BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5227

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094954.1|  PREDICTED: L-type lectin-domain containing r...    137   8e-35   Sesamum indicum [beniseed]
gb|EYU41819.1|  hypothetical protein MIMGU_mgv1a009026mg                127   5e-31   Erythranthe guttata [common monkey flower]
ref|XP_006363087.1|  PREDICTED: L-type lectin-domain containing r...    114   2e-26   Solanum tuberosum [potatoes]
ref|XP_009759025.1|  PREDICTED: L-type lectin-domain containing r...    114   3e-26   Nicotiana sylvestris
ref|XP_004246363.1|  PREDICTED: L-type lectin-domain containing r...    113   7e-26   Solanum lycopersicum
gb|KJB36868.1|  hypothetical protein B456_006G179800                    106   2e-23   Gossypium raimondii
ref|XP_009621566.1|  PREDICTED: lectin-like protein At3g16530           105   5e-23   Nicotiana tomentosiformis
ref|XP_008239852.1|  PREDICTED: L-type lectin-domain containing r...    105   6e-23   Prunus mume [ume]
ref|XP_006576579.1|  PREDICTED: L-type lectin-domain containing r...    104   1e-22   Glycine max [soybeans]
ref|XP_007133954.1|  hypothetical protein PHAVU_010G006300g             103   1e-22   Phaseolus vulgaris [French bean]
ref|XP_007026824.1|  Concanavalin A-like lectin family protein, p...    102   5e-22   
gb|KJB76858.1|  hypothetical protein B456_012G110400                    102   6e-22   Gossypium raimondii
ref|XP_009358820.1|  PREDICTED: L-type lectin-domain containing r...    101   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_009370238.1|  PREDICTED: L-type lectin-domain containing r...    100   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_010256728.1|  PREDICTED: L-type lectin-domain containing r...  99.8    4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_002276782.1|  PREDICTED: L-type lectin-domain containing r...  97.1    4e-20   Vitis vinifera
ref|XP_012087950.1|  PREDICTED: L-type lectin-domain containing r...  96.7    5e-20   Jatropha curcas
ref|XP_004302660.1|  PREDICTED: L-type lectin-domain containing r...  96.7    5e-20   Fragaria vesca subsp. vesca
ref|XP_004492393.1|  PREDICTED: L-type lectin-domain containing r...  96.3    7e-20   Cicer arietinum [garbanzo]
ref|XP_003529134.1|  PREDICTED: L-type lectin-domain containing r...  95.5    1e-19   Glycine max [soybeans]
gb|AFK44294.1|  unknown                                               95.1    2e-19   Lotus japonicus
gb|KHN28781.1|  L-type lectin-domain containing receptor kinase V...  94.7    2e-19   Glycine soja [wild soybean]
gb|ACU17688.1|  unknown                                               92.0    3e-19   Glycine max [soybeans]
gb|KHN26218.1|  L-type lectin-domain containing receptor kinase I.7   92.8    1e-18   Glycine soja [wild soybean]
ref|XP_003516924.1|  PREDICTED: L-type lectin-domain containing r...  92.8    1e-18   Glycine max [soybeans]
ref|XP_008356989.1|  PREDICTED: leucoagglutinating phytohemagglut...  90.5    1e-18   
gb|KEH23081.1|  legume lectin beta domain protein                     92.4    1e-18   Medicago truncatula
ref|XP_008379889.1|  PREDICTED: leucoagglutinating phytohemagglut...  90.1    2e-18   
ref|XP_008370040.1|  PREDICTED: L-type lectin-domain containing r...  89.7    1e-17   Malus domestica [apple tree]
ref|XP_006480935.1|  PREDICTED: L-type lectin-domain containing r...  89.4    2e-17   Citrus sinensis [apfelsine]
ref|XP_003552217.1|  PREDICTED: L-type lectin-domain containing r...  89.4    2e-17   Glycine max [soybeans]
ref|XP_006429260.1|  hypothetical protein CICLE_v10012045mg           89.4    2e-17   Citrus clementina [clementine]
gb|KDO58027.1|  hypothetical protein CISIN_1g018168mg                 89.4    2e-17   Citrus sinensis [apfelsine]
ref|XP_010101839.1|  putative inactive L-type lectin-domain conta...  88.2    4e-17   Morus notabilis
ref|XP_003604815.1|  Lectin                                           87.8    6e-17   Medicago truncatula
emb|CDP06531.1|  unnamed protein product                              87.4    8e-17   Coffea canephora [robusta coffee]
ref|XP_010262713.1|  PREDICTED: L-type lectin-domain containing r...  87.0    9e-17   Nelumbo nucifera [Indian lotus]
ref|XP_004506648.1|  PREDICTED: L-type lectin-domain containing r...  87.0    1e-16   Cicer arietinum [garbanzo]
gb|KHN08323.1|  L-type lectin-domain containing receptor kinase V...  86.7    1e-16   Glycine soja [wild soybean]
ref|XP_007140433.1|  hypothetical protein PHAVU_008G111500g           86.7    1e-16   Phaseolus vulgaris [French bean]
ref|XP_002308200.2|  alpha-amylase inhibitor alpha subunit family...  86.7    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011019177.1|  PREDICTED: lectin-like protein At1g53070         86.3    2e-16   Populus euphratica
ref|XP_008388104.1|  PREDICTED: L-type lectin-domain containing r...  85.9    2e-16   
ref|NP_001154599.1|  putative lectin                                  85.9    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322948.1|  alpha-amylase inhibitor alpha subunit family...  84.0    1e-15   
ref|XP_011009155.1|  PREDICTED: L-type lectin-domain containing r...  83.6    2e-15   Populus euphratica
ref|XP_010037751.1|  PREDICTED: probable L-type lectin-domain con...  80.1    3e-14   
ref|XP_010558351.1|  PREDICTED: L-type lectin-domain containing r...  75.9    9e-13   Tarenaya hassleriana [spider flower]
ref|XP_006398654.1|  hypothetical protein EUTSA_v10013972mg           74.7    2e-12   Eutrema salsugineum [saltwater cress]
emb|CDY07898.1|  BnaC03g36250D                                        74.3    3e-12   Brassica napus [oilseed rape]
ref|XP_010543888.1|  PREDICTED: L-type lectin-domain containing r...  73.9    4e-12   Tarenaya hassleriana [spider flower]
ref|XP_010464556.1|  PREDICTED: truncated lectin 2-like               73.6    5e-12   Camelina sativa [gold-of-pleasure]
gb|AAD56334.1|AC009326_21  putative lectin                            72.4    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469926.1|  PREDICTED: truncated lectin 2-like isoform X1    72.4    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002527882.1|  Agglutinin-2 precursor, putative                 72.0    2e-11   Ricinus communis
ref|XP_010672608.1|  PREDICTED: probable L-type lectin-domain con...  71.6    3e-11   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX73952.1|  BnaA03g30950D                                        71.2    4e-11   
ref|XP_009135075.1|  PREDICTED: probable L-type lectin-domain con...  70.9    5e-11   Brassica rapa
ref|XP_010530423.1|  PREDICTED: L-type lectin-domain containing r...  70.5    6e-11   Tarenaya hassleriana [spider flower]
ref|XP_007205667.1|  hypothetical protein PRUPE_ppa009494mg           69.3    1e-10   
ref|XP_002884719.1|  hypothetical protein ARALYDRAFT_317721           69.3    1e-10   
ref|XP_010553259.1|  PREDICTED: lectin-like protein At1g53070         69.3    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_010486461.1|  PREDICTED: L-type lectin-domain containing r...  67.8    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009354482.1|  PREDICTED: L-type lectin-domain containing r...  65.9    7e-10   
ref|XP_010464536.1|  PREDICTED: L-type lectin-domain containing r...  67.4    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010486478.1|  PREDICTED: lectin-like                           67.4    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009116095.1|  PREDICTED: L-type lectin-domain containing r...  66.2    2e-09   Brassica rapa
ref|XP_010468550.1|  PREDICTED: L-type lectin-domain containing r...  65.9    3e-09   Camelina sativa [gold-of-pleasure]
ref|NP_683540.1|  concanavalin A-like lectin                          64.3    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882602.1|  legume lectin family protein                     63.9    1e-08   
gb|KJB74194.1|  hypothetical protein B456_011G278600                  62.0    5e-08   Gossypium raimondii
gb|EPS72516.1|  hypothetical protein M569_02242                       61.2    8e-08   Genlisea aurea
ref|XP_010452027.1|  PREDICTED: L-type lectin-domain containing r...  61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002873031.1|  legume lectin family protein                     61.2    1e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_010423913.1|  PREDICTED: L-type lectin-domain containing r...  60.8    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009130668.1|  PREDICTED: L-type lectin-domain containing r...  60.5    2e-07   Brassica rapa
ref|XP_011076752.1|  PREDICTED: L-type lectin-domain containing r...  60.1    2e-07   Sesamum indicum [beniseed]
ref|XP_006403620.1|  hypothetical protein EUTSA_v10010505mg           60.1    3e-07   Eutrema salsugineum [saltwater cress]
gb|KFK38290.1|  hypothetical protein AALP_AA3G095000                  59.7    4e-07   Arabis alpina [alpine rockcress]
ref|XP_010490607.1|  PREDICTED: L-type lectin-domain containing r...  58.9    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002280264.1|  PREDICTED: L-type lectin-domain containing r...  58.2    1e-06   Vitis vinifera
ref|XP_004147898.1|  PREDICTED: L-type lectin-domain containing r...  58.5    1e-06   Cucumis sativus [cucumbers]
emb|CDY44678.1|  BnaA05g29280D                                        57.4    2e-06   Brassica napus [oilseed rape]
ref|XP_006296653.1|  hypothetical protein CARUB_v10015712mg           57.0    3e-06   Capsella rubella
ref|XP_006288058.1|  hypothetical protein CARUB_v10001288mg           56.2    5e-06   Capsella rubella
ref|NP_195729.1|  concanavalin A-like lectin                          55.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65643.1|  lectin-like protein                                   55.8    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008785595.1|  PREDICTED: putative L-type lectin-domain con...  55.8    8e-06   Phoenix dactylifera
ref|XP_008364444.1|  PREDICTED: uncharacterized protein LOC103428122  53.1    9e-06   
ref|XP_010923163.1|  PREDICTED: L-type lectin-domain containing r...  55.1    1e-05   Elaeis guineensis
ref|XP_010093501.1|  Lysine histidine transporter 1                   54.3    3e-05   
ref|XP_009146954.1|  PREDICTED: uncharacterized protein LOC103870564  53.9    4e-05   Brassica rapa
ref|XP_007009125.1|  Concanavalin A-like lectin family protein, p...  53.5    4e-05   
gb|KFK34652.1|  hypothetical protein AALP_AA5G173800                  53.5    4e-05   Arabis alpina [alpine rockcress]
ref|XP_008448934.1|  PREDICTED: L-type lectin-domain containing r...  53.5    5e-05   Cucumis melo [Oriental melon]
emb|CDY53094.1|  BnaCnng24240D                                        53.1    5e-05   Brassica napus [oilseed rape]
ref|XP_008233697.1|  PREDICTED: lectin-like protein LEC               52.8    7e-05   Prunus mume [ume]
ref|XP_006407707.1|  hypothetical protein EUTSA_v10022097mg           52.4    9e-05   
gb|EYU19968.1|  hypothetical protein MIMGU_mgv1a007272mg              52.4    1e-04   Erythranthe guttata [common monkey flower]
emb|CDY11212.1|  BnaA03g00480D                                        52.4    1e-04   Brassica napus [oilseed rape]
ref|XP_009103902.1|  PREDICTED: uncharacterized protein LOC103829963  51.6    2e-04   Brassica rapa
ref|XP_007218209.1|  hypothetical protein PRUPE_ppa007818mg           51.6    2e-04   Prunus persica
emb|CDY07559.1|  BnaC06g15050D                                        51.6    2e-04   Brassica napus [oilseed rape]
ref|XP_008381923.1|  PREDICTED: L-type lectin-domain containing r...  51.2    3e-04   
gb|KJB78811.1|  hypothetical protein B456_013G020300                  50.8    3e-04   Gossypium raimondii
gb|KFK24622.1|  hypothetical protein AALP_AA8G003000                  50.4    4e-04   Arabis alpina [alpine rockcress]
ref|XP_004249497.1|  PREDICTED: L-type lectin-domain containing r...  50.8    5e-04   
ref|XP_010676673.1|  PREDICTED: L-type lectin-domain containing r...  49.3    9e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002316243.2|  hypothetical protein POPTR_0010s20190g           49.3    0.001   Populus trichocarpa [western balsam poplar]



>ref|XP_011094954.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Sesamum indicum]
Length=353

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 3/117 (3%)
 Frame = +1

Query  331  MASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDS  510
            MA+VS P  RY LAFF L+L  K + ADPNL+F+FKNFGKDSNF+S  ALYGD +V  D 
Sbjct  1    MAAVSTP--RYLLAFFLLNLYLKVLDADPNLTFSFKNFGKDSNFESQFALYGDAEVAGDG  58

Query  511  LSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +S+++ GS +S  AGR+  KKP+ LVEG  R  VSFS YF FS+S+ +GDGLAFVML
Sbjct  59   MSVQMAGSGVST-AGRVCCKKPMNLVEGNSRNVVSFSNYFTFSMSKENGDGLAFVML  114



>gb|EYU41819.1| hypothetical protein MIMGU_mgv1a009026mg [Erythranthe guttata]
Length=355

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            RYFLAF  L++  K ++ +PN++F+FKNFGKDSNF S ++L+GD KV  D+ SI++ GS 
Sbjct  8    RYFLAFLLLNIFLKVINGEPNITFSFKNFGKDSNFGSQLSLFGDAKVAKDNASIQMSGSG  67

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +   +GR + KKPI LVEGK RK VSFS+YFAFS+S+  GDGLAFVML
Sbjct  68   VFT-SGRFICKKPINLVEGKSRKMVSFSSYFAFSMSKEKGDGLAFVML  114



>ref|XP_006363087.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Solanum tuberosum]
Length=359

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 3/108 (3%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            RY +  F     F+ + ++  +SF F +FGKDSNF+S IALYGD KVVN    I++ GS 
Sbjct  8    RYLMVLFIFCFYFRTIQSEEKMSFGFGDFGKDSNFESQIALYGDAKVVNGG--IQMSGS-  64

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            M   AGRI++KKP KL+EG PRK VSFS +F FSLSR +GDG AFVM+
Sbjct  65   MGFSAGRILNKKPFKLIEGSPRKMVSFSLHFVFSLSRENGDGFAFVMV  112



>ref|XP_009759025.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Nicotiana sylvestris]
Length=361

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 78/109 (72%), Gaps = 4/109 (4%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKF-MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            RY   FF+L   F+  +S + N+SF F+NFGKDSNF   +ALYGD KVVN    I++ GS
Sbjct  8    RYLTVFFYLCFYFRISLSEEQNMSFDFENFGKDSNFKPELALYGDAKVVNGG--IQMSGS  65

Query  535  EMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
             M   +GRI++KKPIKLVE  PRK VSFS +F FSLSR +GDG AFVM+
Sbjct  66   -MGFSSGRILNKKPIKLVEKNPRKMVSFSMHFVFSLSRENGDGFAFVMV  113



>ref|XP_004246363.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Solanum lycopersicum]
Length=359

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 3/108 (3%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            RY +  F     F+ + ++  +SF F +FGKDSNF+S IALYGD KVVN    I++ GS 
Sbjct  8    RYLMVLFIFCFYFRTIQSEEKMSFGFGDFGKDSNFESQIALYGDAKVVNGG--IQMSGS-  64

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            M   AGRI++KKP KL++G PRK VSFS +F FSLSR +GDG AFVM+
Sbjct  65   MGFSAGRILNKKPFKLIDGNPRKMVSFSLHFVFSLSRENGDGFAFVMV  112



>gb|KJB36868.1| hypothetical protein B456_006G179800 [Gossypium raimondii]
Length=357

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 72/109 (66%), Gaps = 2/109 (2%)
 Frame = +1

Query  355  PRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            P YF     L    KF++A  + SF+FK FG+D NF+S IALYGD  V N    I++  S
Sbjct  7    PMYFFTALIL-FHLKFVAAVQSSSFSFKTFGEDPNFESKIALYGDAHVANHGSVIQLTNS  65

Query  535  EMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
             +   AGR+M KKPIKLVEGK R   SFSTYF+FS+S   GDGLAFVM+
Sbjct  66   -VKWSAGRVMYKKPIKLVEGKVRNFASFSTYFSFSMSHEKGDGLAFVMV  113



>ref|XP_009621566.1| PREDICTED: lectin-like protein At3g16530 [Nicotiana tomentosiformis]
Length=363

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPN--LSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDG  531
            RY + FF+L   F+   ++    LSF F+NFGKDSNF S +ALYGD KVVN    I++ G
Sbjct  8    RYIIVFFYLCFYFRISLSEEQKYLSFDFENFGKDSNFGSELALYGDAKVVNGG--IQMSG  65

Query  532  SEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            S M   +GRI++KK IKLVE  PRK +SFS +F FSLSR +GDG  FVM+
Sbjct  66   S-MGFSSGRILNKKSIKLVEKNPRKMMSFSMHFVFSLSRENGDGFVFVMV  114



>ref|XP_008239852.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Prunus mume]
Length=351

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +1

Query  340  VSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSI  519
             S P  ++  AF  L    +  +AD N SF+F  FGK   F+S IALYGD +VVN   ++
Sbjct  2    ASLPFSKHLAAFVLLIFFLQPSAADSNSSFSFTEFGKGPKFESNIALYGDAEVVNGGYAV  61

Query  520  EIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            ++  S  S  AGR M KKPIKL EGKP+K VSFST F+FS+S  +GDGLAFVM+
Sbjct  62   QLTSSVRS-SAGRAMYKKPIKLSEGKPQKSVSFSTNFSFSVSTGNGDGLAFVMV  114



>ref|XP_006576579.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Glycine max]
 gb|KHN27007.1| L-type lectin-domain containing receptor kinase VIII.2 [Glycine 
soja]
Length=350

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 70/110 (64%), Gaps = 0/110 (0%)
 Frame = +1

Query  349  PKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEID  528
            P   YF AF F  L  K ++ DP   F++  FGKD  F   +AL+G+ KV+N+   I   
Sbjct  5    PTSHYFRAFTFSILFLKTLAFDPIPLFSYAGFGKDLKFKPNVALFGNAKVLNEGSGIHFS  64

Query  529  GSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            G   S G GRIM KKPIKL +GKPR+ VSFSTYFAFS+S   G GLAFVM
Sbjct  65   GFGSSRGTGRIMYKKPIKLSQGKPRQLVSFSTYFAFSVSLEDGGGLAFVM  114



>ref|XP_007133954.1| hypothetical protein PHAVU_010G006300g [Phaseolus vulgaris]
 gb|ESW05948.1| hypothetical protein PHAVU_010G006300g [Phaseolus vulgaris]
Length=348

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = +1

Query  331  MASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDS  510
            MA++S P   YF  F F  L  K ++ DP   F++  FGKD  F   +ALYG+ KVVND 
Sbjct  1    MAALSTP--HYFRVFTFSVLFLKTLAFDPIPLFSYAGFGKDLKFKPNVALYGNAKVVNDG  58

Query  511  LSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
              I   GS  S   GR+M KKPIKL +GKPR+ VS STYFAFS+S   G GLAFVM+
Sbjct  59   SGIHFSGSG-SSDTGRVMYKKPIKLFQGKPRQLVSISTYFAFSISLDMGGGLAFVMV  114



>ref|XP_007026824.1| Concanavalin A-like lectin family protein, putative [Theobroma 
cacao]
 gb|EOY07326.1| Concanavalin A-like lectin family protein, putative [Theobroma 
cacao]
Length=358

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            YF    F+   FK ++AD + SF+FK+FGKD NF S IALYGD +V ND   +++  S +
Sbjct  9    YFTVLTFIIFHFKILAADQSSSFSFKSFGKDPNFVSNIALYGDARVANDGSWVQLTNS-V  67

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            S  AG++M KKPIKLVEGK R   SFSTYF+FS+S  +GDGLAFVM+
Sbjct  68   SGSAGKVMYKKPIKLVEGKVRNFASFSTYFSFSMSHENGDGLAFVMV  114



>gb|KJB76858.1| hypothetical protein B456_012G110400 [Gossypium raimondii]
Length=359

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
             Y  A   L    K ++A+ + SF+FK FGKD  F+S IALYGD  V ND   +++  S 
Sbjct  8    NYLTALTCLVFFSKILAAEQSSSFSFKIFGKDPKFESNIALYGDAHVGNDGSWVQLTNS-  66

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +S  AG +M KKPIKLV+GK RK  SFSTYF+FS+S  +GDGLAF+M+
Sbjct  67   VSWSAGAVMYKKPIKLVQGKVRKLASFSTYFSFSMSHKNGDGLAFIMV  114



>ref|XP_009358820.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Pyrus x bretschneideri]
Length=351

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
             +F A  FL    +  S   N SF+F +FGK SNF S IALYGD +VVN   ++++  S 
Sbjct  8    HHFAAVAFLIFFLRTTSTASNSSFSFTHFGKVSNFGSDIALYGDAEVVNGGYAVQLT-SS  66

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +S  AGR + KKP+KL EGKPRK VSFST F+FS+S   GDGLA V++
Sbjct  67   VSSSAGRAVYKKPMKLYEGKPRKSVSFSTNFSFSISNGGGDGLAIVVV  114



>ref|XP_009370238.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Pyrus x bretschneideri]
 ref|XP_009370254.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Pyrus x bretschneideri]
Length=349

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            +F+A  FL    +  SA  N SF+  +FG+ SNF S IALYGD +VVN   ++++  S +
Sbjct  9    HFVAVAFLVFFLRTTSAACNSSFSVTHFGEVSNFGSDIALYGDAEVVNGGYAVQLT-SSV  67

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            S  AGR + K+PI+L EGKPRK VSFST F+FS+S   GDGLAFV++
Sbjct  68   SSSAGRAIYKRPIELFEGKPRKSVSFSTNFSFSISNGGGDGLAFVVV  114



>ref|XP_010256728.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Nelumbo nucifera]
Length=359

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            RY L+  F   CF   +A+   SF+ K F  +  F S +AL+GD +VVN   S+ +  S 
Sbjct  8    RYPLSLAFFIFCFVTTAAEQISSFSLKKFETNPIFGSQVALFGDAEVVNGGYSVNVTRSS  67

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +   AGR+M K+PIKLVEG PRK VSFSTYF+FS+S  +GDG+AFV+L
Sbjct  68   IL-SAGRLMYKQPIKLVEGNPRKGVSFSTYFSFSISPDNGDGIAFVLL  114



>ref|XP_002276782.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Vitis vinifera]
Length=358

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            Y      +   F+ +SA P LSF+  +FGKD +F+S  ALYGD KVVN   S+++ G   
Sbjct  9    YLTTLSLIVFFFRALSAVPILSFSLNSFGKDPSFESDFALYGDAKVVNGGSSVQLSGPAS  68

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            S  AGR + K+P+++VEG PR  VSFSTYF+FS+S  +G GLAF +
Sbjct  69   S-SAGRFVYKRPVRVVEGNPRNSVSFSTYFSFSMSPGNGGGLAFAV  113



>ref|XP_012087950.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Jatropha curcas]
 gb|KDP24510.1| hypothetical protein JCGZ_25074 [Jatropha curcas]
Length=359

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 77/115 (67%), Gaps = 11/115 (10%)
 Frame = +1

Query  367  LAFFFLSLCF---------KFMSADPNLSFAFKNFGKDSNFDSLIALYGDT-KVVNDSLS  516
            +A F +S CF         K +SA+PN SF+F +F K+ +F+S IALYGD    VN+   
Sbjct  1    MAVFSISSCFIALNFFFHLKMLSANPNSSFSFLSFEKNPSFESDIALYGDAANAVNNGSV  60

Query  517  IEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +++  S +S  AGR++ KKPIKLVEG P   VSFSTYF+F +S  +GDGLAFVML
Sbjct  61   LQLTRS-VSSSAGRVLYKKPIKLVEGNPVNLVSFSTYFSFLMSPDNGDGLAFVML  114



>ref|XP_004302660.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Fragaria vesca subsp. vesca]
Length=349

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +1

Query  370  AFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPG  549
            +F  L    +  ++D N SF+F  FGKD +F+S I+LYGD KVVN S+ +    S +S  
Sbjct  12   SFALLIFILRASASDTNSSFSFTKFGKDPSFESSISLYGDAKVVNGSIQLT---SSVSSS  68

Query  550  AGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            AGR M KK +KL EGKP+K VSFS++F  S+S+  GDGLAFV++
Sbjct  69   AGRGMYKKALKLGEGKPKKSVSFSSHFTLSMSKEDGDGLAFVIV  112



>ref|XP_004492393.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Cicer arietinum]
Length=362

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 2/109 (2%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
             +F       L  K  S DP  SF+F +FGKD  F S++ LYG+ KVVN    + + G E
Sbjct  8    HHFTILTLFILFLKIQSFDPVSSFSFTDFGKDPRFKSIVGLYGNAKVVNGGSEVLLSGYE  67

Query  538  MSPGAGRIMSKKPIKLVEG-KPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
             S G+G+IM KK IKLVEG +P+  VSFSTYF+FS+S   G+GLAFVM+
Sbjct  68   NS-GSGKIMYKKSIKLVEGGEPKTLVSFSTYFSFSMSLGDGNGLAFVMV  115



>ref|XP_003529134.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Glycine max]
Length=354

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 76/123 (62%), Gaps = 9/123 (7%)
 Frame = +1

Query  319  PRSRMASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKV  498
            P S MA  S     +F AF FL L  K  + DP  SF+F +F KD NF S + LYG+ KV
Sbjct  2    PTSIMAPFSTS--HHFTAFTFLILFLKTQAFDPLSSFSFTDFQKDPNFKSSVGLYGNAKV  59

Query  499  VNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGD--GLAF  672
            V +   + + G+    G GR+M KKP KLV G+ R+ VSFSTYF FS+S L G+  GLAF
Sbjct  60   VYNGSEVLLSGN----GGGRVMYKKPFKLVHGEARELVSFSTYFGFSMS-LDGEKNGLAF  114

Query  673  VML  681
            VM+
Sbjct  115  VMV  117



>gb|AFK44294.1| unknown [Lotus japonicus]
Length=359

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
             +F A  FL    K  ++D   SFAF NFGKD  F+S + LYG+ ++VN    + + G  
Sbjct  8    HHFTALTFLIFFLKTQASDSVSSFAFTNFGKDPKFNSSVGLYGNARLVNGGSQVFLSGYG  67

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
             S G+G++M KKPIKLV+G  R  VSF TYFAFS+S   G+GLAFV++
Sbjct  68   NS-GSGKVMYKKPIKLVDGNARGCVSFQTYFAFSISLDDGNGLAFVLV  114



>gb|KHN28781.1| L-type lectin-domain containing receptor kinase VIII.2 [Glycine 
soja]
Length=359

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 75/122 (61%), Gaps = 7/122 (6%)
 Frame = +1

Query  319  PRSRMASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKV  498
            P S MA  S     +F AF FL L  K  + DP  SF+F +F KD NF S + LYG+ KV
Sbjct  2    PTSIMAPFSTS--HHFTAFTFLILFLKTQAFDPLSSFSFTDFQKDPNFKSSVGLYGNAKV  59

Query  499  VNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLS-GDGLAFV  675
            V +   + + G+    G GR+M KKP KLV G+ R+ VSFSTYF FS+S  S  +GLAFV
Sbjct  60   VYNGSEVLLSGN----GGGRVMYKKPFKLVHGEARELVSFSTYFGFSMSLDSEKNGLAFV  115

Query  676  ML  681
            M+
Sbjct  116  MV  117



>gb|ACU17688.1| unknown [Glycine max]
Length=169

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            YF AF F  L  K ++ DP   F +  FGKD  F   +AL+G+ KV+N+   I   GS  
Sbjct  10   YFRAFTFSILFLKTLAFDPIPLFYYAGFGKDLKFTPNVALFGNAKVLNEGSGIHFSGSGS  69

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            S   GR+M KKPIKL +GKPR+ VSFSTYFAFS+S   G GLAFVM
Sbjct  70   SGDTGRVMYKKPIKLFQGKPRQLVSFSTYFAFSVSLEDGGGLAFVM  115



>gb|KHN26218.1| L-type lectin-domain containing receptor kinase I.7 [Glycine 
soja]
Length=348

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            YF AF F  L  K ++ DP   F +  FGKD  F   +AL+G+ KV+N+   I   GS  
Sbjct  10   YFRAFTFSILFLKTLAFDPIPLFYYAGFGKDLKFTPNVALFGNAKVLNEGSGIHFSGSGS  69

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            S   GR+M KKPIKL +GKPR+ VSFSTYFAFS+S   G GLAFVM
Sbjct  70   SGDTGRVMYKKPIKLFQGKPRQLVSFSTYFAFSVSLEDGGGLAFVM  115



>ref|XP_003516924.1| PREDICTED: L-type lectin-domain containing receptor kinase I.7-like 
[Glycine max]
Length=348

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            YF AF F  L  K ++ DP   F +  FGKD  F   +AL+G+ KV+N+   I   GS  
Sbjct  10   YFRAFTFSILFLKTLAFDPIPLFYYAGFGKDLKFTPNVALFGNAKVLNEGSGIHFSGSGS  69

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            S   GR+M KKPIKL +GKPR+ VSFSTYFAFS+S   G GLAFVM
Sbjct  70   SGDTGRVMYKKPIKLFQGKPRQLVSFSTYFAFSVSLEDGGGLAFVM  115



>ref|XP_008356989.1| PREDICTED: leucoagglutinating phytohemagglutinin-like [Malus 
domestica]
Length=183

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +1

Query  340  VSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSI  519
            V+     +F+A  FL    +      N SF+F +F K SNF S IALYGD +VVN   ++
Sbjct  2    VASSISTHFVALDFLVFFLRTTFTASNSSFSFTDFDKVSNFGSYIALYGDAEVVNGRYAV  61

Query  520  EIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            ++  S MS   GR + KKPI+L EGKP K VSF T F FS+    GDGL FVM+
Sbjct  62   QLT-SSMSSSVGRAIYKKPIELYEGKPWKSVSFLTNFLFSIYNGGGDGLTFVMV  114



>gb|KEH23081.1| legume lectin beta domain protein [Medicago truncatula]
Length=352

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            + + F  L LC K  + DP  SF+F +FGKD NF S++  YG+ KVVN    + + G   
Sbjct  5    FIIPFTILILCLKIHAFDPVSSFSFNDFGKDPNFKSVLGFYGNAKVVNGGSEVLLSGYGD  64

Query  541  SPGAGRIMSKKPIKL--VEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            S G G++M KKPI++  VE +P+  VSFS+YF FSLS   G+GLAFVM+
Sbjct  65   S-GNGKVMYKKPIRVVDVEDEPKLLVSFSSYFEFSLSFGDGNGLAFVMV  112



>ref|XP_008379889.1| PREDICTED: leucoagglutinating phytohemagglutinin-like [Malus 
domestica]
Length=183

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +1

Query  340  VSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSI  519
            V+     +F+A  FL    +      N SF+F +F K SNF S IALYGD +VVN   ++
Sbjct  2    VASXISTHFVALDFLVFFLRTTFTASNSSFSFTDFDKVSNFGSYIALYGDAEVVNGRYAV  61

Query  520  EIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            ++  S MS   GR + KKPI+L EGKP K VSF T F FS+    GDGL FVM+
Sbjct  62   QLT-SSMSSSVGRAIYKKPIELYEGKPWKSVSFLTNFLFSIYNGGGDGLTFVMV  114



>ref|XP_008370040.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Malus domestica]
Length=349

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            +F+A  FL    +  SA  N SF+F +FGK SNF S IALYGD +VVN   ++++  S +
Sbjct  9    HFVAVAFLVFFLRTTSAASNSSFSFTHFGKVSNFGSDIALYGDAEVVNGGYAVQLT-SSV  67

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            S  AGR + K PI+L EGKPRK VSFST F+FS+S   GDGLAFV++
Sbjct  68   SSSAGRAIYKIPIELYEGKPRKSVSFSTNFSFSISNGGGDGLAFVVV  114



>ref|XP_006480935.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Citrus sinensis]
Length=360

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            RYF     L   F+ ++ADP+ SF+FK+FGK S+ +S IALYGD KVVN    +++  S 
Sbjct  8    RYFATLTLLIFHFQVLNADPSSSFSFKSFGKGSHLESSIALYGDAKVVNGGSVVQLTDS-  66

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +S  AGR+M KKPIKLVEG      SFST F+FS+S+ +GDGLAF+M+
Sbjct  67   VSSSAGRVMYKKPIKLVEGNTGNLASFSTNFSFSMSKENGDGLAFIMV  114



>ref|XP_003552217.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Glycine max]
Length=358

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 73/122 (60%), Gaps = 8/122 (7%)
 Frame = +1

Query  319  PRSRMASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKV  498
            P S MA  S     +F AF FL L  K  + DP   F+F +F KD NF S + LYG+ KV
Sbjct  2    PTSIMAPFSTSP--HFTAFTFLILFLKTQAFDPLSFFSFTDFEKDPNFKSSVGLYGNAKV  59

Query  499  VNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLS-GDGLAFV  675
            VN+   + + G+      GR++ KKP+KLV G  R+ VSFSTYF FS+S  S   GLAFV
Sbjct  60   VNNGSEVLLSGN-----GGRVIYKKPVKLVHGGARELVSFSTYFGFSMSLDSEKSGLAFV  114

Query  676  ML  681
            M+
Sbjct  115  MV  116



>ref|XP_006429260.1| hypothetical protein CICLE_v10012045mg [Citrus clementina]
 gb|ESR42500.1| hypothetical protein CICLE_v10012045mg [Citrus clementina]
Length=360

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            RYF     L   F+ ++ADP+ SF+FK+FGK S+ +S IALYGD KVVN    +++  S 
Sbjct  8    RYFATLTLLIFHFQVLNADPSSSFSFKSFGKGSHLESSIALYGDAKVVNGGSVVQLTDS-  66

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +S  AGR+M KKPIKLVEG      SFST F+FS+S+ +GDGLAF+M+
Sbjct  67   VSSSAGRVMYKKPIKLVEGNTGNLASFSTNFSFSMSKENGDGLAFIMV  114



>gb|KDO58027.1| hypothetical protein CISIN_1g018168mg [Citrus sinensis]
Length=360

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            RYF     L   F+ ++ADP+ SF+FK+FGK S+ +S IALYGD KVVN    +++  S 
Sbjct  8    RYFATLTLLIFHFQVLNADPSSSFSFKSFGKGSHLESSIALYGDAKVVNGGSVVQLTDS-  66

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +S  AGR+M KKPIKLVEG      SFST F+FS+S+ +GDGLAF+M+
Sbjct  67   VSSSAGRVMYKKPIKLVEGNTGNLASFSTNFSFSMSKENGDGLAFIMV  114



>ref|XP_010101839.1| putative inactive L-type lectin-domain containing receptor kinase 
III.1 [Morus notabilis]
 gb|EXB89976.1| putative inactive L-type lectin-domain containing receptor kinase 
III.1 [Morus notabilis]
Length=355

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 6/81 (7%)
 Frame = +1

Query  439  NFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSF  618
             F KD  F+S +A YGD+KVVN   ++++  S      GR++ KKPIKLVEGKP+K VSF
Sbjct  36   QFAKDLKFESRVAFYGDSKVVNGGSAVQLTSS------GRVIYKKPIKLVEGKPQKLVSF  89

Query  619  STYFAFSLSRLSGDGLAFVML  681
            ST F+FSLS+  G+GLAFVML
Sbjct  90   STNFSFSLSQGDGNGLAFVML  110



>ref|XP_003604815.1| Lectin [Medicago truncatula]
 gb|AES87012.1| legume lectin beta domain protein [Medicago truncatula]
Length=350

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            YF +  F+ L  K +S DP   F+F +F KD  F S + ++G+ KVVN    I+  G   
Sbjct  9    YFKSLIFIILFIKTLSFDPIPLFSFADFEKDLKFKSNVEIFGNAKVVNGESKIQFSGE--  66

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
               +GR++ KKPIK+ +GKP++ VSFSTYF FS+S  +  GLAFVM+
Sbjct  67   ---SGRVIYKKPIKVFQGKPKQLVSFSTYFTFSISMENEGGLAFVMI  110



>emb|CDP06531.1| unnamed protein product [Coffea canephora]
Length=352

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 72/117 (62%), Gaps = 4/117 (3%)
 Frame = +1

Query  331  MASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVN-D  507
            M SVS    RY ++   L L F+ + AD N+SFA +   K  NF+SL A YGD K V+  
Sbjct  1    MTSVSAS--RYLISIALLLLYFEIVYADFNVSFASEKVDKGPNFESLFAFYGDAKFVSGH  58

Query  508  SLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
              S+++ GS ++P AG ++ K+PIKL E   RK VSF   F FSLS  +GDGLAF M
Sbjct  59   DKSVQLSGS-VAPSAGTVLYKEPIKLFERNSRKMVSFVMNFVFSLSSENGDGLAFAM  114



>ref|XP_010262713.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Nelumbo nucifera]
Length=357

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = +1

Query  424  SFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPR  603
            SF+   F  + +FDS I L+GD ++VN   S+ I  S +   AGR+M   P+KLVEG PR
Sbjct  30   SFSLNKFEANPSFDSNITLFGDAEIVNGGSSVNITRSTIL-SAGRLMHSLPVKLVEGNPR  88

Query  604  KXVSFSTYFAFSLSRLSGDGLAFVML  681
            K VSFSTYF+FS+S  +GDGLAFV+L
Sbjct  89   KGVSFSTYFSFSISPENGDGLAFVLL  114



>ref|XP_004506648.1| PREDICTED: L-type lectin-domain containing receptor kinase I.7-like 
[Cicer arietinum]
Length=367

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
             YF     + L  K  S DP   F+F +F KD  F S +AL+GD KVVN    I+  GS 
Sbjct  8    HYFKTLIVIILFIKTQSFDPIPLFSFADFEKDLKFKSNVALFGDAKVVNGESKIQFYGS-  66

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
             S   GR++ KKPI+L +GKP + VSFSTYF FS+   +G GL FVM+
Sbjct  67   -STEIGRVIYKKPIQLFQGKPNQLVSFSTYFTFSIPFENGGGLDFVMI  113



>gb|KHN08323.1| L-type lectin-domain containing receptor kinase VIII.2 [Glycine 
soja]
Length=358

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 72/122 (59%), Gaps = 8/122 (7%)
 Frame = +1

Query  319  PRSRMASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKV  498
            P S MA  S     +F AF FL L  K  + DP   F+F +F KD NF S + LYG+ KV
Sbjct  2    PTSIMAPFSTSP--HFTAFTFLILFLKTQAFDPLSFFSFTDFEKDPNFKSSVGLYGNAKV  59

Query  499  VNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLS-GDGLAFV  675
            VN+   + + G+      GR++ KKP+KLV    R+ VSFSTYF FS+S  S   GLAFV
Sbjct  60   VNNGSEVLLSGN-----GGRVIYKKPVKLVHSGARELVSFSTYFGFSMSLDSEKSGLAFV  114

Query  676  ML  681
            M+
Sbjct  115  MV  116



>ref|XP_007140433.1| hypothetical protein PHAVU_008G111500g [Phaseolus vulgaris]
 gb|ESW12427.1| hypothetical protein PHAVU_008G111500g [Phaseolus vulgaris]
Length=356

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
             +F  F FL    K  + DP  SF+F +F KD  F S + LYG+ KV+N    + + G+ 
Sbjct  13   HHFTVFTFLIFFLKAQAFDPLSSFSFADFEKDPKFKSSVELYGNAKVMNGGAGVLLSGN-  71

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDG-LAFVML  681
                +GRIM KKPIKLV+G  R+ VSFSTY  FS+S  SG G LAFVM+
Sbjct  72   ----SGRIMYKKPIKLVQGGARELVSFSTYVGFSMSLDSGKGSLAFVMV  116



>ref|XP_002308200.2| alpha-amylase inhibitor alpha subunit family protein [Populus 
trichocarpa]
 gb|EEE91723.2| alpha-amylase inhibitor alpha subunit family protein [Populus 
trichocarpa]
Length=356

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  448  KDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTY  627
            KD NF+S IALYGD KVV +S S+++    +S  AGR+M K+PIKLVEG P   VSFSTY
Sbjct  38   KDPNFESSIALYGDAKVVGNSSSLQLT-RPVSLSAGRVMYKQPIKLVEGNPGNLVSFSTY  96

Query  628  FAFSLSRLSGDGLAFVML  681
            F+F +S  +GDGLAFV++
Sbjct  97   FSFLMSPDNGDGLAFVVV  114



>ref|XP_011019177.1| PREDICTED: lectin-like protein At1g53070 [Populus euphratica]
Length=356

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  448  KDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTY  627
            KD NF+S IALYGD KVV +S S+++    +S  AGR+M K+PIKLVEG P   VSFSTY
Sbjct  38   KDPNFESSIALYGDAKVVGNSSSLQLT-RPVSLSAGRVMYKQPIKLVEGNPGNLVSFSTY  96

Query  628  FAFSLSRLSGDGLAFVML  681
            F+F +S  +GDGLAFV++
Sbjct  97   FSFLMSPDNGDGLAFVVV  114



>ref|XP_008388104.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Malus domestica]
 ref|XP_008359775.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Malus domestica]
Length=351

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
             +F A  FL    +  SA  N SF+F  FGK SNF S IALYGD +VVN   ++++  S 
Sbjct  8    HHFAAVAFLIFXLRTTSAASNSSFSFXXFGKVSNFGSDIALYGDAEVVNGGYAVQLT-SS  66

Query  538  MSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +S  AGR + KKP+KL EGKPRK VSF T F+FS+S   GDGLAFV++
Sbjct  67   VSSSAGRAVYKKPMKLYEGKPRKSVSFLTNFSFSISNGGGDGLAFVVV  114



>ref|NP_001154599.1| putative lectin [Arabidopsis thaliana]
 gb|AEE74735.1| putative lectin [Arabidopsis thaliana]
Length=345

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +1

Query  376  FFLSLCFKFM-SADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGA  552
            F + LCF+   +A  + +F+F  F K  +FD  +AL+GD+K+VNDS SI++  S ++   
Sbjct  9    FLVLLCFEIHGTAGVDFTFSFDEFVKSQSFDKSVALFGDSKLVNDSSSIQLTDS-VNRTE  67

Query  553  GRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            GR+  KKPI L +GK R  V FSTYF+FS+    GD LAFVM+
Sbjct  68   GRVFYKKPINLFQGKERNSVIFSTYFSFSMPNEIGDVLAFVMV  110



>ref|XP_002322948.1| alpha-amylase inhibitor alpha subunit family protein [Populus 
trichocarpa]
 gb|EEF04709.1| alpha-amylase inhibitor alpha subunit family protein [Populus 
trichocarpa]
Length=355

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +1

Query  331  MASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVV-ND  507
            MA  + P     L F    L  K ++A  + SF+F+ F K+ NF S IALYGD KVV N 
Sbjct  1    MAKFNIPACLTVLTFMISHL--KMLNAGSSYSFSFETFDKNPNFQSNIALYGDAKVVGNG  58

Query  508  SLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            SL +   GS     AGR+M K+PIKLVEG     VSFST F+F +S   GDGLAF ++
Sbjct  59   SLQLTRAGSS---SAGRVMYKQPIKLVEGISGNMVSFSTNFSFLMSTDDGDGLAFFLV  113



>ref|XP_011009155.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 
[Populus euphratica]
Length=355

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +1

Query  331  MASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVV-ND  507
            MA  + P     L F    L  K ++A  + SF+F+ F K+ NF S IALYGD KVV N 
Sbjct  1    MAKFNIPTCLTVLTFMISHL--KMLNAGSSYSFSFETFDKNPNFQSNIALYGDAKVVGNG  58

Query  508  SLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            SL +      +S  AGR+M K+PIKLVEG     VSFST F+F +S   GDGLAF ++
Sbjct  59   SLQLT---RAVSSSAGRVMYKQPIKLVEGISGNMVSFSTNFSFLMSTDDGDGLAFFLV  113



>ref|XP_010037751.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7 [Eucalyptus grandis]
 gb|KCW49484.1| hypothetical protein EUGRSUZ_K03005 [Eucalyptus grandis]
Length=365

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 4/109 (4%)
 Frame = +1

Query  355  PRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVN-DSLSIEIDG  531
            P   LA   +SL    ++ DP  SF+F+ F KD+ F+S +ALYGD KVV+    S+++ G
Sbjct  19   PLSALALVVVSL--GALADDPGPSFSFRGFAKDAYFESNVALYGDAKVVSAGGSSVQLTG  76

Query  532  SEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            +   P AG +  ++PIK+V+G P   VSFST+FAFSLS   GDG AF +
Sbjct  77   AG-GPSAGAVAYRRPIKIVQGNPENLVSFSTHFAFSLSGGGGDGFAFAL  124



>ref|XP_010558351.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Tarenaya hassleriana]
Length=359

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 13/111 (12%)
 Frame = +1

Query  367  LAF--FFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVND-----SLSIEI  525
            LAF  FFL +    ++AD N SF F  FG+   F   IAL+GD+KVVN       L+  +
Sbjct  7    LAFIVFFLEIS-GILAADGNSSFTFNGFGQSRIFVEDIALFGDSKVVNGGGSSIQLTDSV  65

Query  526  DGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
             GSE     GR++ +KPI+L  GK R   SFSTYF+FS+S   G  +AFVM
Sbjct  66   SGSE-----GRVIYRKPIQLFGGKERNSCSFSTYFSFSMSSKIGGVMAFVM  111



>ref|XP_006398654.1| hypothetical protein EUTSA_v10013972mg [Eutrema salsugineum]
 gb|ESQ40107.1| hypothetical protein EUTSA_v10013972mg [Eutrema salsugineum]
Length=352

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 8/111 (7%)
 Frame = +1

Query  367  LAFFFLSLCFKF----MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            LAF F+ LCFK      +AD N S +F  F K   FD  + L+GD+K+VN   SI++ GS
Sbjct  7    LAFLFV-LCFKIYETMAAADGNSSISFSGFVKSPGFDKNVGLFGDSKLVNGGSSIQLTGS  65

Query  535  EMSPGAGRIMSKKPIKLVEGKPRK-XVSFSTYFAFSL-SRLSGDGLAFVML  681
             +S   GR++  KPIKL +GK R    SFST F+FS+ S+  G  LAFVM+
Sbjct  66   -VSRSQGRVIYIKPIKLFQGKERNFSGSFSTNFSFSMSSKEIGSVLAFVMV  115



>emb|CDY07898.1| BnaC03g36250D [Brassica napus]
Length=346

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = +1

Query  367  LAFFFLSLCFKFM----SADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            L+F F+ LCFK      +   N SF+F  F K   FD  ++L+GD+K+V+ + SI++  S
Sbjct  7    LSFLFV-LCFKIHGTMATTHENSSFSFDGFAKSPTFDKDVSLFGDSKLVSSTSSIQLTDS  65

Query  535  EMSPGAGRIMSKKPIKLVEGKPRK-XVSFSTYFAFSLSRLSGDGLAFVML  681
             +S   G ++ KKPIKL++GK R+  +SFST+F+FS+     D + FVM+
Sbjct  66   -VSGSVGGVLYKKPIKLLQGKERRNSLSFSTHFSFSMPNEISDVMGFVMV  114



>ref|XP_010543888.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like, 
partial [Tarenaya hassleriana]
Length=332

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = +1

Query  412  DPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVE  591
            +P L+  F  FG+  + D  IAL+GD+KVVN   SI++  S MS   GR+  +KPI+L  
Sbjct  2    EPPLT-TFNGFGQSPSSDEHIALFGDSKVVNGGSSIQLTDS-MSRSEGRVFYRKPIQLFG  59

Query  592  GKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            G+ R   SFST+F+FS+S  +G  LAFVM+
Sbjct  60   GEGRNSGSFSTHFSFSMSNKTGGALAFVMV  89



>ref|XP_010464556.1| PREDICTED: truncated lectin 2-like [Camelina sativa]
Length=337

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = +1

Query  376  FFLSLCFKFM-SADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGA  552
            F   LCF+   +A  +  F+F  F K  N    +A++GD+K+VNDS SI++  S +S   
Sbjct  9    FLFVLCFEIHGTAGEDFKFSFDGFVKSQN--KSVAMFGDSKLVNDSSSIQLTDS-VSGSV  65

Query  553  GRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            GR+  +KPI L  GK    V FSTYF+FS+    GD LAFVM+
Sbjct  66   GRVFYRKPINLFRGKEINLVVFSTYFSFSMPNEIGDVLAFVMV  108



>gb|AAD56334.1|AC009326_21 putative lectin [Arabidopsis thaliana]
Length=313

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +1

Query  454  SNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFA  633
             +FD  +AL+GD+K+VNDS SI++  S ++   GR+  KKPI L +GK R  V FSTYF+
Sbjct  4    QSFDKSVALFGDSKLVNDSSSIQLTDS-VNRTEGRVFYKKPINLFQGKERNSVIFSTYFS  62

Query  634  FSLSRLSGDGLAFVML  681
            FS+    GD LAFVM+
Sbjct  63   FSMPNEIGDVLAFVMV  78



>ref|XP_010469926.1| PREDICTED: truncated lectin 2-like isoform X1 [Camelina sativa]
Length=336

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = +1

Query  376  FFLSLCFKFM-SADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGA  552
            F   LCF+   +A  + +F+F  F K  N    +A++GD+K+VNDS SI++  S +S   
Sbjct  9    FLFVLCFEIHGTAGVDFTFSFGGFVKSQN--KSVAMFGDSKLVNDSSSIQLTDS-VSGSV  65

Query  553  GRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            GR+  +KPI L  GK    V FSTYF+FS+    GD LAFVM
Sbjct  66   GRVFYRKPINLFRGKEINLVIFSTYFSFSMPNDIGDVLAFVM  107



>ref|XP_002527882.1| Agglutinin-2 precursor, putative [Ricinus communis]
 gb|EEF34513.1| Agglutinin-2 precursor, putative [Ricinus communis]
Length=357

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 75/115 (65%), Gaps = 11/115 (10%)
 Frame = +1

Query  367  LAFFFLSLCF----------KFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLS  516
            +A F +S CF            +SAD + SF+F++F KD NFDS IALYGD   VN+   
Sbjct  1    MAAFSISACFICLSVSVFHFNLLSADQSSSFSFQSFHKDPNFDSNIALYGDASAVNNGSV  60

Query  517  IEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +++  S +S  AG IM KKPIKLVEG P   VSFS+Y +FS+S  +GDGLAFVM+
Sbjct  61   LQLTRS-VSSSAGHIMYKKPIKLVEGNPINLVSFSSYISFSMSSENGDGLAFVMV  114



>ref|XP_010672608.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7 [Beta vulgaris subsp. vulgaris]
Length=364

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = +1

Query  400  FMSADPNLSFAFKNFGKDSNF-DSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKP  576
            F+ A+ + SF FKNF K+S F DS IA YGD  +  +   +++  S  +  AGR+M K P
Sbjct  25   FLLAEASPSFGFKNFDKNSKFLDSQIAFYGDAMIDGNGSFVKMTQS-WNYSAGRVMYKIP  83

Query  577  IKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            IK +E    +  SF +YF+FSLS  +GDGL FVML
Sbjct  84   IKQLERNGGRKASFGSYFSFSLSSENGDGLVFVML  118



>emb|CDX73952.1| BnaA03g30950D [Brassica napus]
Length=346

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (61%), Gaps = 6/107 (6%)
 Frame = +1

Query  376  FFLSLCF----KFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMS  543
            FF +LCF       +   N SF+F  F K   F   ++L+GD+K+V+ + SI++  S +S
Sbjct  10   FFFALCFVSYGTMATTHENSSFSFDGFAKSQTFYKDVSLFGDSKLVSSTSSIQLTNS-VS  68

Query  544  PGAGRIMSKKPIKLVEGKPRK-XVSFSTYFAFSLSRLSGDGLAFVML  681
               G +  KKPIKL++GK R+  +SFST+F+FS+     D L FVM+
Sbjct  69   GSVGGVFYKKPIKLLQGKERRNSLSFSTHFSFSMPNEISDVLGFVMV  115



>ref|XP_009135075.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase VI.1 [Brassica rapa]
Length=346

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (61%), Gaps = 6/107 (6%)
 Frame = +1

Query  376  FFLSLCF----KFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMS  543
            FF +LCF       +   N SF+F  F K   F   ++L+GD+K+V+ + SI++  S +S
Sbjct  10   FFFALCFVSYGTMATTHENSSFSFDGFAKSQTFYKDVSLFGDSKLVSSTSSIQLTNS-VS  68

Query  544  PGAGRIMSKKPIKLVEGKPRK-XVSFSTYFAFSLSRLSGDGLAFVML  681
               G +  KKPIKL++GK R+  +SFST+F+FS+     D L FVM+
Sbjct  69   GSLGGVFYKKPIKLLQGKERRNSLSFSTHFSFSMPNEIADVLGFVMV  115



>ref|XP_010530423.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Tarenaya hassleriana]
Length=354

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 5/111 (5%)
 Frame = +1

Query  358  RYF--LAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDG  531
            RYF   A  F++       +D +  F+F++FGKD +F+S IA+YGD KVV+   SI++  
Sbjct  8    RYFAITAISFIAFFSGISLSDESPLFSFQSFGKDVSFESDIAMYGDAKVVDGDSSIQLTN  67

Query  532  SEMSPGAGRIMSKKPIKLVEGKPRK--XVSFSTYFAFSLSRLSGDGLAFVM  678
            S +S  +GR++ K PIKLVE  P      SFST+F+ S+S   G  L F +
Sbjct  68   S-VSYSSGRVVYKNPIKLVENDPEHPFPASFSTFFSLSMSPGHGSCLGFAV  117



>ref|XP_007205667.1| hypothetical protein PRUPE_ppa009494mg [Prunus persica]
 gb|EMJ06866.1| hypothetical protein PRUPE_ppa009494mg [Prunus persica]
Length=290

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query  358  RYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            R+  AF  L    +  +AD N SF+F  FGK   F+S IALYGD +VVN   ++++  S 
Sbjct  8    RHLAAFVLLIFFLQPSAADSNSSFSFTEFGKGPKFESNIALYGDAEVVNGGYAVQLTSSV  67

Query  538  MSPGAGRIMSKKPIKLVEGK  597
             S  AGR M KKPIKL EG 
Sbjct  68   RS-SAGRTMYKKPIKLTEGH  86



>ref|XP_002884719.1| hypothetical protein ARALYDRAFT_317721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60978.1| hypothetical protein ARALYDRAFT_317721 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +1

Query  460  FDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFS  639
            FD  +AL+GD+K+VN S SI++  S +S   GR+  +KPI L +GK R  V FSTYF+FS
Sbjct  6    FDKSVALFGDSKLVNVSSSIQLTDS-VSQSEGRVFYRKPIHLFKGKERNSVIFSTYFSFS  64

Query  640  LSRLSGDGLAFVML  681
            +    GD LAFVM+
Sbjct  65   MPNEIGDVLAFVMV  78



>ref|XP_010553259.1| PREDICTED: lectin-like protein At1g53070 [Tarenaya hassleriana]
Length=351

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  403  MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIK  582
            +S D +  F+F +FGKD +F+S IA++GD KVV+   SI++  S +S  +GR++ KKPIK
Sbjct  26   LSDDDSSRFSFPSFGKDVSFESDIAMHGDAKVVDGGSSIQLTDS-VSYSSGRVVYKKPIK  84

Query  583  LVEGKPR--KXVSFSTYFAFSLSRLSGDGLAFVM  678
            LV   P      SFST F+ S+SR  G  L FV+
Sbjct  85   LVANDPEFPFPASFSTSFSLSMSRDRGSCLGFVV  118



>ref|XP_010486461.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Camelina sativa]
Length=338

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 6/83 (7%)
 Frame = +1

Query  367  LAFFFLSLCFKF----MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            L+F FL LCF+     MSAD N +F+F  F K  +FD  +AL+GD+K+VNDS SI++  S
Sbjct  7    LSFMFL-LCFEILHGTMSADVNSTFSFNGFVKSPSFDKTVALFGDSKLVNDSSSIQLTDS  65

Query  535  EMSPGAGRIMSKKPIKLVEGKPR  603
             +S   GR+  ++PI L +GK R
Sbjct  66   -VSGSVGRVFYRQPINLFQGKER  87



>ref|XP_009354482.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Pyrus x bretschneideri]
Length=218

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +1

Query  409  ADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLV  588
            A  N SF++ NF K SNF S IALYGD +VVN   ++++  S +S    R + KKPI+L 
Sbjct  52   ATSNSSFSYTNFSKVSNFGSDIALYGDAEVVNGGYAVQLT-SLVSSSFDRAIYKKPIELY  110

Query  589  EGKPRKXVSFSTYFA  633
            EGKPRK +S  T F+
Sbjct  111  EGKPRKSMSLLTNFS  125



>ref|XP_010464536.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Camelina sativa]
Length=338

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 8/111 (7%)
 Frame = +1

Query  367  LAFFFLSLCFKF----MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            L+F FL LCF+     MSAD N +F+F  F K  +FD  +AL+GD+K+VNDS SI++  S
Sbjct  7    LSFLFL-LCFEILHGTMSADVNSTFSFNGFVKSPSFDKSVALFGDSKLVNDSSSIQLTDS  65

Query  535  EMSPGAGRIMSKKPIKLVEGKPR--KXVSFSTYFAFSLSRLSGDGLAFVML  681
             +S   GR+   KPI L +GK +  +  S    F+   S +  D LAFVM+
Sbjct  66   -VSGSVGRVFYSKPINLFQGKEKNLRSFSTHFSFSSMSSEIGDDVLAFVMV  115



>ref|XP_010486478.1| PREDICTED: lectin-like [Camelina sativa]
Length=336

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = +1

Query  406  SADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKL  585
            +A  + +F+F  F K  N    +A++GD+K+VN+S SI++  S +    GR+  +KPI L
Sbjct  20   TAGVDFTFSFDGFVKSQN--KSVAMFGDSKLVNESSSIQLTDS-VGGSVGRVFYRKPINL  76

Query  586  VEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
              GK    V FSTYF+FS+    GD LAFVM+
Sbjct  77   FHGKESNLVIFSTYFSFSMPNEIGDVLAFVMV  108



>ref|XP_009116095.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Brassica rapa]
 ref|XP_009120255.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Brassica rapa]
Length=339

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = +1

Query  406  SADPNLSFAFKNFGKDSNFDSL-IALYGDTKVVN--DSLSIEIDGSEMSPGAGRIMSKKP  576
            +++   SF F +FGK+S FDS  IAL+G+ K+++   S+SI+++ S +S  +GR++ KKP
Sbjct  23   TSEAKPSFTFTSFGKNSTFDSDDIALFGEAKLLDGGSSISIQVNDS-VSHNSGRVVYKKP  81

Query  577  IKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            IK VE K      FST+ AFS+S   G  L FV+
Sbjct  82   IKFVETKSEYPAGFSTFIAFSVSPDHGGRLGFVV  115



>ref|XP_010468550.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like 
[Camelina sativa]
Length=339

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 55/83 (66%), Gaps = 6/83 (7%)
 Frame = +1

Query  367  LAFFFLSLCFKF----MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            L+F FL LCF+     MSAD N +F+F  F K  +FD  +AL+GD+K+VNDS SI++  S
Sbjct  8    LSFLFL-LCFEILHGTMSADVNSTFSFNGFVKSPSFDKSVALFGDSKLVNDSSSIQLTDS  66

Query  535  EMSPGAGRIMSKKPIKLVEGKPR  603
             +S   GR+  ++PI L +GK +
Sbjct  67   -VSGSVGRVFYRQPINLFQGKEK  88



>ref|NP_683540.1| concanavalin A-like lectin [Arabidopsis thaliana]
 gb|AEE74712.1| concanavalin A-like lectin [Arabidopsis thaliana]
Length=338

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 7/110 (6%)
 Frame = +1

Query  367  LAFFFLSLCFKF---MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            L+F FL LCF+    ++AD N  F+F  F K  +FD  +AL+GD+K+VNDS  I++  S 
Sbjct  7    LSFLFL-LCFQIHGTVAADENSLFSFNGFVKSPSFDKRVALFGDSKLVNDSSLIQLTDS-  64

Query  538  MSPGAGRIMSKKPIKLVEGKPRK--XVSFSTYFAFSLSRLSGDGLAFVML  681
            ++   GR++ KKPI L +GK R     S    F+   + +  D LAFVM+
Sbjct  65   VTRSVGRVVYKKPINLFKGKQRNSRSFSTHFSFSSMSNEIGDDVLAFVMV  114



>ref|XP_002882602.1| legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58861.1| legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = +1

Query  367  LAFFFLSLCFKF---MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            L+F FL LCF+    MSA  N SF+F  F    +FD  +AL+GD+K+VNDS  I++  S 
Sbjct  7    LSFLFL-LCFQIHGTMSAAENSSFSFNGFAISPSFDKSVALFGDSKLVNDSSLIQLTDS-  64

Query  538  MSPGAGRIMSKKPIKLVEGKPR  603
            ++   GR++ KKPI L +GK R
Sbjct  65   VTRSVGRVVYKKPINLFQGKQR  86



>gb|KJB74194.1| hypothetical protein B456_011G278600 [Gossypium raimondii]
Length=341

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (58%), Gaps = 8/107 (7%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            Y  +F    L F F +A P  SFA +N   + NFD  I+L+GD +V N S ++ +  S  
Sbjct  9    YPFSFNLQILIFLFFTAKPVSSFALQN---NPNFDPYISLFGDARVENGSSNVILTRSH-  64

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +P +G ++  KP K V G+P   VSFST F FSLS  + DGLA V +
Sbjct  65   APSSGLLLLDKPFKFV-GEP---VSFSTEFTFSLSPGNADGLALVFV  107



>gb|EPS72516.1| hypothetical protein M569_02242 [Genlisea aurea]
Length=327

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 16/106 (15%)
 Frame = +1

Query  367  LAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSP  546
            L  F LS  F+ ++    LSF+ +NFGK S+FDS +AL G+ + VN + S+ I GS    
Sbjct  10   LGLFLLS--FRSVAQGNFLSFSVENFGKVSDFDSQVALLGNAEFVNGTNSVRISGS----  63

Query  547  GAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGD-GLAFVML  681
              GR++ K+P  L+       ++FST+ AFS   LSGD G  F+ML
Sbjct  64   --GRLICKRPFTLIT----NLIAFSTHIAFS---LSGDRGFDFLML  100



>ref|XP_010452027.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Camelina sativa]
Length=354

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 61/110 (55%), Gaps = 6/110 (5%)
 Frame = +1

Query  367  LAFFFLSLCFKF----MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            L F F+  CF+      +AD N SF F  F K  +FD  +AL+GD+K+V+   SI++  S
Sbjct  7    LGFLFVLCCFEIYQTMAAADANPSFLFNGFVKSPSFDENVALFGDSKLVDGGPSIQLTDS  66

Query  535  EMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSL-SRLSGDGLAFVML  681
             +S   GR++ K+PI+L +GK R      +     L +   G  LAFVM+
Sbjct  67   -VSRSEGRVVYKQPIRLFQGKERNFSGSFSTSFSFLMANEIGAVLAFVMV  115



>ref|XP_002873031.1| legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49290.1| legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
Length=351

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = +1

Query  367  LAFFFLSLCFKFMSA----DPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            LAF F  LCF    A    D N SF+F  F K  +FD  +AL+GD+K+VN   SI++  S
Sbjct  7    LAFLFF-LCFGIYQAVAVTDVNSSFSFNGFVKSPSFDKNVALFGDSKLVNGGPSIQLTDS  65

Query  535  EMSPGAGRIMSKKPIKLVEGKPR  603
             +S   GR++ KKPI+L +GK R
Sbjct  66   -VSRSEGRVIYKKPIRLFQGKER  87



>ref|XP_010423913.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Camelina sativa]
Length=354

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  LAFFFLSLCFKF----MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            LAF F+  CF+      +AD N SF F  F K  +FD  +AL+GD+K+V+   SI++  S
Sbjct  7    LAFLFVLCCFEIYQTMAAADANPSFLFNGFVKSPSFDENVALFGDSKLVDGGPSIQLTDS  66

Query  535  EMSPGAGRIMSKKPIKLVEGKPR  603
             +S   GR++ ++PI+L +GK R
Sbjct  67   -VSRSEGRVVYRQPIRLFQGKER  88



>ref|XP_009130668.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Brassica rapa]
Length=356

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 8/111 (7%)
 Frame = +1

Query  367  LAFFFLSLCFKFMS--ADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            LAF F+   F+ M+  +D N SF+F  F K  +F   IAL+GD+K+V+   SI++ GS +
Sbjct  7    LAFLFV-FSFETMATASDANSSFSFDGFVKSPSFHKNIALFGDSKLVSGGSSIQLTGS-V  64

Query  541  SPGAGRIMSKKPIKLVEGKPRKXV---SFSTYFAFSL-SRLSGDGLAFVML  681
            S   GR++  KPIKL +   +      SFST F+F++ S+  G  LAFVM+
Sbjct  65   SRSQGRVIYMKPIKLSQATTKGRSFPGSFSTSFSFTMPSKEFGSVLAFVMV  115



>ref|XP_011076752.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Sesamum indicum]
Length=358

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 15/112 (13%)
 Frame = +1

Query  355  PRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            P  FL+ FF  L F    + PN            +F S + L GD K  N+S  I++   
Sbjct  19   PLIFLSAFFSVLHFSL--SLPN----------KPHFGSNLVLIGDAKFANNSSCIQLTDH  66

Query  535  EMS-PGAGRIMSKKPIKLVEG--KPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            ++S P +G ++ KKPI+L+    K RK VSFST F FS+S  +GDGLAF+++
Sbjct  67   KISSPSSGFLIQKKPIRLLSSTTKSRKPVSFSTDFTFSISPHNGDGLAFLIV  118



>ref|XP_006403620.1| hypothetical protein EUTSA_v10010505mg [Eutrema salsugineum]
 gb|ESQ45073.1| hypothetical protein EUTSA_v10010505mg [Eutrema salsugineum]
Length=348

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +1

Query  424  SFAFKNFGKDSNFDSL-IALYGDTKVVN--DSLSIEIDGSEMSPGAGRIMSKKPIKLVEG  594
            SF+F +FGK  +FDS  I+LYGD K+V+   S+SI+++ S +S G G ++ KKPI+ VE 
Sbjct  32   SFSFTSFGKKPSFDSDDISLYGDAKLVDGGSSISIQLNDS-VSQGDGLVVYKKPIEFVET  90

Query  595  KPRKXVSFSTYFAFSLSRLSGDGLAFV  675
            +      FST+ +FS+S   G  L FV
Sbjct  91   ESEYPAGFSTFISFSISPSRGGRLGFV  117



>gb|KFK38290.1| hypothetical protein AALP_AA3G095000 [Arabis alpina]
Length=347

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = +1

Query  403  MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIK  582
            ++A  N SF+F  F K + FD  + L+GD+K+V++S SI++  S +S   GR+  KKPIK
Sbjct  21   IAAGWNSSFSFDGFVKSNRFDKKVGLFGDSKLVSNSSSIQMTDS-VSGSEGRVFYKKPIK  79

Query  583  LVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            L +GK R  VSFS+YF+FS+    GD L FVM+
Sbjct  80   LFKGKQRNSVSFSSYFSFSMPNEIGDVLGFVMV  112



>ref|XP_010490607.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Camelina sativa]
Length=357

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = +1

Query  367  LAFFFLSLCFKFMSA----DPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            LAF  +  CF+        D N SF F  F K  +FD  +AL+GD+K+VN   SI++  S
Sbjct  7    LAFLLVLCCFEIYQTMADTDANPSFLFNGFVKSPSFDENVALFGDSKLVNGGPSIQLTDS  66

Query  535  EMSPGAGRIMSKKPIKLVEGKPR  603
             +S   GR++ ++PI+L +GK R
Sbjct  67   -VSRSEGRVVYRQPIRLFQGKER  88



>ref|XP_002280264.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Vitis vinifera]
Length=343

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 62/105 (59%), Gaps = 12/105 (11%)
 Frame = +1

Query  367  LAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSP  546
            L F+FL+L     SA P  SF+F++F K S  DS IALYGD ++ ND  S+ +    ++ 
Sbjct  16   LVFWFLAL-----SAKPISSFSFQDFQKTS-VDSEIALYGDARISNDGSSVTLT-PPLAS  68

Query  547  GAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
              G +   +  +L+E       SFST F+FS+S  +GDGLA V+L
Sbjct  69   SFGLLAYNRGFRLLEA-----TSFSTDFSFSISPDNGDGLALVVL  108



>ref|XP_004147898.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Cucumis sativus]
 gb|KGN54345.1| hypothetical protein Csa_4G307380 [Cucumis sativus]
Length=373

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 6/81 (7%)
 Frame = +1

Query  442  FGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFS  621
            F  D  F+  +ALYGD  +V    ++++  S      GRI+  KPI+L+ GKPR+ +SFS
Sbjct  41   FHGDPQFELNVALYGDAALVGGG-ALQLASSS----GGRIIYNKPIRLLRGKPRRLMSFS  95

Query  622  TYFAFSLSRLSG-DGLAFVML  681
            T F+FSLS  +G +GL FV++
Sbjct  96   TDFSFSLSPNTGKNGLGFVIV  116



>emb|CDY44678.1| BnaA05g29280D [Brassica napus]
Length=353

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 5/109 (5%)
 Frame = +1

Query  367  LAFFFLSLCFKF---MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            L+F F+ LCF+    M+AD N SF+F  F K  + D  +AL GD+K+V+D  SI++  S 
Sbjct  7    LSFVFVLLCFEIHETMAADGNSSFSFDGFAKSPSLDKHVALSGDSKLVSDGSSIQLTDSV  66

Query  538  MSPGAGRIMSKKPIKLVEGKP-RKXVSFSTYFAFSLSRLSGDGLAFVML  681
                 G + +K PIKL++GK  R  +SFS+YF+FS+    GD +AFVM+
Sbjct  67   SGSVGGVVYTK-PIKLLQGKESRNSLSFSSYFSFSMPNEVGDVMAFVMV  114



>ref|XP_006296653.1| hypothetical protein CARUB_v10015712mg [Capsella rubella]
 gb|EOA29551.1| hypothetical protein CARUB_v10015712mg [Capsella rubella]
Length=338

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = +1

Query  367  LAFFFLSLCFKF---MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            L+  FLS CF+    M+AD + +F+F  F K   FD  +AL+GD+K+V D+  I++  S 
Sbjct  7    LSLLFLS-CFEIHGTMAADESSTFSFDGFVKSPTFDKSVALFGDSKLVTDTSLIQLTDS-  64

Query  538  MSPGAGRIMSKKPIKLVEGKPR  603
            +S   GR++ +KP+ L +GK R
Sbjct  65   VSGRVGRVVYRKPVSLFQGKER  86



>ref|XP_006288058.1| hypothetical protein CARUB_v10001288mg [Capsella rubella]
 gb|EOA20956.1| hypothetical protein CARUB_v10001288mg [Capsella rubella]
Length=353

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 58/110 (53%), Gaps = 7/110 (6%)
 Frame = +1

Query  367  LAFFFLSLCFKFM----SADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGS  534
            LAF F+ LCF+      + D N SF F  F K  +FD  +AL+GD+K++N   SI++  S
Sbjct  7    LAFLFV-LCFEIHHPMAAEDANSSFLFDGFVKSPSFDENVALFGDSKLLNGGPSIQLTDS  65

Query  535  EMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLS-GDGLAFVML  681
              S   GR++ + PI+L +GK R      +           G  LAFVM+
Sbjct  66   -ASRSEGRVVYRTPIRLFQGKERNFSGSFSTSFSFSMSSEIGSVLAFVMV  114



>ref|NP_195729.1| concanavalin A-like lectin [Arabidopsis thaliana]
 emb|CAB69837.1| lectin-like protein [Arabidopsis thaliana]
 dbj|BAF00398.1| lectin - like protein [Arabidopsis thaliana]
 gb|AED90298.1| concanavalin A-like lectin [Arabidopsis thaliana]
Length=353

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +1

Query  367  LAFFFLSLCFKFMS---ADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            LAF F+     + S    D N SF+F  F K  +FD+ +AL+GD+K+V+   SI++  S 
Sbjct  7    LAFLFVLSIVIYQSVAVTDVNSSFSFNGFVKAPSFDNNVALFGDSKLVHGGPSIQLTDS-  65

Query  538  MSPGAGRIMSKKPIKLVEGKPR  603
            +S   GR++ KKPI+L +GK R
Sbjct  66   VSRSEGRVIYKKPIRLFQGKER  87



>gb|AAM65643.1| lectin-like protein [Arabidopsis thaliana]
Length=353

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +1

Query  367  LAFFFLSLCFKFMS---ADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            LAF F+     + S    D N SF+F  F K  +FD+ +AL+GD+K+V+   SI++  S 
Sbjct  7    LAFLFVLSIVIYQSVAVTDVNSSFSFNGFVKAPSFDNNVALFGDSKLVHGGPSIQLTDS-  65

Query  538  MSPGAGRIMSKKPIKLVEGKPR  603
            +S   GR++ KKPI+L +GK R
Sbjct  66   VSRSEGRVIYKKPIRLFQGKER  87



>ref|XP_008785595.1| PREDICTED: putative L-type lectin-domain containing receptor 
kinase I.1 [Phoenix dactylifera]
Length=445

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 8/93 (9%)
 Frame = +1

Query  397  KFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKP  576
            K  +  P  SF F+ F K+ + D++IALYGD ++ +  + I       S   GR++ +KP
Sbjct  122  KVPAKGPAFSFRFERFEKNRSLDAVIALYGDAEISDFVVGITRPAVFSS---GRVVYRKP  178

Query  577  IKLVEGKPRKXVSFSTYFAFSLSRL-SGDGLAF  672
            ++ +   P    SFSTYFAFS+S    G+GLAF
Sbjct  179  VRFLGRNP----SFSTYFAFSVSSPDGGEGLAF  207



>ref|XP_008364444.1| PREDICTED: uncharacterized protein LOC103428122 [Malus domestica]
Length=122

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +1

Query  310  RLKPRSRMASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGD  489
            +L+P S  A+ S     +F+A  FL    K  SA  N SF+F +FGK SNF S IALY D
Sbjct  44   QLQPTSSXAASSIFT--HFVALAFLVFFLKTTSATSNSSFSFTDFGKVSNFXSDIALYED  101

Query  490  TKVVNDSLSIEIDGS  534
             +VVN    ++I  S
Sbjct  102  AEVVNGGYIVQITSS  116



>ref|XP_010923163.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Elaeis guineensis]
Length=350

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = +1

Query  376  FFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAG  555
             F  L  + +  +   SF F+ F K+ + D++IALYGD ++ +  + I       S   G
Sbjct  20   LFAGLHCESLGKNRAFSFRFERFEKNRSLDAVIALYGDAEISDSVVGITRPAVSSS---G  76

Query  556  RIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRL-SGDGLAF  672
            R++ +KP++ +   P     FSTYFAFS+S    G+GLAF
Sbjct  77   RVVYRKPVRFLGRNP----GFSTYFAFSVSSPGGGEGLAF  112



>ref|XP_010093501.1| Lysine histidine transporter 1 [Morus notabilis]
 gb|EXB54154.1| Lysine histidine transporter 1 [Morus notabilis]
Length=867

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 12/116 (10%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMS----ADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEID  528
            YF +F  L + F  ++    A P  +FA ++  K  NFD  IALYGD K+        + 
Sbjct  9    YFSSFSCLLILFSSLTLTLIAKPIFTFALQSPTKSLNFDYEIALYGDAKLEGGDGGASVR  68

Query  529  GSEMS-PGAGRIMSKKPIKLVE----GKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
             + +S P +G ++ +KP +L++    G P    SFST FAFS+S   G G+A V++
Sbjct  69   LTRLSVPSSGLLLRRKPFRLLDPNRLGNP---TSFSTDFAFSISPGDGGGVALVLV  121



>ref|XP_009146954.1| PREDICTED: uncharacterized protein LOC103870564 [Brassica rapa]
Length=354

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 5/109 (5%)
 Frame = +1

Query  367  LAFFFLSLCFKF---MSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSE  537
            L+F F+ LCF+    M+AD N SF+F  F K  + D  +AL GD+K+V+D  SI++  S 
Sbjct  7    LSFVFVLLCFEIHETMAADGNSSFSFDGFAKSPSLDKHVALSGDSKLVSDGSSIQLTDSV  66

Query  538  MSPGAGRIMSKKPIKLVEGKP-RKXVSFSTYFAFSLSRLSGDGLAFVML  681
                 G + +K PIKL++GK  R  +SFS+YF+FS+    G  +AFVM+
Sbjct  67   SGSVGGVVYTK-PIKLLQGKESRNSLSFSSYFSFSMPNEIGVVMAFVMV  114



>ref|XP_007009125.1| Concanavalin A-like lectin family protein, putative [Theobroma 
cacao]
 gb|EOY17935.1| Concanavalin A-like lectin family protein, putative [Theobroma 
cacao]
Length=355

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 8/111 (7%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            Y  +F      F F++A P  SFA +    + +F   I+L+GD +V +    + +     
Sbjct  9    YTFSFNLQIFIFLFLAAKPISSFAQQALDNNPSFSPHISLFGDARVEDGGSHVRLT-RPH  67

Query  541  SPGAGRIMSKKPIKLVE----GKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
            +P +G ++ +KP K  +    G+P    SF+  F+FSLS  +GDGLAFV++
Sbjct  68   APSSGLLLLEKPFKFADERNVGRP---TSFAAEFSFSLSPGNGDGLAFVLI  115



>gb|KFK34652.1| hypothetical protein AALP_AA5G173800 [Arabis alpina]
Length=341

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  472  IALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRL  651
            IALYG+ ++V+   SI+++ S +S   GR++ KKP+K +E K      FST F+FS+S  
Sbjct  46   IALYGNAELVDGGSSIQLNDS-VSHVGGRVVYKKPMKYIETKTEYSAGFSTEFSFSMSPS  104

Query  652  SGDGLAFVM  678
            SG  L FV+
Sbjct  105  SGGRLGFVV  113



>ref|XP_008448934.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Cucumis melo]
Length=372

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +1

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGD-GLAFVML  681
            S   GRI+ KKPI+L+ GKPR+ +SFST F+FSLS  SG+ GL FV++
Sbjct  69   SSSGGRIIYKKPIRLLRGKPRRLMSFSTDFSFSLSPNSGENGLGFVIV  116



>emb|CDY53094.1| BnaCnng24240D [Brassica napus]
Length=352

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 3/105 (3%)
 Frame = +1

Query  373  FFFLSLCFKFM-SADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPG  549
             F L LCF+   +   + SF+F  F K  + +  +AL+GD+K+ +D  SI++  S +S  
Sbjct  10   LFVLLLCFEIHGTMATSYSFSFDGFAKSPSLEKNVALFGDSKLFSDGSSIQLTES-VSGS  68

Query  550  AGRIMSKKPIKLVEGKP-RKXVSFSTYFAFSLSRLSGDGLAFVML  681
             GR++  KPIKL +GK  R   SFS+YF+FS+    GD +AFVM+
Sbjct  69   LGRVVYAKPIKLFQGKESRNSSSFSSYFSFSMPNEVGDVMAFVMV  113



>ref|XP_008233697.1| PREDICTED: lectin-like protein LEC [Prunus mume]
Length=354

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +1

Query  373  FFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGA  552
              FL   F F++  P  S + K+   + NFDS IAL+GD + V+    + I    +S  A
Sbjct  13   LIFLLSSFYFLTLQPISSSSLKSLNNNPNFDSEIALFGDAEPVDAGSYVNITRPSVS-SA  71

Query  553  GRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            G ++ +KP K ++       SFST F FS++  SGDGL  V+
Sbjct  72   GLLLRQKPFKFLDANLSSPTSFSTEFTFSMTPGSGDGLLLVL  113



>ref|XP_006407707.1| hypothetical protein EUTSA_v10022097mg, partial [Eutrema salsugineum]
 gb|ESQ49160.1| hypothetical protein EUTSA_v10022097mg, partial [Eutrema salsugineum]
Length=255

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  448  KDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTY  627
            K  ++D  + L+GD+K+VN   SI++  S +S   GR++  + IKL +GK +  +SFST 
Sbjct  5    KPMSYDKDVTLFGDSKLVNGGSSIQLTNS-VSGSEGRVVYMETIKLFQGKEKDSLSFSTA  63

Query  628  FAFSLSRLSGDGLAFVML  681
            F+FS+       LAFVM+
Sbjct  64   FSFSMRNEIDCVLAFVMV  81



>gb|EYU19968.1| hypothetical protein MIMGU_mgv1a007272mg [Erythranthe guttata]
Length=413

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +1

Query  460  FDSLIALYGDTKVVNDSLSIEIDGSEMS-PGAGRIMSKKPIKL--VEGKPRKXVSFSTYF  630
            F S + L GD +  N+S  I++   ++S P +G +   KPIKL     K R  +SFST F
Sbjct  97   FGSNLVLIGDARFTNNSSCIQLTNPKISSPSSGFLTQGKPIKLFSSNSKGRNPISFSTDF  156

Query  631  AFSLSRLSGDGLAFVML  681
             FS+S  +GDG+AF+++
Sbjct  157  TFSISPHNGDGMAFLVV  173



>emb|CDY11212.1| BnaA03g00480D [Brassica napus]
Length=354

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 60/97 (62%), Gaps = 6/97 (6%)
 Frame = +1

Query  406  SADPNLSFAFKNFGKDSNFDSLIALYGDTKVVN-DSLSIEIDGSEMSPGAGRIMSKKPIK  582
            ++D   SF+F  F K  +FD  IAL+GD+K+V+    SI++ GS +S   GR++  KPIK
Sbjct  18   ASDAISSFSFDGFVKSPSFDQNIALFGDSKLVSGGGSSIQLTGS-VSRSEGRVIYMKPIK  76

Query  583  LVEGKPRKXV---SFSTYFAFSL-SRLSGDGLAFVML  681
            L +   +      SFST F+F++ S+  G  LAFVM+
Sbjct  77   LSQATTKGRSFPGSFSTSFSFTMPSKEFGSVLAFVMV  113



>ref|XP_009103902.1| PREDICTED: uncharacterized protein LOC103829963 [Brassica rapa]
 emb|CDX67587.1| BnaA07g16270D [Brassica napus]
Length=340

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +1

Query  409  ADPNLSFAFKNFGKDSNFDSL-IALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKL  585
            ++   SF+F +F K+++F S  IALYGD K+V+   SI++  S +S   G ++ KKPI+ 
Sbjct  27   SEATSSFSFTSFDKNASFQSDDIALYGDAKLVDSGASIQLTNS-VSRIDGGVVYKKPIEC  85

Query  586  VEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
             + K      FST F+FS+S   G  + FV+
Sbjct  86   KDTKDDFFTGFSTVFSFSMSPGRGGSVGFVL  116



>ref|XP_007218209.1| hypothetical protein PRUPE_ppa007818mg [Prunus persica]
 gb|EMJ19408.1| hypothetical protein PRUPE_ppa007818mg [Prunus persica]
Length=354

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +1

Query  373  FFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGA  552
              FL   F F++  P  S + K+   + NFDS IAL+GD + V+    + I    +S  +
Sbjct  13   LIFLLSSFYFLTLQPISSSSLKSLNNNPNFDSEIALFGDAEPVDAGSYVNITRPSVS-SS  71

Query  553  GRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
            G ++ +KP K ++       SFST F FS++  SGDGL  V+
Sbjct  72   GLLLRQKPFKFLDANLSSPTSFSTEFTFSMTPGSGDGLLLVL  113



>emb|CDY07559.1| BnaC06g15050D [Brassica napus]
Length=335

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 5/117 (4%)
 Frame = +1

Query  331  MASVSCPKPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSL-IALYGDTKVVND  507
            MAS    +    L   F SL      ++   SF+F  F +++ F+S  I+LYGD K+V+ 
Sbjct  1    MASFILSRSFLVLLLTFTSLFSTISISEATSSFSFTRFDRNATFESDDISLYGDAKLVDG  60

Query  508  SLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVM  678
              SI++  S     +G +  KKPI+  + K      FST F+F +SR  G  +AFV+
Sbjct  61   GASIQLTDSV----SGGVFYKKPIESKDTKADFFTGFSTVFSFYMSRGRGGSVAFVV  113



>ref|XP_008381923.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Malus domestica]
Length=359

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 59/114 (52%), Gaps = 8/114 (7%)
 Frame = +1

Query  346  CPKPRYFL--AFFFLSLCFKFMSADPNLSFAFK--NFGKDSNFDSLIALYGDTKVVNDSL  513
            C  P  FL  +F+FL+L    + A+P  S   K  N   + NFDS IAL GD  +     
Sbjct  9    CNFPFIFLLSSFYFLTLT---LIAEPISSSGPKPLNNSSNPNFDSEIALLGDAALAGGGS  65

Query  514  SIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFV  675
             + +    +S  +G ++ +KP K ++G      SFST FAFS++   GDGL  V
Sbjct  66   YVNLTRPSVS-SSGLLLRRKPFKFLDGNLSNPTSFSTEFAFSMTPDGGDGLLLV  118



>gb|KJB78811.1| hypothetical protein B456_013G020300 [Gossypium raimondii]
Length=359

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 55/107 (51%), Gaps = 0/107 (0%)
 Frame = +1

Query  361  YFLAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEM  540
            Y  +F      F F++A P  SFA      + +FD  I+L+GD +V + S  +++     
Sbjct  9    YIPSFNLQIFIFLFLTAKPISSFAHSALDNNPSFDPHISLFGDARVEDGSSDVQLTRPHA  68

Query  541  SPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLSGDGLAFVML  681
                  ++ K     +E    + VSFST F+FS++  + DGLAFV++
Sbjct  69   PSSGLLLLHKPLKLTMENNVGQPVSFSTEFSFSIAPGNCDGLAFVLI  115



>gb|KFK24622.1| hypothetical protein AALP_AA8G003000 [Arabis alpina]
Length=341

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +1

Query  367  LAFFFLSLCFKFMSADPNLSFAFKNFGKDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSP  546
            LAF F+      ++ D N SFAF  F K  N    +AL+ D+K+VN   SI++  S +S 
Sbjct  7    LAFLFI--LSSVVAGDVNSSFAFNGFVKSPN----VALFRDSKLVNGGSSIQLTDS-VSH  59

Query  547  GAGRIMSKKPIKLVEGKPR  603
              GR++ KKPIKL +GK R
Sbjct  60   SEGRVIYKKPIKLFQGKGR  78



>ref|XP_004249497.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Solanum lycopersicum]
Length=721

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 64/118 (54%), Gaps = 18/118 (15%)
 Frame = +1

Query  352  KPRYFLAFFFLSLCFKFMSADPNLSFAFKNFGK-DSNFDSL----IALYGDTKVVNDSLS  516
            K R FL +F L LCF  +S+          FGK D +F++L    + L GD  + N+ + 
Sbjct  8    KIRDFLVWFILLLCFCSISS---------TFGKTDFDFENLTLSSLKLLGDAHLSNNIVK  58

Query  517  IEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTYFAFSLSRLS----GDGLAFVM  678
            +  D +  + GAG+++  KP++  +       SFST+F FS++ L+    G GLAFV+
Sbjct  59   LTRDLAVPNSGAGKVLYSKPVRFQQPGFDFPASFSTFFTFSVTNLNPSSIGGGLAFVL  116



>ref|XP_010676673.1| PREDICTED: L-type lectin-domain containing receptor kinase I.3-like 
[Beta vulgaris subsp. vulgaris]
Length=256

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 63/108 (58%), Gaps = 7/108 (6%)
 Frame = +1

Query  364  FLAFFFLSLCFKFMSADPNLSFAFKNFGKDS-NFDSLIALYGDTKVVNDSLSIEIDGSEM  540
             ++FFF++        +P++ F+F+ F      FDS I +Y D  +  D LSI++  ++ 
Sbjct  16   LVSFFFIN---SLAPVEPSILFSFEKFDTSLLKFDSKIGVYCDAILDVDELSIKMTNAKK  72

Query  541  SPGAGRIMSKKPIKLVEGK-PRKXVSFSTYFAFSLSRLSGD-GLAFVM  678
              G G +  ++PIK++E K P++  SF T+F+FS+S    + G+ FVM
Sbjct  73   FSG-GIVTYQQPIKIMEEKNPKRKGSFRTHFSFSMSPDKNEFGIMFVM  119



>ref|XP_002316243.2| hypothetical protein POPTR_0010s20190g [Populus trichocarpa]
 gb|EEF02414.2| hypothetical protein POPTR_0010s20190g [Populus trichocarpa]
Length=343

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = +1

Query  448  KDSNFDSLIALYGDTKVVNDSLSIEIDGSEMSPGAGRIMSKKPIKLVEGKPRKXVSFSTY  627
            K+ NFD  I L GD KV ND   + +  S     +G +M K P K     P K  SFST 
Sbjct  37   KNPNFDPQITLLGDAKVSNDGSHVLLT-SPFPSSSGLLMYKHPFKFPSFSPAKATSFSTE  95

Query  628  FAFSLSRLSGDGLAFVM  678
            F+FS+S   G+GL+ +M
Sbjct  96   FSFSISG-KGNGLSLLM  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1161397529311