATTPFFTA+FAYL T KRE
Sbjct  69   TLKSKSQFVKIATLSIVFCGSVVGGNISLRYLAVSFNQAVGATTPFFTALFAYLATLKRE  128

Query  723  AWLTY  737
            AW+TY
Sbjct  129  AWVTY  133



>ref|XP_008443328.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Cucumis melo]
Length=307

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +3

Query  333  MSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIA  512
            M++ K T   F + LV  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM+AC++LSY +
Sbjct  1    MASNKQT--LFILSLVIFWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMSACAILSYFS  58

Query  513  IAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAV  692
            I   K+VP+Q ++SR QF+KI+AL LVFC SVV GN+SLRYL VSFNQA+GATTPFFTA+
Sbjct  59   IVVFKIVPIQMLKSRSQFLKIAALGLVFCGSVVGGNVSLRYLAVSFNQAVGATTPFFTAL  118

Query  693  FAYLMTFKREAWLTY  737
            FAYLMT KREAW+TY
Sbjct  119  FAYLMTLKREAWVTY  133



>ref|XP_007202335.1| hypothetical protein PRUPE_ppa008167mg [Prunus persica]
 gb|EMJ03534.1| hypothetical protein PRUPE_ppa008167mg [Prunus persica]
Length=342

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +3

Query  327  RPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSY  506
            +P+         F   LV  WYSSNIGV+LLNK+LLSNYGF++PIFLTMCHM AC++LSY
Sbjct  32   KPLKMSSKKQAIFISSLVILWYSSNIGVILLNKFLLSNYGFRFPIFLTMCHMAACAILSY  91

Query  507  IAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFT  686
            I+I ++K+VP+QT++S+ QF+KI+ LS+VFC SVV GNISLRYL VSFNQA+GATTPFFT
Sbjct  92   ISIVFLKVVPLQTLKSKSQFVKIATLSVVFCGSVVGGNISLRYLAVSFNQAVGATTPFFT  151

Query  687  AVFAYLMTFKREAWLTY  737
            A+FAYL T KREAW+TY
Sbjct  152  ALFAYLATLKREAWVTY  168



>ref|XP_008392288.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Malus domestica]
Length=307

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   LV  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM AC++LSY +I ++K+VP+Q
Sbjct  9    FISSLVILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMAACAILSYFSIVFLKIVPLQ  68

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
            TI+S+ QF+KI+ LS+VFC SVV GNISLRYL VSFNQA+GATTPFFTA+FAYL T KRE
Sbjct  69   TIKSKSQFVKIATLSVVFCGSVVGGNISLRYLAVSFNQAVGATTPFFTALFAYLATLKRE  128

Query  723  AWLTY  737
            AW+TY
Sbjct  129  AWVTY  133



>ref|XP_009363221.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Pyrus x bretschneideri]
Length=307

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYSSNIGVLLLNK+LLSNYGF++PIFLTMCHM AC++LSY +I ++K+VP+Q
Sbjct  9    FISSLIILWYSSNIGVLLLNKFLLSNYGFRFPIFLTMCHMAACAILSYFSIVFLKIVPLQ  68

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
            TI+S+ QF+KI+ LS+VFC SVV GNISLRYL VSFNQA+GATTPFFTA+FAYL T KRE
Sbjct  69   TIKSKSQFVKIATLSVVFCGSVVGGNISLRYLAVSFNQAVGATTPFFTALFAYLATLKRE  128

Query  723  AWLTY  737
            AW+TY
Sbjct  129  AWVTY  133



>ref|XP_011075351.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
[Sesamum indicum]
Length=310

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +3

Query  336  SAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAI  515
            SA K    F T  L+  WYS+NIGVLLLNK+LLSNYGF +PIFLTMCHM+AC++LSYI+I
Sbjct  4    SASKKHAVFITC-LIILWYSTNIGVLLLNKFLLSNYGFAFPIFLTMCHMSACAVLSYISI  62

Query  516  AWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVF  695
             ++K+VP+Q I+SR QF++I+ LS+VFC SVV GNISL+YLPVSFNQA+GATTPFFTA+F
Sbjct  63   MFLKIVPIQRIKSRSQFLRIATLSMVFCGSVVGGNISLKYLPVSFNQAVGATTPFFTALF  122

Query  696  AYLMTFKREAWLTY  737
            AYLMT KREAW TY
Sbjct  123  AYLMTRKREAWATY  136



>ref|XP_003556842.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g05820-like 
[Glycine max]
Length=293

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +3

Query  318  RIDRPMSAMKATG-RFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACS  494
            +I   +  +K +  RFFT+GLVA+WYSSNIGVLLLNKYLL+NYG KYPIFLTMCHMT CS
Sbjct  93   QISEGLKKIKGSNNRFFTVGLVAAWYSSNIGVLLLNKYLLNNYGLKYPIFLTMCHMTTCS  152

Query  495  LLSYIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATT  674
            L SY+AIAWMK+VP+QT+RSRVQF KIS LSLVF  SVV  +ISL YLPVSFNQAIGATT
Sbjct  153  LFSYVAIAWMKVVPLQTLRSRVQFFKISVLSLVFYVSVVFRSISLYYLPVSFNQAIGATT  212

Query  675  PFFTAVFAYLMTFKREAWLTYV  740
            PFFTAVFAYLMT KRE WLTY+
Sbjct  213  PFFTAVFAYLMTLKRETWLTYL  234



>gb|KHN31567.1| Putative sugar phosphate/phosphate translocator, partial [Glycine 
soja]
Length=191

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  348  ATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMK  527
            +  RFFT+GLVA+WYSSNIGVLLLNKYLL+NYG KYPIFL MCHMT CSL SY+AIAWMK
Sbjct  2    SNNRFFTVGLVAAWYSSNIGVLLLNKYLLNNYGLKYPIFLIMCHMTTCSLFSYVAIAWMK  61

Query  528  MVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLM  707
            +VP+QT+RSRVQF KIS LSLVF  SVV  +ISL YLPVSFNQAIGATTP FTAVFAYLM
Sbjct  62   VVPLQTLRSRVQFFKISVLSLVFYVSVVFRSISLYYLPVSFNQAIGATTPLFTAVFAYLM  121

Query  708  TFKREAWLTYV  740
            T KRE WLTY+
Sbjct  122  TLKRETWLTYL  132



>gb|EYU18703.1| hypothetical protein MIMGU_mgv1a010140mg [Erythranthe guttata]
Length=321

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F + L+  WYS+NIGVLLLNK+LLSNYGF +PIFLTMCHM+AC++LSY++I ++K+VP Q
Sbjct  23   FIVLLIILWYSTNIGVLLLNKFLLSNYGFAFPIFLTMCHMSACAILSYVSIMFLKVVPPQ  82

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF++I+ LS+VFCASVV GNISL+YLPVSFNQA+GATTPFFTA+FAY+MT KRE
Sbjct  83   RIKSRSQFLRIATLSVVFCASVVGGNISLKYLPVSFNQAVGATTPFFTALFAYMMTRKRE  142

Query  723  AWLTY  737
            AW TY
Sbjct  143  AWATY  147



>gb|EPS74176.1| hypothetical protein M569_00572, partial [Genlisea aurea]
Length=302

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYS+NIGVLLLNK+LLSNYGF +PIFLTMCHMTAC++LSY++IA++K+VP+Q
Sbjct  4    FIASLIFLWYSTNIGVLLLNKFLLSNYGFIFPIFLTMCHMTACAVLSYVSIAFLKVVPIQ  63

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             ++SR Q ++I+ LS+VFC SVV GNISL++LPVSFNQA+GATTPFFTA+FAY MT KRE
Sbjct  64   RVKSRSQLLRIATLSVVFCGSVVGGNISLKFLPVSFNQAVGATTPFFTALFAYAMTLKRE  123

Query  723  AWLTY  737
            AW+TY
Sbjct  124  AWVTY  128



>ref|XP_011078917.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
isoform X1 [Sesamum indicum]
Length=312

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  363  FTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQ  542
            F   L+  WYS+NIGVLLLNK+LLSNYGF +PIFLTMCHM+AC+LLSYI+I ++K+V +Q
Sbjct  14   FITCLIILWYSTNIGVLLLNKFLLSNYGFAFPIFLTMCHMSACALLSYISIMFLKVVQIQ  73

Query  543  TIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKRE  722
             I+SR QF++I+ LS+VFC SVV GNISL+YLPVSFNQA+GATTPFFTA+FAY+MT KRE
Sbjct  74   RIKSRSQFLRIATLSIVFCGSVVGGNISLKYLPVSFNQAVGATTPFFTALFAYMMTLKRE  133

Query  723  AWLTY  737
             W+TY
Sbjct  134  GWVTY  138



>gb|EEE58836.1| hypothetical protein OsJ_10410 [Oryza sativa Japonica Group]
Length=307

 Score =   195 bits (495),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 112/139 (81%), Gaps = 8/139 (6%)
 Frame = +3

Query  324  DRPMSAMKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLS  503
            +RP+    A  R  T    AS  SS       NKYLLSNYGFKYPIFLTMCHM+AC+LLS
Sbjct  117  ERPLLHRGARHRLVTPPTSAS--SS------FNKYLLSNYGFKYPIFLTMCHMSACALLS  168

Query  504  YIAIAWMKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFF  683
            Y AIAW+++VPMQ +RSRVQ  KI+ALSLVFC SVVSGN+SLRYLPVSFNQA+GATTPFF
Sbjct  169  YAAIAWLRVVPMQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFF  228

Query  684  TAVFAYLMTFKREAWLTYV  740
            TAVFAY+MT KRE+W+TY+
Sbjct  229  TAVFAYIMTVKRESWVTYL  247



>ref|XP_012086214.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
isoform X1 [Jatropha curcas]
 ref|XP_012086215.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g04160 
isoform X2 [Jatropha curcas]
 gb|KDP26086.1| hypothetical protein JCGZ_21119 [Jatropha curcas]
Length=403

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +3

Query  375  LVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQTIRS  554
            LV  WYSSNIGVLLLNKYLLSNYGFK+PIFLTMCHM+AC++LSY++I + K+VP+Q ++S
Sbjct  99   LVVLWYSSNIGVLLLNKYLLSNYGFKFPIFLTMCHMSACAILSYLSIVFFKIVPLQAVKS  158

Query  555  RVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREAWLT  734
              Q +K++ LS+VFC SVV  NISLRYLPVSFNQAIGAT PFFTAVFAYL+TFKRE+W+T
Sbjct  159  SPQLLKVATLSVVFCGSVVGCNISLRYLPVSFNQAIGATAPFFTAVFAYLLTFKRESWVT  218

Query  735  Y  737
            Y
Sbjct  219  Y  219



>gb|KJB17017.1| hypothetical protein B456_002G260500 [Gossypium raimondii]
Length=306

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            MK    + TI +V SWY SNIGVLLLNKYLL+  GFKYPIFLTMCHM A SLLSY+AIAW
Sbjct  1    MKTMIPWTTIWIVFSWYGSNIGVLLLNKYLLTYCGFKYPIFLTMCHMLASSLLSYVAIAW  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            +K+VPMQTI S+ QF+KI  LS VFC SVV GN+SLRYLPVSFNQAIGATTPFFTAVFAY
Sbjct  61   LKVVPMQTIGSKKQFIKIFGLSSVFCFSVVLGNVSLRYLPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTYV  740
            +M  K E+W+TY+
Sbjct  121  VMMKKTESWVTYL  133



>ref|XP_008388183.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Malus domestica]
Length=149

 Score =   188 bits (477),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A   + T+ +VA+WY SNIGVLLLNKYLL+NYGF +PIFLT+CHMTACS+ SY+A+A 
Sbjct  1    MSAPIEWTTVWMVAAWYGSNIGVLLLNKYLLTNYGFGFPIFLTLCHMTACSVFSYVAVAV  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MK+  +Q+++S+ QF KI+ LS+VFC SVV GN+SLRY+PVSFNQA+ ATTPFFTA+FA+
Sbjct  61   MKVALLQSVKSKXQFAKIAGLSVVFCFSVVCGNVSLRYIPVSFNQAVSATTPFFTAIFAF  120

Query  702  LMTFKREAWLTY  737
            L+   REAWLTY
Sbjct  121  LIIKSREAWLTY  132



>ref|XP_010101830.1| putative sugar phosphate/phosphate translocator [Morus notabilis]
 gb|EXB89967.1| putative sugar phosphate/phosphate translocator [Morus notabilis]
Length=307

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M+   R+ T+ +VASWY SNIG+LLLNKYLL+ +GFKYP+FLT+CHM AC+ LSY+AI  
Sbjct  1    MENPIRWTTVWVVASWYGSNIGILLLNKYLLTGFGFKYPVFLTLCHMVACASLSYVAIGL  60

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
             ++VP+Q I+SR Q  +++ALS+VFC SVV GN+SLRY+PVSFNQAIGATTPFFTAVFAY
Sbjct  61   ARVVPLQAIKSRSQLGRLAALSVVFCYSVVCGNVSLRYIPVSFNQAIGATTPFFTAVFAY  120

Query  702  LMTFKREAWLTY  737
            LM  KREAW TY
Sbjct  121  LMIQKREAWATY  132



>ref|XP_008350510.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320 
[Malus domestica]
Length=312

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  342  MKATGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAW  521
            M A   + T+ +VA+WY SNIGVLLLNKYLL+NYGF +PIFLT+CHMTACS+ SY+A+A 
Sbjct  3    MSAPIEWTTVWMVAAWYGSNIGVLLLNKYLLTNYGFGFPIFLTLCHMTACSVFSYVAVAV  62

Query  522  MKMVPMQTIRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAY  701
            MK+  +Q+++S+VQF KI+ LS+VFC SVV GN+SLRY+PVSFNQA+ ATTPFFTA+FA+
Sbjct  63   MKVALLQSVKSKVQFAKIAGLSVVFCFSVVCGNVSLRYIPVSFNQAVSATTPFFTAIFAF  122

Query  702  LMTFKREAWLTY  737
            L+  KREAWLTY
Sbjct  123  LIIKKREAWLTY  134



>ref|XP_003516328.2| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Glycine max]
 gb|KHN26229.1| Putative sugar phosphate/phosphate translocator [Glycine soja]
Length=314

 Score =   190 bits (483),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  366  TIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYIAIAWMKMVPMQT  545
            TIG+V +WYSSNIGVLLLNKYLLSNYGF++P+FLT CHM  CSL SY+ ++    VP+Q 
Sbjct  15   TIGVVIAWYSSNIGVLLLNKYLLSNYGFRFPVFLTTCHMMVCSLFSYVIVSVTDAVPLQR  74

Query  546  IRSRVQFMKISALSLVFCASVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTFKREA  725
            +RSR QF +I AL +VFC SVV GN+SLRY+PVSFNQAIGATTPFFTAVFAY ++ KREA
Sbjct  75   VRSRSQFGRIVALGVVFCFSVVCGNVSLRYIPVSFNQAIGATTPFFTAVFAYAVSAKREA  134

Query  726  WLTY  737
            W+TY
Sbjct  135  WVTY  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1400076157675