BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5105

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364388.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    342   5e-113   Solanum tuberosum [potatoes]
ref|NP_001234368.1|  D-cysteine desulfhydrase                           340   5e-112   Solanum lycopersicum
ref|XP_010091758.1|  Putative 1-aminocyclopropane-1-carboxylate d...    334   2e-110   
ref|XP_007037067.1|  D-cysteine desulfhydrase isoform 2                 331   3e-110   
gb|KDO46412.1|  hypothetical protein CISIN_1g019410mg                   328   3e-109   Citrus sinensis [apfelsine]
ref|XP_006478105.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    330   1e-108   
gb|EYU22265.1|  hypothetical protein MIMGU_mgv1a006748mg                331   2e-108   Erythranthe guttata [common monkey flower]
ref|XP_007037068.1|  D-cysteine desulfhydrase isoform 3                 330   2e-108   
ref|XP_007037066.1|  D-cysteine desulfhydrase isoform 1                 330   2e-108   
gb|KJB39186.1|  hypothetical protein B456_007G002100                    325   2e-108   Gossypium raimondii
emb|CDO98623.1|  unnamed protein product                                329   2e-108   Coffea canephora [robusta coffee]
gb|KJB39188.1|  hypothetical protein B456_007G002100                    324   4e-108   Gossypium raimondii
gb|KJB39185.1|  hypothetical protein B456_007G002100                    325   4e-108   Gossypium raimondii
gb|KJB39181.1|  hypothetical protein B456_007G002100                    325   4e-108   Gossypium raimondii
gb|KJB39184.1|  hypothetical protein B456_007G002100                    325   5e-108   Gossypium raimondii
ref|XP_004954079.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    329   6e-108   Setaria italica
ref|XP_006478104.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    329   6e-108   Citrus sinensis [apfelsine]
ref|XP_011072033.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    329   6e-108   Sesamum indicum [beniseed]
ref|XP_002454633.1|  hypothetical protein SORBIDRAFT_04g034640          327   2e-107   
ref|XP_006364399.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    333   3e-107   
gb|KJB39183.1|  hypothetical protein B456_007G002100                    323   7e-107   Gossypium raimondii
gb|AGK36098.1|  1-aminocyclopropane-1-carboxylate deaminase             325   8e-107   Vitis vinifera
ref|XP_010276234.1|  PREDICTED: putative D-cysteine desulfhydrase...    325   1e-106   Nelumbo nucifera [Indian lotus]
emb|CBI38261.3|  unnamed protein product                                324   1e-106   Vitis vinifera
ref|XP_010276233.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    325   2e-106   Nelumbo nucifera [Indian lotus]
ref|NP_001130254.1|  hypothetical protein                               324   2e-106   Zea mays [maize]
gb|ACL52405.1|  unknown                                                 324   3e-106   Zea mays [maize]
ref|XP_008240383.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    325   4e-106   Prunus mume [ume]
ref|XP_002263358.2|  PREDICTED: putative D-cysteine desulfhydrase...    324   5e-106   Vitis vinifera
gb|KJB39180.1|  hypothetical protein B456_007G002100                    324   8e-106   Gossypium raimondii
ref|XP_010069481.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    323   2e-105   Eucalyptus grandis [rose gum]
ref|XP_007209158.1|  hypothetical protein PRUPE_ppa006016mg             323   2e-105   Prunus persica
ref|XP_008393481.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    322   5e-105   Malus domestica [apple tree]
gb|KHG12264.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    318   6e-105   Gossypium arboreum [tree cotton]
gb|ACF86644.1|  unknown                                                 320   7e-105   Zea mays [maize]
ref|XP_003525175.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    319   1e-104   Glycine max [soybeans]
ref|XP_009761444.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    321   2e-104   Nicotiana sylvestris
ref|XP_004299485.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    320   2e-104   Fragaria vesca subsp. vesca
ref|XP_006647985.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    318   4e-104   
gb|ABK95965.1|  unknown                                                 318   6e-104   Populus trichocarpa [western balsam poplar]
ref|XP_009349823.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    319   6e-104   Pyrus x bretschneideri [bai li]
ref|XP_009341766.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    319   7e-104   
ref|XP_009341767.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    319   8e-104   Pyrus x bretschneideri [bai li]
gb|KDO46413.1|  hypothetical protein CISIN_1g019410mg                   314   2e-103   Citrus sinensis [apfelsine]
gb|EPS62545.1|  hypothetical protein M569_12243                         311   2e-103   Genlisea aurea
dbj|BAJ94783.1|  predicted protein                                      317   3e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC74091.1|  hypothetical protein OsI_09120                          315   4e-103   Oryza sativa Indica Group [Indian rice]
gb|KDO46411.1|  hypothetical protein CISIN_1g019410mg                   313   6e-103   Citrus sinensis [apfelsine]
ref|XP_002318328.2|  hypothetical protein POPTR_0012s03600g             317   6e-103   
ref|XP_009598629.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    316   7e-103   Nicotiana tomentosiformis
ref|NP_001048267.1|  Os02g0773300                                       315   8e-103   
ref|XP_007160569.1|  hypothetical protein PHAVU_002G332800g             313   2e-102   Phaseolus vulgaris [French bean]
ref|XP_006580386.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    313   3e-102   Glycine max [soybeans]
ref|XP_012072903.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    314   4e-102   Jatropha curcas
ref|XP_011000759.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    315   5e-102   Populus euphratica
ref|XP_006849530.1|  PREDICTED: putative D-cysteine desulfhydrase...    311   8e-102   
sp|Q6ZHE5.2|DCYD1_ORYSJ  RecName: Full=Putative D-cysteine desulf...    313   1e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417666.1|  PREDICTED: putative D-cysteine desulfhydrase...    313   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF84959.1|  unknown                                                 310   4e-101   Zea mays [maize]
gb|AFW73686.1|  hypothetical protein ZEAMMB73_104591                    310   9e-101   
ref|XP_004503246.1|  PREDICTED: putative 1-aminocyclopropane-1-ca...    309   2e-100   Cicer arietinum [garbanzo]
ref|XP_010687041.1|  PREDICTED: putative D-cysteine desulfhydrase...    307   5e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010091756.1|  Putative 1-aminocyclopropane-1-carboxylate d...    307   5e-100   Morus notabilis
gb|AFK42354.1|  unknown                                                 306   2e-99    Lotus japonicus
gb|ABK24303.1|  unknown                                                 306   6e-99    Picea sitchensis
gb|ABR17681.1|  unknown                                                 306   7e-99    Picea sitchensis
ref|XP_002527688.1|  1-aminocyclopropane-1-carboxylate deaminase,...    305   1e-98    Ricinus communis
gb|KEH21438.1|  1-aminocyclopropane-1-carboxylate deaminase, puta...    301   2e-98    Medicago truncatula
gb|KEH21437.1|  1-aminocyclopropane-1-carboxylate deaminase, puta...    300   2e-98    Medicago truncatula
ref|XP_004137385.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    305   5e-98    Cucumis sativus [cucumbers]
gb|KGN63956.1|  hypothetical protein Csa_1G031770                       303   5e-98    Cucumis sativus [cucumbers]
ref|XP_008467141.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    305   6e-98    Cucumis melo [Oriental melon]
ref|XP_003631148.1|  D-cysteine desulfhydrase                           300   3e-97    Medicago truncatula
gb|AFK35260.1|  unknown                                                 300   4e-97    Medicago truncatula
ref|XP_003570540.1|  PREDICTED: putative D-cysteine desulfhydrase...    300   9e-97    Brachypodium distachyon [annual false brome]
gb|KJB39182.1|  hypothetical protein B456_007G002100                    286   7e-94    Gossypium raimondii
gb|EMS48554.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    291   3e-93    Triticum urartu
ref|XP_001777657.1|  predicted protein                                  288   1e-92    
gb|EMT31928.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    289   2e-92    
ref|XP_010549032.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    286   9e-92    Tarenaya hassleriana [spider flower]
ref|XP_010534203.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    280   4e-89    Tarenaya hassleriana [spider flower]
ref|XP_002961916.1|  hypothetical protein SELMODRAFT_77084              275   8e-88    
ref|XP_012089571.1|  PREDICTED: putative D-cysteine desulfhydrase...    275   3e-87    Jatropha curcas
gb|KDP23066.1|  hypothetical protein JCGZ_01161                         275   3e-87    Jatropha curcas
ref|XP_002971172.1|  hypothetical protein SELMODRAFT_94611              274   3e-87    
gb|KFK36096.1|  hypothetical protein AALP_AA4G076800                    275   4e-87    Arabis alpina [alpine rockcress]
gb|KFK36095.1|  hypothetical protein AALP_AA4G076700                    273   1e-86    Arabis alpina [alpine rockcress]
emb|CDX93667.1|  BnaA06g03810D                                          271   7e-86    
gb|ACN36628.1|  unknown                                                 268   8e-85    Zea mays [maize]
gb|EMT14169.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    263   3e-83    
gb|KDP30412.1|  hypothetical protein JCGZ_18090                         259   5e-82    Jatropha curcas
ref|XP_006393414.1|  hypothetical protein EUTSA_v10011539mg             258   2e-80    Eutrema salsugineum [saltwater cress]
ref|XP_009147970.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    258   2e-80    Brassica rapa
gb|AAL32737.1|  Unknown protein                                         257   3e-80    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175275.3|  1-aminocyclopropane-1-carboxylate deaminase 1         257   3e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAF79717.1|AC020889_25  T1N15.3                                      257   5e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDY49670.1|  BnaC06g01990D                                          256   7e-80    Brassica napus [oilseed rape]
ref|XP_010500366.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    256   1e-79    
ref|XP_010461660.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    256   1e-79    
ref|XP_002894112.1|  D-cysteine desulfhydrase                           255   3e-79    Arabidopsis lyrata subsp. lyrata
ref|XP_006306308.1|  hypothetical protein CARUB_v10012175mg             255   1e-78    
ref|XP_010479263.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    251   7e-78    
ref|XP_002955139.1|  hypothetical protein VOLCADRAFT_65498              246   8e-76    Volvox carteri f. nagariensis
gb|KIY95661.1|  hypothetical protein MNEG_12301                         235   3e-72    Monoraphidium neglectum
ref|XP_009341768.1|  PREDICTED: putative D-cysteine desulfhydrase...    224   3e-68    Pyrus x bretschneideri [bai li]
ref|XP_010645769.1|  PREDICTED: putative D-cysteine desulfhydrase...    224   3e-68    
ref|XP_005649299.1|  pyridoxal phosphate-depend                         225   5e-68    Coccomyxa subellipsoidea C-169
gb|KCW57844.1|  hypothetical protein EUGRSUZ_H00596                     222   9e-68    Eucalyptus grandis [rose gum]
ref|XP_010932486.1|  PREDICTED: putative D-cysteine desulfhydrase...    222   2e-67    Elaeis guineensis
gb|KJB39189.1|  hypothetical protein B456_007G002100                    219   1e-66    Gossypium raimondii
ref|XP_002505216.1|  predicted protein                                  220   2e-66    Micromonas commoda
ref|XP_009625167.1|  PREDICTED: putative D-cysteine desulfhydrase...    217   2e-66    
ref|XP_006580387.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    217   1e-65    Glycine max [soybeans]
ref|XP_001700834.1|  hypothetical protein CHLREDRAFT_98369              217   3e-65    Chlamydomonas reinhardtii
ref|XP_006441357.1|  hypothetical protein CICLE_v100243012mg            205   2e-63    
gb|AAN74942.1|  putative 1-aminocyclopropane-1-carboxylate deaminase    207   5e-63    Betula pendula [white birch]
gb|EMT11299.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    211   6e-62    
ref|XP_009840456.1|  hypothetical protein H257_14374                    207   5e-61    Aphanomyces astaci
ref|XP_005850727.1|  hypothetical protein CHLNCDRAFT_34235              206   7e-61    Chlorella variabilis
ref|XP_006343533.1|  PREDICTED: uncharacterized protein LOC102604926    201   2e-60    
ref|XP_008604210.1|  hypothetical protein SDRG_00508                    201   1e-58    Saprolegnia diclina VS20
ref|XP_009515993.1|  hypothetical protein PHYSODRAFT_309478             199   5e-58    Phytophthora sojae
gb|KDO27924.1|  hypothetical protein SPRG_07198                         198   2e-57    Saprolegnia parasitica CBS 223.65
ref|XP_008898732.1|  hypothetical protein PPTG_06545                    196   9e-57    Phytophthora parasitica INRA-310
ref|XP_002906856.1|  D-cysteine desulfhydrase, putative                 195   2e-56    Phytophthora infestans T30-4
ref|XP_011399663.1|  Putative 1-aminocyclopropane-1-carboxylate d...    195   3e-56    Auxenochlorella protothecoides
gb|ETL78167.1|  hypothetical protein L917_20968                         194   5e-56    Phytophthora parasitica
gb|ETO59840.1|  hypothetical protein F444_21871                         192   2e-55    Phytophthora parasitica P1976
ref|XP_001637312.1|  predicted protein                                  185   8e-53    Nematostella vectensis
ref|XP_005835247.1|  hypothetical protein GUITHDRAFT_136785             180   1e-52    Guillardia theta CCMP2712
ref|XP_008877014.1|  hypothetical protein H310_11927                    181   9e-51    Aphanomyces invadans
ref|XP_005783691.1|  hypothetical protein EMIHUDRAFT_418319             166   3e-45    Emiliania huxleyi CCMP1516
ref|XP_005787529.1|  hypothetical protein EMIHUDRAFT_429282             166   4e-45    Emiliania huxleyi CCMP1516
ref|XP_001630448.1|  predicted protein                                  164   1e-44    Nematostella vectensis
ref|XP_011664993.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    157   3e-42    Strongylocentrotus purpuratus [purple urchin]
ref|XP_782004.3|  PREDICTED: putative D-cysteine desulfhydrase 1,...    157   4e-42    Strongylocentrotus purpuratus [purple urchin]
ref|XP_001630447.1|  predicted protein                                  157   7e-42    Nematostella vectensis
ref|NP_001229618.1|  uncharacterized protein LOC578025                  153   1e-40    Strongylocentrotus purpuratus [purple urchin]
ref|XP_009053466.1|  hypothetical protein LOTGIDRAFT_175080             152   5e-40    Lottia gigantea
ref|XP_003383708.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    148   9e-39    Amphimedon queenslandica
ref|XP_011409801.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    148   1e-38    
gb|ELT93489.1|  hypothetical protein CAPTEDRAFT_123695                  145   1e-37    Capitella teleta
ref|XP_002895266.1|  D-cysteine desulfhydrase, putative                 142   6e-37    Phytophthora infestans T30-4
ref|XP_006823418.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    139   4e-35    Saccoglossus kowalevskii
ref|WP_012830343.1|  D-cysteine desulfhydrase                           137   1e-34    Haliangium ochraceum
ref|XP_002288615.1|  predicted protein                                  136   6e-34    Thalassiosira pseudonana CCMP1335
ref|XP_796433.2|  PREDICTED: bifunctional D-cysteine desulfhydras...    135   6e-34    Strongylocentrotus purpuratus [purple urchin]
gb|EJK45891.1|  hypothetical protein THAOC_35476                        135   1e-33    Thalassiosira oceanica
ref|WP_020209703.1|  hypothetical protein                               133   2e-33    Gilvimarinus chinensis
ref|XP_011424021.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    134   2e-33    
ref|XP_003383705.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    134   2e-33    Amphimedon queenslandica
ref|XP_011424022.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    134   3e-33    
ref|WP_016403095.1|  1-aminocyclopropane-1-carboxylate deaminase        132   7e-33    Agarivorans albus
ref|XP_787534.1|  PREDICTED: bifunctional D-cysteine desulfhydras...    132   9e-33    Strongylocentrotus purpuratus [purple urchin]
gb|EKC20722.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    135   4e-32    Crassostrea gigas
ref|XP_002121189.1|  PREDICTED: putative D-cysteine desulfhydrase...    130   4e-32    Ciona intestinalis [sea vase]
ref|WP_007103711.1|  D-cysteine desulfhydrase                           127   2e-31    Paraglaciecola polaris
ref|XP_001619528.1|  hypothetical protein NEMVEDRAFT_v1g42395           126   3e-31    Nematostella vectensis
ref|WP_015595624.1|  D-cysteine desulfhydrase                           127   5e-31    Bacillus sp. 1NLA3E
ref|WP_045451759.1|  cysteine desulfhydrase                             126   6e-31    
dbj|GAF58324.1|  LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carbo...    126   7e-31    Psychrobacter sp. JCM 18902
ref|XP_002109431.1|  hypothetical protein TRIADDRAFT_53453              127   7e-31    Trichoplax adhaerens
ref|XP_004342345.1|  Dcysteine desulfhydrase                            129   9e-31    Acanthamoeba castellanii str. Neff
ref|WP_025650556.1|  MULTISPECIES: cysteine desulfhydrase               125   1e-30    Psychrobacter
ref|WP_007087484.1|  D-cysteine desulfhydrase                           125   2e-30    Bacillus bataviensis
ref|WP_036860353.1|  cysteine desulfhydrase                             125   2e-30    Porticoccus hydrocarbonoclasticus
emb|CBY35070.1|  unnamed protein product                                125   2e-30    Oikopleura dioica
ref|WP_039994916.1|  cysteine desulfhydrase                             124   7e-30    Paraglaciecola agarilytica
dbj|GAC03960.1|  D-cysteine desulfhydrase                               124   8e-30    Paraglaciecola agarilytica NO2
ref|WP_003503279.1|  D-cysteine desulfhydrase [                         123   1e-29    Clostridiales
ref|WP_041523161.1|  cysteine desulfhydrase                             122   2e-29    Gilvimarinus agarilyticus
ref|WP_022665909.1|  D-cysteine desulfhydrase                           122   2e-29    Desulfospira joergensenii
ref|WP_011574605.1|  D-cysteine desulfhydrase                           122   3e-29    Pseudoalteromonas atlantica
ref|WP_023050567.1|  hypothetical protein                               122   3e-29    Cetobacterium somerae
ref|WP_020443970.1|  D-cysteine desulfhydrase                           122   4e-29    Psychrobacter sp. G
ref|WP_011514148.1|  D-cysteine desulfhydrase                           122   5e-29    Psychrobacter cryohalolentis
ref|WP_009298784.1|  D-cysteine desulfhydrase                           121   6e-29    Clostridium sp. 7_3_54FAA
ref|WP_044832725.1|  cysteine desulfhydrase                             121   7e-29    Thalassomonas actiniarum
ref|WP_028398585.1|  cysteine desulfhydrase                             121   7e-29    Bacillus sp. FJAT-14578
ref|WP_011280868.1|  D-cysteine desulfhydrase                           121   8e-29    Psychrobacter arcticus
gb|EAW31256.1|  D-cysteine desulfhydrase                                120   9e-29    marine gamma proteobacterium HTCC2143
ref|WP_013753524.1|  D-cysteine desulfhydrase                           120   1e-28    Glaciecola sp. 4H-3-7+YE-5
ref|WP_040823088.1|  cysteine desulfhydrase                             120   1e-28    
ref|WP_021642770.1|  putative D-cysteine desulfhydrase [                120   1e-28    [Clostridium] symbiosum
ref|WP_041324464.1|  cysteine desulfhydrase                             120   1e-28    Saccharophagus degradans
ref|WP_039992873.1|  cysteine desulfhydrase                             120   1e-28    Paraglaciecola chathamensis
gb|ABD80923.1|  Pyridoxal phosphate-dependent deaminase                 120   1e-28    Saccharophagus degradans 2-40
dbj|GAC12138.1|  D-cysteine desulfhydrase                               120   2e-28    Paraglaciecola chathamensis S18K6
ref|WP_014733258.1|  1-aminocyclopropane-1-carboxylate deaminase        120   2e-28    Pyrococcus sp. ST04
ref|WP_038029883.1|  cysteine desulfhydrase                             119   2e-28    Thermonema rossianum
ref|WP_043332804.1|  cytochrome C biogenesis protein CcmE               119   3e-28    Cobetia amphilecti
ref|WP_039207249.1|  cytochrome C biogenesis protein CcmE               119   4e-28    Brevibacterium linens
ref|WP_034836925.1|  cytochrome C biogenesis protein CcmE               119   5e-28    Inquilinus limosus
dbj|GAF60526.1|  1-aminocyclopropane-1-carboxylate deaminase            118   5e-28    Psychrobacter sp. JCM 18903
ref|WP_007232100.1|  D-cysteine desulfhydrase                           118   7e-28    gamma proteobacterium HTCC2207
ref|WP_035518186.1|  cytochrome C biogenesis protein CcmE               118   8e-28    Pseudohaliea rubra
ref|WP_045993656.1|  cytochrome C biogenesis protein CcmE               117   1e-27    Halomonas
gb|EIF44157.1|  D-cysteine desulfhydrase                                117   2e-27    gamma proteobacterium BDW918
ref|WP_040802912.1|  cysteine desulfhydrase                             117   2e-27    
ref|WP_005978024.1|  D-cysteine desulfhydrase                           117   2e-27    Fusobacterium ulcerans
ref|WP_008697125.1|  D-cysteine desulfhydrase                           117   2e-27    Fusobacterium ulcerans
ref|WP_011989078.1|  D-cysteine desulfhydrase                           117   2e-27    Clostridium kluyveri
ref|WP_018706755.1|  hypothetical protein                               117   3e-27    Bacillus fordii
ref|WP_034834091.1|  hypothetical protein                               116   3e-27    Inquilinus limosus
ref|WP_023398581.1|  pyridoxal phosphate-dependent, D-cysteine de...    116   4e-27    Pseudoalteromonas luteoviolacea
ref|WP_013902062.1|  cytochrome C biogenesis protein CcmE               116   4e-27    Ramlibacter tataouinensis
gb|EDM30233.1|  D-cysteine desulfhydrase                                117   4e-27    Roseovarius sp. TM1035
ref|WP_012097186.1|  D-cysteine desulfhydrase                           116   4e-27    Anaeromyxobacter sp. Fw109-5
ref|WP_034600917.1|  cysteine desulfhydrase                             116   5e-27    
ref|WP_006247534.1|  MULTISPECIES: D-cysteine desulfhydrase             115   5e-27    Mycolicibacterium
ref|WP_025777723.1|  cytochrome C biogenesis protein CcmE               116   5e-27    Brevibacterium sp. VCM10
ref|WP_014805412.1|  D-cysteine desulfhydrase                           115   5e-27    Mycolicibacterium chubuense
ref|WP_020593864.1|  hypothetical protein                               115   6e-27    Kiloniella laminariae
ref|WP_035488452.1|  cysteine desulfhydrase                             115   6e-27    Gammaproteobacteria bacterium MOLA455
ref|WP_010475890.1|  D-cysteine desulfhydrase                           115   7e-27    Acaryochloris sp. CCMEE 5410
ref|WP_040971292.1|  cytochrome C biogenesis protein CcmE               115   7e-27    Mesorhizobium sp. ORS 3324
ref|WP_022957125.1|  D-cysteine desulfhydrase                           115   1e-26    Spongiibacter tropicus
ref|WP_007640691.1|  D-cysteine desulfhydrase                           115   1e-26    Paraglaciecola psychrophila
ref|WP_045670987.1|  cysteine desulfhydrase                             115   1e-26    Paenibacillus beijingensis
ref|WP_025647111.1|  MULTISPECIES: cysteine desulfhydrase               115   1e-26    Psychrobacter
ref|WP_033187553.1|  cysteine desulfhydrase                             114   1e-26    Pseudoalteromonas sp. PLSV
ref|WP_035134048.1|  cysteine desulfhydrase                             114   1e-26    Clostridium sulfidigenes
ref|WP_006992457.1|  D-cysteine desulfhydrase                           114   2e-26    Paraglaciecola mesophila
ref|WP_021282477.1|  hypothetical protein                               114   2e-26    Clostridium sp. BL8
ref|WP_009019997.1|  D-cysteine desulfhydrase                           114   2e-26    Luminiphilus syltensis
gb|EHM00187.1|  putative D-cysteine desulfhydrase                       114   3e-26    Lactobacillus parafarraginis F0439
ref|WP_027872533.1|  cysteine desulfhydrase                             114   3e-26    Spongiibacter marinus
ref|WP_017417108.1|  hypothetical protein                               114   3e-26    Clostridium tunisiense
ref|WP_012162178.1|  D-cysteine desulfhydrase                           114   3e-26    Acaryochloris marina
ref|WP_026573864.1|  cysteine desulfhydrase                             113   4e-26    
ref|WP_006006904.1|  D-cysteine desulfhydrase                           113   4e-26    Glaciecola punicea
gb|KGM89288.1|  D-cysteine desulfhydrase                                114   4e-26    Roseovarius mucosus DSM 17069
ref|WP_034850629.1|  hypothetical protein                               113   4e-26    Inquilinus limosus
ref|WP_008033848.1|  cytochrome C biogenesis protein CcmE               114   5e-26    Rhodobacterales bacterium HTCC2255
ref|WP_040537582.1|  cysteine desulfhydrase                             113   5e-26    
ref|WP_014123061.1|  1-aminocyclopropane-1-carboxylate deaminase        113   5e-26    Thermococcus sp. AM4
ref|WP_004739369.1|  cytochrome C biogenesis protein CcmE               113   6e-26    Vibrio splendidus
ref|WP_012238709.1|  D-cysteine desulfhydrase                           112   7e-26    Sorangium cellulosum
ref|WP_042691531.1|  1-aminocyclopropane-1-carboxylate deaminase        112   8e-26    Thermococcus nautili
ref|WP_035924902.1|  1-aminocyclopropane-1-carboxylate deaminase        112   9e-26    Caballeronia glathei
gb|EDQ35075.2|  pyridoxal phosphate-dependent enzyme, D-cysteine ...    112   1e-25    Hoeflea phototrophica DFL-43
ref|WP_028828759.1|  cysteine desulfhydrase                             112   1e-25    Proteocatella sphenisci
ref|WP_045652067.1|  cysteine desulfhydrase                             112   1e-25    
ref|WP_040449732.1|  cytochrome C biogenesis protein CcmE               112   1e-25    Hoeflea phototrophica
gb|EEF94357.1|  D-cysteine desulfhydrase                                108   1e-25    Catenibacterium mitsuokai DSM 15897
ref|WP_005950565.1|  D-cysteine desulfhydrase                           112   1e-25    Fusobacterium varium
ref|WP_043955455.1|  cytochrome C biogenesis protein CcmE               112   1e-25    Kosakonia radicincitans
ref|WP_012870613.1|  1-aminocyclopropane-1-carboxylate deaminase        112   1e-25    Sphaerobacter thermophilus
ref|WP_007372747.1|  cytochrome C biogenesis protein CcmE               112   1e-25    Enterobacteriaceae
ref|WP_020056652.1|  cytochrome C biogenesis protein CcmE               112   1e-25    
ref|WP_023471843.1|  L-cysteate sulfo-lyase                             112   1e-25    Betaproteobacteria bacterium MOLA814
ref|WP_036181997.1|  cytochrome C biogenesis protein CcmE               112   1e-25    Maribius sp. MOLA 401
ref|WP_041870641.1|  hypothetical protein                               112   1e-25    
ref|WP_036752884.1|  pyridoxal-5'-phosphate-dependent protein           112   1e-25    Paracoccus versutus
ref|WP_010884169.1|  1-aminocyclopropane-1-carboxylate deaminase        111   2e-25    Pyrococcus horikoshii
ref|WP_045518945.1|  cysteine desulfhydrase                             111   2e-25    Bacillus niacini
dbj|BAA29122.1|  328aa long hypothetical 1-aminocyclopropane-1-ca...    111   2e-25    Pyrococcus horikoshii OT3
ref|WP_045432621.1|  hypothetical protein                               111   3e-25    
ref|WP_013362190.1|  D-cysteine desulfhydrase [                         111   3e-25    Acetoanaerobium sticklandii
ref|WP_043283974.1|  cytochrome C biogenesis protein CcmE               111   3e-25    Reyranella massiliensis
ref|WP_026987775.1|  cytochrome C biogenesis protein CcmE               111   3e-25    Fodinicurvata fenggangensis
ref|WP_014731804.1|  D-cysteine desulfhydrase                           110   3e-25    
ref|WP_023558156.1|  cytochrome C biogenesis protein CcmE               111   3e-25    Brevibacillus panacihumi
ref|WP_039069285.1|  cysteine desulfhydrase                             111   3e-25    Staphylococcus xylosus
ref|WP_006877565.1|  cytochrome C biogenesis protein CcmE               110   4e-25    Vibrio brasiliensis
ref|WP_002538848.1|  1-aminocyclopropane-1-carboxylate deaminase        110   4e-25    Grimontia indica
ref|WP_017106411.1|  cytochrome C biogenesis protein CcmE               110   4e-25    Vibrio
ref|WP_041076635.1|  cysteine desulfhydrase                             110   4e-25    Thermotoga caldifontis
gb|EBA12228.1|  ACC deaminase/D-cysteine desulfhydrase family pro...    110   5e-25    Roseobacter sp. CCS2
ref|WP_028468381.1|  cytochrome C biogenesis protein CcmE               110   5e-25    Neptunomonas japonica
ref|WP_029249755.1|  hypothetical protein                               108   5e-25    
ref|WP_015922557.1|  1-aminocyclopropane-1-carboxylate deaminase        110   5e-25    Thermomicrobium roseum
ref|WP_045451587.1|  cytochrome C biogenesis protein CcmE               110   5e-25    Vibrio campbellii
ref|WP_039882519.1|  cysteine desulfhydrase                             110   5e-25    
ref|WP_037293945.1|  cytochrome C biogenesis protein CcmE               110   5e-25    
ref|WP_020739110.1|  hypothetical protein                               110   5e-25    Sorangium cellulosum
ref|WP_035181246.1|  cysteine desulfhydrase                             110   6e-25    Lactobacillus farraginis
dbj|GAF37919.1|  pyridoxal phosphate-dependent deaminase                110   6e-25    Lactobacillus farraginis DSM 18382 = JCM 14108
ref|WP_007436632.1|  cytochrome C biogenesis protein CcmE               110   6e-25    Acetobacteraceae bacterium AT-5844
ref|WP_033187050.1|  cytochrome C biogenesis protein CcmE               110   6e-25    
ref|WP_039987278.1|  cytochrome C biogenesis protein CcmE               110   6e-25    
ref|WP_027949954.1|  cytochrome C biogenesis protein CcmE               110   6e-25    
dbj|GAC24673.1|  D-cysteine desulfhydrase                               110   6e-25    
ref|WP_026973179.1|  cysteine desulfhydrase                             110   6e-25    
gb|KGR36586.1|  L-cysteate sulfo-lyase                                  110   7e-25    
ref|WP_039357067.1|  cytochrome C biogenesis protein CcmE               110   7e-25    
ref|WP_020661433.1|  cytochrome C biogenesis protein CcmE               110   7e-25    
emb|CCU85070.1|  putative 1-aminocyclopropane-1-carboxylate deami...    110   7e-25    
ref|WP_040193666.1|  cysteine desulfhydrase                             110   7e-25    
ref|WP_022290456.1|  putative pyridoxal-phosphate-dependent enzyme      110   7e-25    
ref|WP_015839676.1|  cytochrome C biogenesis protein CcmE               110   8e-25    
ref|WP_017640203.1|  1-aminocyclopropane-1-carboxylate deaminase        110   9e-25    
ref|WP_039296109.1|  cytochrome C biogenesis protein CcmE               109   9e-25    
ref|WP_041273752.1|  cysteine desulfhydrase                             109   1e-24    
ref|WP_011093111.1|  cytochrome C biogenesis protein CcmE               109   1e-24    
ref|WP_007161738.1|  MULTISPECIES: 1-aminocyclopropane-1-carboxyl...    109   1e-24    
gb|ACN14643.1|  DcyD1                                                   109   1e-24    
ref|WP_009884774.1|  cytochrome C biogenesis protein CcmE               109   1e-24    
gb|EBA03208.1|  D-cysteine desulfhydrase                                109   1e-24    
ref|WP_040786795.1|  cytochrome C biogenesis protein CcmE               109   1e-24    
ref|WP_020288259.1|  D-cysteine desulfhydrase                           109   1e-24    
ref|WP_013934365.1|  cytochrome C biogenesis protein CcmE               109   1e-24    
ref|WP_023366737.1|  cytochrome C biogenesis protein CcmE               109   1e-24    
ref|WP_018387327.1|  cytochrome C biogenesis protein CcmE               109   1e-24    
ref|WP_039506754.1|  cytochrome C biogenesis protein CcmE               108   2e-24    
ref|WP_022729334.1|  cytochrome C biogenesis protein CcmE               108   2e-24    
ref|WP_018231717.1|  hypothetical protein                               108   2e-24    
ref|WP_010285227.1|  cytochrome C biogenesis protein CcmE               108   2e-24    
ref|WP_024764583.1|  cysteine desulfhydrase                             108   2e-24    
ref|WP_039311964.1|  cytochrome C biogenesis protein CcmE               108   2e-24    
ref|WP_026564824.1|  cytochrome C biogenesis protein CcmE               108   2e-24    
ref|WP_040629445.1|  cysteine desulfhydrase                             108   2e-24    
ref|WP_036221528.1|  hypothetical protein                               108   2e-24    
ref|WP_038003989.1|  MULTISPECIES: cytochrome C biogenesis protei...    108   2e-24    
gb|KGL01741.1|  cytochrome C biogenesis protein CcmE                    108   2e-24    
ref|WP_014458661.1|  cytochrome C biogenesis protein CcmE               108   2e-24    
gb|KGK80359.1|  cytochrome C biogenesis protein CcmE                    108   2e-24    
ref|WP_013624170.1|  D-cysteine desulfhydrase                           108   3e-24    
ref|WP_040030730.1|  cytochrome C biogenesis protein CcmE               108   3e-24    
ref|WP_039492739.1|  cytochrome C biogenesis protein CcmE               108   3e-24    
ref|WP_039535510.1|  cytochrome C biogenesis protein CcmE               108   3e-24    
ref|WP_010298434.1|  cytochrome C biogenesis protein CcmE               108   3e-24    
ref|WP_018037493.1|  cytochrome C biogenesis protein CcmE               108   3e-24    
ref|WP_039544165.1|  cytochrome C biogenesis protein CcmE               108   3e-24    
ref|XP_001748624.1|  hypothetical protein                               108   3e-24    
ref|WP_039540788.1|  cytochrome C biogenesis protein CcmE               108   3e-24    
gb|AIU69606.1|  1-aminocyclopropane-1-carboxylate deaminase             108   4e-24    
ref|WP_005970827.1|  cytochrome C biogenesis protein CcmE               108   4e-24    
ref|WP_018415066.1|  D-cysteine desulfhydrase                           108   4e-24    
ref|WP_010867187.1|  1-aminocyclopropane-1-carboxylate deaminase        107   4e-24    
ref|WP_013743851.1|  cytochrome C biogenesis protein CcmE               107   4e-24    
ref|WP_045825394.1|  cysteine desulfhydrase                             108   4e-24    
ref|WP_028886870.1|  cysteine desulfhydrase                             108   4e-24    
ref|WP_027351657.1|  1-aminocyclopropane-1-carboxylate deaminase        107   4e-24    
ref|WP_044203430.1|  cytochrome C biogenesis protein CcmE               107   4e-24    
ref|WP_043342016.1|  cytochrome C biogenesis protein CcmE               107   4e-24    
ref|WP_034945331.1|  cytochrome C biogenesis protein CcmE               107   5e-24    
ref|WP_007446102.1|  cytochrome C biogenesis protein CcmE               107   5e-24    
ref|WP_028882366.1|  cysteine desulfhydrase                             107   5e-24    
ref|WP_034918160.1|  cytochrome C biogenesis protein CcmE               107   5e-24    
gb|ADI18719.1|  1-aminocyclopropane-1-carboxylate deaminase             107   5e-24    
ref|WP_008695708.1|  D-cysteine desulfhydrase                           107   5e-24    
ref|WP_046017930.1|  cytochrome C biogenesis protein CcmE               107   5e-24    
ref|WP_044874483.1|  cytochrome C biogenesis protein CcmE               107   5e-24    
ref|WP_041683396.1|  cytochrome C biogenesis protein CcmE               107   5e-24    
ref|WP_020058151.1|  hypothetical protein                               107   5e-24    
ref|XP_002184089.1|  predicted protein                                  107   5e-24    
ref|WP_013748049.1|  1-aminocyclopropane-1-carboxylate deaminase        107   5e-24    
ref|WP_029323805.1|  cytochrome C biogenesis protein CcmE               107   6e-24    
ref|WP_029031827.1|  cytochrome C biogenesis protein CcmE               107   6e-24    
ref|WP_026960062.1|  cysteine desulfhydrase                             107   6e-24    
ref|WP_025750102.1|  cytochrome C biogenesis protein CcmE               107   6e-24    
ref|WP_006929754.1|  Pyridoxal-5'-phosphate-dependent protein bet...    107   7e-24    
ref|WP_025918887.1|  cytochrome C biogenesis protein CcmE               107   7e-24    
ref|WP_022425163.1|  d-cysteine desulfhydrase family pyridoxal ph...    107   7e-24    
ref|WP_009113560.1|  cytochrome C biogenesis protein CcmE               107   7e-24    
ref|WP_038288390.1|  hypothetical protein                               107   7e-24    
ref|WP_044838157.1|  cysteine desulfhydrase                             107   7e-24    
ref|WP_043978405.1|  cytochrome C biogenesis protein CcmE               107   7e-24    
ref|WP_028410988.1|  cytochrome C biogenesis protein CcmE               107   8e-24    
ref|WP_038327996.1|  cytochrome C biogenesis protein CcmE               107   8e-24    
ref|WP_016765209.1|  cytochrome C biogenesis protein CcmE               107   8e-24    
gb|KGA06370.1|  putative D-cysteine desulfhydrase                       107   8e-24    
ref|WP_028468189.1|  cytochrome C biogenesis protein CcmE               107   8e-24    
ref|WP_005982040.1|  D-cysteine desulfhydrase                           107   8e-24    
ref|WP_019606438.1|  D-cysteine desulfhydrase                           107   8e-24    
ref|WP_013084580.1|  cytochrome C biogenesis protein CcmE               107   8e-24    
ref|WP_026299722.1|  hypothetical protein                               107   9e-24    
ref|WP_015820700.1|  D-cysteine desulfhydrase                           107   9e-24    
ref|WP_018276569.1|  D-cysteine desulfhydrase                           107   9e-24    
ref|WP_012018450.1|  D-cysteine desulfhydrase                           107   9e-24    
ref|WP_017382211.1|  cytochrome C biogenesis protein CcmE               107   9e-24    
ref|WP_003239700.1|  D-cysteine desulfhydrase                           107   9e-24    
ref|WP_018016026.1|  D-cysteine desulfhydrase                           107   1e-23    
ref|WP_008192535.1|  cytochrome C biogenesis protein CcmE               107   1e-23    
ref|WP_013932067.1|  D-cysteine desulfhydrase                           106   1e-23    
ref|WP_045859980.1|  cysteine desulfhydrase                             107   1e-23    
ref|WP_043359880.1|  cytochrome C biogenesis protein CcmE               107   1e-23    
ref|WP_005832585.1|  D-cysteine desulfhydrase                           107   1e-23    
ref|WP_043829119.1|  cytochrome C biogenesis protein CcmE               107   1e-23    
ref|WP_025849097.1|  cytochrome C biogenesis protein CcmE               107   1e-23    
ref|WP_026838511.1|  cysteine desulfhydrase                             106   1e-23    
ref|WP_031503284.1|  cysteine desulfhydrase                             107   1e-23    
ref|WP_007784500.1|  cytochrome C biogenesis protein CcmE               106   1e-23    
gb|AAL80134.1|  1-aminocyclopropane-1-carboxylate deaminase             107   1e-23    
ref|WP_045094837.1|  hypothetical protein                               106   1e-23    
gb|EAW41951.1|  D-cysteine desulfhydrase                                106   1e-23    
ref|WP_033071321.1|  cytochrome C biogenesis protein CcmE               106   1e-23    
ref|WP_040811353.1|  cysteine desulfhydrase                             106   1e-23    
ref|WP_009520596.1|  MULTISPECIES: cytochrome C biogenesis protei...    106   1e-23    
ref|WP_011575441.1|  cytochrome C biogenesis protein CcmE               106   1e-23    
gb|EGY79963.1|  D-cysteine desulfhydrase                                106   1e-23    
ref|WP_023659723.1|  1-aminocyclopropane-1-carboxylate deaminase        106   2e-23    
ref|WP_019412894.1|  hypothetical protein                               106   2e-23    
ref|WP_042322206.1|  cytochrome C biogenesis protein CcmE               106   2e-23    
ref|WP_016565713.1|  putative pyridoxal-phosphate-dependent enzyme      106   2e-23    
ref|WP_039307478.1|  cytochrome C biogenesis protein CcmE               106   2e-23    
ref|WP_019470022.1|  hypothetical protein                               106   2e-23    
ref|WP_010427488.1|  cytochrome C biogenesis protein CcmE               106   2e-23    
ref|WP_040029759.1|  cysteine desulfhydrase                             106   2e-23    
ref|WP_011011122.1|  1-aminocyclopropane-1-carboxylate deaminase        106   2e-23    
ref|WP_032697151.1|  cytochrome C biogenesis protein CcmE               106   2e-23    
ref|WP_012954745.1|  pyridoxal phosphate-dependent enzyme, D-cyst...    106   2e-23    
ref|WP_028237784.1|  MULTISPECIES: cysteine desulfhydrase               106   2e-23    
ref|WP_044181281.1|  cytochrome C biogenesis protein CcmE               106   2e-23    
ref|WP_039473600.1|  cytochrome C biogenesis protein CcmE               106   2e-23    
ref|WP_032698333.1|  cytochrome C biogenesis protein CcmE               106   2e-23    
ref|WP_040552301.1|  cysteine desulfhydrase                             105   2e-23    
ref|WP_044297453.1|  hypothetical protein                               105   2e-23    
ref|WP_028403237.1|  cytochrome C biogenesis protein CcmE               105   2e-23    
ref|WP_044033026.1|  cytochrome C biogenesis protein CcmE               106   2e-23    
ref|WP_027294407.1|  hypothetical protein                               105   2e-23    
gb|KIR18797.1|  D-cysteine desulfhydrase                                106   2e-23    
gb|ABG31453.1|  ACC deaminase/D-cysteine desulfhydrase family           105   2e-23    
ref|WP_031448215.1|  cytochrome C biogenesis protein CcmE               105   2e-23    
ref|WP_032689828.1|  cytochrome C biogenesis protein CcmE               105   2e-23    
ref|WP_029421126.1|  cytochrome C biogenesis protein CcmE               105   2e-23    
ref|WP_037298694.1|  cytochrome C biogenesis protein CcmE               105   2e-23    
ref|WP_008945246.1|  cytochrome C biogenesis protein CcmE               105   2e-23    
ref|WP_034899769.1|  cytochrome C biogenesis protein CcmE               105   2e-23    
gb|KJG71676.1|  cytochrome C biogenesis protein CcmE                    105   2e-23    
ref|WP_004857057.1|  MULTISPECIES: cytochrome C biogenesis protei...    105   2e-23    
ref|WP_019808357.1|  D-cysteine desulfhydrase                           105   3e-23    
ref|WP_037338342.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
ref|WP_045295009.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
ref|WP_045853357.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
ref|WP_042955862.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
ref|WP_040986641.1|  MULTISPECIES: cytochrome C biogenesis protei...    105   3e-23    
gb|EJX18501.1|  D-cysteine desulfhydrase                                105   3e-23    
ref|WP_044350149.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
ref|WP_044348034.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
ref|WP_015478332.1|  D-cysteine desulfhydrase                           105   3e-23    
gb|EPA92948.1|  1-aminocyclopropane-1-carboxylate deaminase             105   3e-23    
ref|WP_002511540.1|  MULTISPECIES: D-cysteine desulfhydrase             105   3e-23    
ref|WP_043932521.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
ref|WP_032831334.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
dbj|GAC38670.1|  D-cysteine desulfhydrase                               105   3e-23    
ref|WP_028415021.1|  MULTISPECIES: cytochrome C biogenesis protei...    105   3e-23    
ref|WP_012694825.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
ref|WP_033045145.1|  cytochrome C biogenesis protein CcmE               105   3e-23    
dbj|GAN00463.1|  pyridoxal phosphate-dependent deaminase                105   4e-23    
ref|WP_027623144.1|  cysteine desulfhydrase                             105   4e-23    
ref|WP_021207642.1|  D-cysteine desulfhydrase                           105   4e-23    
gb|KEX90196.1|  cytochrome C biogenesis protein CcmE                    105   4e-23    
gb|AAV95902.1|  ACC deaminase/D-cysteine desulfhydrase family           105   4e-23    
ref|WP_013058599.1|  cytochrome C biogenesis protein CcmE               105   4e-23    
ref|WP_014560896.1|  D-cysteine desulfhydrase                           105   4e-23    
ref|WP_019406888.1|  D-cysteine desulfhydrase                           105   4e-23    
gb|AGH45190.1|  D-cysteine desulfhydrase                                105   4e-23    
gb|EJN33343.1|  1-aminocyclopropane-1-carboxylate deaminase             105   4e-23    
ref|WP_041250498.1|  cytochrome C biogenesis protein CcmE               105   4e-23    
ref|WP_026558136.1|  cytochrome C biogenesis protein CcmE               105   4e-23    
ref|WP_012633648.1|  D-cysteine desulfhydrase                           105   4e-23    
ref|WP_017251284.1|  cytochrome C biogenesis protein CcmE               105   4e-23    
ref|WP_041844054.1|  cysteine desulfhydrase                             105   4e-23    
ref|WP_014699462.1|  D-cysteine desulfhydrase                           105   4e-23    
ref|WP_033791468.1|  cytochrome C biogenesis protein CcmE               105   4e-23    
ref|WP_039610204.1|  cysteine desulfhydrase                             105   4e-23    
ref|WP_045681951.1|  cytochrome C biogenesis protein CcmE               105   5e-23    
ref|WP_041437482.1|  cysteine desulfhydrase                             104   5e-23    
ref|WP_009816219.1|  cytochrome C biogenesis protein CcmE               104   5e-23    
ref|WP_044029285.1|  cytochrome C biogenesis protein CcmE               104   5e-23    
ref|WP_015950991.1|  cytochrome C biogenesis protein CcmE               104   5e-23    
gb|ACM22637.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    104   5e-23    
ref|WP_026037561.1|  1-aminocyclopropane-1-carboxylate deaminase        104   6e-23    
ref|WP_039592631.1|  cysteine desulfhydrase                             104   6e-23    
emb|CFQ43546.1|  D-cysteine desulfhydrase                               104   6e-23    
ref|WP_033101483.1|  hypothetical protein                               104   6e-23    
ref|WP_045154800.1|  cysteine desulfhydrase                             104   6e-23    
ref|WP_024913799.1|  cytochrome C biogenesis protein CcmE               104   6e-23    
ref|WP_012253791.1|  cytochrome C biogenesis protein CcmE               104   6e-23    
ref|WP_045819283.1|  cysteine desulfhydrase                             104   7e-23    
ref|WP_005540296.1|  hypothetical protein                               104   7e-23    
ref|WP_015730234.1|  cytochrome C biogenesis protein CcmE               104   7e-23    
ref|WP_044870946.1|  cysteine desulfhydrase                             104   7e-23    
emb|CBY09115.1|  unnamed protein product                              99.8    7e-23    
ref|WP_022545791.1|  hypothetical protein                               104   7e-23    
ref|WP_016961470.1|  cytochrome C biogenesis protein CcmE               104   7e-23    
ref|WP_008825528.1|  D-cysteine desulfhydrase                           104   7e-23    
ref|WP_027896461.1|  cysteine desulfhydrase                             104   8e-23    
ref|WP_009077019.1|  cytochrome C biogenesis protein CcmE               104   8e-23    
ref|WP_046065269.1|  cysteine desulfhydrase                             104   8e-23    
ref|WP_003602931.1|  cytochrome C biogenesis protein CcmE               104   8e-23    
ref|WP_014336023.1|  D-cysteine desulfhydrase                           104   8e-23    
ref|WP_018401367.1|  cytochrome C biogenesis protein CcmE               104   8e-23    
ref|WP_039691184.1|  cytochrome C biogenesis protein CcmE               104   9e-23    
ref|WP_003559139.1|  D-cysteine desulfhydrase                           104   9e-23    
ref|WP_038660159.1|  cytochrome C biogenesis protein CcmE               104   9e-23    
ref|WP_025211272.1|  cysteine desulfhydrase                             104   9e-23    
ref|WP_043250480.1|  cysteine desulfhydrase                             104   9e-23    
ref|WP_003186840.1|  D-cysteine desulfhydrase                           103   9e-23    
ref|WP_022117247.1|  putative pyridoxal-phosphate-dependent enzyme      103   1e-22    
ref|WP_026838343.1|  cysteine desulfhydrase                             103   1e-22    
ref|WP_028245853.1|  hypothetical protein                               103   1e-22    
ref|XP_003172451.1|  1-aminocyclopropane-1-carboxylate deaminase        103   1e-22    
ref|WP_030140506.1|  cysteine desulfhydrase                             103   1e-22    
gb|ETX00666.1|  1-aminocyclopropane-1-carboxylate deaminase             103   1e-22    
ref|WP_002470882.1|  D-cysteine desulfhydrase                           103   1e-22    
ref|WP_042731571.1|  cysteine desulfhydrase                             103   1e-22    
ref|WP_028022129.1|  cytochrome C biogenesis protein CcmE               103   1e-22    



>ref|XP_006364388.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006364389.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
isoform X2 [Solanum tuberosum]
Length=425

 Score =   342 bits (877),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 180/210 (86%), Gaps = 5/210 (2%)
 Frame = +3

Query  39   NTQQKLSSQICCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFS  218
            N    L+ Q C   SS+ ++  +        +PFQFLTKKPY+PP WAS LSP+PS  FS
Sbjct  25   NKALNLNKQCCVTKSSMEDSSSQGH-----QSPFQFLTKKPYEPPPWASHLSPIPSHTFS  79

Query  219  LGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITL  398
            LG+FPTPIH WNLPNLP NTEVWLKRDD+SGMQLSGNKVRKLEFL+ADAVAQGADCI+T+
Sbjct  80   LGHFPTPIHKWNLPNLPKNTEVWLKRDDMSGMQLSGNKVRKLEFLLADAVAQGADCIVTI  139

Query  399  GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEE  578
            GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDKDPGLTGNLLV+RLVGAHIDLVSKEE
Sbjct  140  GGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDKDPGLTGNLLVDRLVGAHIDLVSKEE  199

Query  579  YAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            YAKVG  AL  ILKEKLL+EGRKPYVIPVG
Sbjct  200  YAKVGGEALTKILKEKLLNEGRKPYVIPVG  229



>ref|NP_001234368.1| D-cysteine desulfhydrase [Solanum lycopersicum]
 gb|ACC95419.1| D-cysteine desulfhydrase [Solanum lycopersicum]
Length=425

 Score =   340 bits (871),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 179/210 (85%), Gaps = 5/210 (2%)
 Frame = +3

Query  39   NTQQKLSSQICCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFS  218
            NT   L  Q C   SS+ ++  +        + FQFLTKKPY+PP WAS LSP+PS  FS
Sbjct  25   NTALNLKKQCCFTKSSMEDSSSQGH-----QSAFQFLTKKPYEPPPWASLLSPIPSHTFS  79

Query  219  LGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITL  398
            LG+FPTPIH WNLPNLP NTEVWLKRDD+SGMQLSGNKVRKLEFL+ADAVAQGADCI+T+
Sbjct  80   LGHFPTPIHKWNLPNLPKNTEVWLKRDDMSGMQLSGNKVRKLEFLLADAVAQGADCIVTI  139

Query  399  GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEE  578
            GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDKDPGLTGNLLV+RLVGAHIDLVSKEE
Sbjct  140  GGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDKDPGLTGNLLVDRLVGAHIDLVSKEE  199

Query  579  YAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            YAKVG  AL  ILKEKLL+EGRKPYVIPVG
Sbjct  200  YAKVGGEALTKILKEKLLNEGRKPYVIPVG  229



>ref|XP_010091758.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Morus notabilis]
 gb|EXB45121.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Morus notabilis]
Length=381

 Score =   334 bits (856),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
              FLTKKPY PP+WA+ LSP+PS VFSLG+FPTPIH WNLPNLP NTEVWLKRDD+SGMQ
Sbjct  11   LDFLTKKPYSPPSWATHLSPIPSHVFSLGHFPTPIHKWNLPNLPNNTEVWLKRDDVSGMQ  70

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRATAVAA+YLNLDCYLILRTSKVLV
Sbjct  71   LSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRATAVAARYLNLDCYLILRTSKVLV  130

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLVERLVGAH++L+SKEEYAK+GSVAL N LKEKLL+EGR+PYVIPVG
Sbjct  131  DQDPGLTGNLLVERLVGAHVELISKEEYAKIGSVALTNHLKEKLLNEGRRPYVIPVG  187



>ref|XP_007037067.1| D-cysteine desulfhydrase isoform 2 [Theobroma cacao]
 gb|EOY21568.1| D-cysteine desulfhydrase isoform 2 [Theobroma cacao]
Length=305

 Score =   331 bits (848),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  63   QICCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPI  242
            +I C  S    T+      +  +  F FL KKPY PP+WAS L P+PS VFSLG+ PTPI
Sbjct  28   KIYCSQSQATETETNDDAPKAMALSFDFLGKKPYSPPSWASHLRPIPSHVFSLGHLPTPI  87

Query  243  HIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHC  422
            H WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFLMA+AVAQGADCIIT+GGIQSNHC
Sbjct  88   HKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLMAEAVAQGADCIITIGGIQSNHC  147

Query  423  RATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVA  602
            RATAVAAKYLNLDCYLILRTSK LVD+DPGLTGNLLVER VGAHI L+SKEEYA++GSVA
Sbjct  148  RATAVAAKYLNLDCYLILRTSKALVDQDPGLTGNLLVERFVGAHIQLISKEEYARIGSVA  207

Query  603  LANILKEKLLHEGRKPYVIPVG  668
            L N+LKEKLL EGR+PYVIPVG
Sbjct  208  LTNVLKEKLLKEGRRPYVIPVG  229



>gb|KDO46412.1| hypothetical protein CISIN_1g019410mg [Citrus sinensis]
Length=315

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FLTK  Y PP+WAS L+P+PS VFSLG+FPTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  15   FKFLTKTSYAPPSWASHLAPIPSHVFSLGHFPTPIHKWNLPNLPHNTEVWLKRDDLSGMQ  74

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRA AVAAKYLNLDCYLILRTSKVLV
Sbjct  75   LSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLV  134

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGL GNLLVERLVGAHI+L+SKEEY+K+GSV L NILKEKLL EGR+PYVIPVG
Sbjct  135  DQDPGLIGNLLVERLVGAHIELISKEEYSKIGSVTLTNILKEKLLKEGRRPYVIPVG  191



>ref|XP_006478105.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
isoform X2 [Citrus sinensis]
Length=390

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FLTK  Y PP+WAS L+P+PS VFSLG+FPTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  56   FKFLTKTSYAPPSWASHLAPIPSHVFSLGHFPTPIHKWNLPNLPHNTEVWLKRDDLSGMQ  115

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRA AVAAKYLNLDCYLILRTSKVLV
Sbjct  116  LSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLV  175

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGL GNLLVERLVGAHI+L+SKEEY+K+GSV L NILKEKLL EGR+PYVIPVG
Sbjct  176  DQDPGLIGNLLVERLVGAHIELISKEEYSKIGSVTLTNILKEKLLKEGRRPYVIPVG  232



>gb|EYU22265.1| hypothetical protein MIMGU_mgv1a006748mg [Erythranthe guttata]
Length=433

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = +3

Query  24   ISSTKNTQQKLSSQICCDYSSVANTKKKAAIMEDASNP------FQFLTKKPYQPPTWAS  185
            I++T N+ +  S +    + +  N   K  +  D++        F+FL+KK Y PP+WA+
Sbjct  17   ITTTINSAKLFSDKKTSYHCTATNCSIKPDVSMDSAAKTHAPPTFEFLSKKTYIPPSWAA  76

Query  186  SLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADA  365
             L+PVPS ++SLG+FPTPIH WNLPNLP NTEV+LKRDDLSGMQLSGNKVRKLEFLMA+A
Sbjct  77   HLNPVPSQIYSLGHFPTPIHKWNLPNLPKNTEVYLKRDDLSGMQLSGNKVRKLEFLMAEA  136

Query  366  VAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLV  545
            VA+GADCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLV
Sbjct  137  VAEGADCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLV  196

Query  546  GAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            GAHIDLVSKEEYA VG+VAL NILKEKLL EGRKPYVIPVG
Sbjct  197  GAHIDLVSKEEYASVGAVALTNILKEKLLSEGRKPYVIPVG  237



>ref|XP_007037068.1| D-cysteine desulfhydrase isoform 3, partial [Theobroma cacao]
 gb|EOY21569.1| D-cysteine desulfhydrase isoform 3, partial [Theobroma cacao]
Length=423

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  63   QICCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPI  242
            +I C  S    T+      +  +  F FL KKPY PP+WAS L P+PS VFSLG+ PTPI
Sbjct  58   KIYCSQSQATETETNDDAPKAMALSFDFLGKKPYSPPSWASHLRPIPSHVFSLGHLPTPI  117

Query  243  HIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHC  422
            H WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFLMA+AVAQGADCIIT+GGIQSNHC
Sbjct  118  HKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLMAEAVAQGADCIITIGGIQSNHC  177

Query  423  RATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVA  602
            RATAVAAKYLNLDCYLILRTSK LVD+DPGLTGNLLVER VGAHI L+SKEEYA++GSVA
Sbjct  178  RATAVAAKYLNLDCYLILRTSKALVDQDPGLTGNLLVERFVGAHIQLISKEEYARIGSVA  237

Query  603  LANILKEKLLHEGRKPYVIPVG  668
            L N+LKEKLL EGR+PYVIPVG
Sbjct  238  LTNVLKEKLLKEGRRPYVIPVG  259



>ref|XP_007037066.1| D-cysteine desulfhydrase isoform 1 [Theobroma cacao]
 gb|EOY21567.1| D-cysteine desulfhydrase isoform 1 [Theobroma cacao]
Length=425

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  63   QICCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPI  242
            +I C  S    T+      +  +  F FL KKPY PP+WAS L P+PS VFSLG+ PTPI
Sbjct  28   KIYCSQSQATETETNDDAPKAMALSFDFLGKKPYSPPSWASHLRPIPSHVFSLGHLPTPI  87

Query  243  HIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHC  422
            H WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFLMA+AVAQGADCIIT+GGIQSNHC
Sbjct  88   HKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLMAEAVAQGADCIITIGGIQSNHC  147

Query  423  RATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVA  602
            RATAVAAKYLNLDCYLILRTSK LVD+DPGLTGNLLVER VGAHI L+SKEEYA++GSVA
Sbjct  148  RATAVAAKYLNLDCYLILRTSKALVDQDPGLTGNLLVERFVGAHIQLISKEEYARIGSVA  207

Query  603  LANILKEKLLHEGRKPYVIPVG  668
            L N+LKEKLL EGR+PYVIPVG
Sbjct  208  LTNVLKEKLLKEGRRPYVIPVG  229



>gb|KJB39186.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=293

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 173/208 (83%), Gaps = 11/208 (5%)
 Frame = +3

Query  60   SQICCDYSSVANT-----KKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLG  224
            S++CC  S    T     K K    +D      FL+KKPY PPTWAS L P+PS VFSL 
Sbjct  34   SRVCCSPSRAMETNDDTSKAKGLSFDD------FLSKKPYSPPTWASHLKPIPSHVFSLA  87

Query  225  NFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGG  404
            + PTPIH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GG
Sbjct  88   HLPTPIHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGG  147

Query  405  IQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYA  584
            IQSNHCRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYA
Sbjct  148  IQSNHCRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYA  207

Query  585  KVGSVALANILKEKLLHEGRKPYVIPVG  668
            K+GSVAL N+LKE+LL EGR+PYVIPVG
Sbjct  208  KIGSVALTNVLKEQLLKEGRRPYVIPVG  235



>emb|CDO98623.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FLTKKPY PP+WAS LSP+PS V+SLG+FPTPIH W+LPNLP +TEVWLKRDDLSGMQ
Sbjct  15   FGFLTKKPYDPPSWASHLSPIPSHVYSLGHFPTPIHKWSLPNLPKDTEVWLKRDDLSGMQ  74

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFL+ADAVA+GADC+IT+GGIQSNHCRATAVAAKYLNLDC++ILRTSKVLV
Sbjct  75   LSGNKVRKLEFLLADAVAKGADCVITIGGIQSNHCRATAVAAKYLNLDCFVILRTSKVLV  134

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGLTGNLLVERLVGAHIDLV+KEEYAKVGSV L  ILKEKLL EGR+PYVIPVG
Sbjct  135  DKDPGLTGNLLVERLVGAHIDLVTKEEYAKVGSVELTKILKEKLLREGRRPYVIPVG  191



>gb|KJB39188.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=276

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 173/208 (83%), Gaps = 11/208 (5%)
 Frame = +3

Query  60   SQICCDYSSVANT-----KKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLG  224
            S++CC  S    T     K K    +D      FL+KKPY PPTWAS L P+PS VFSL 
Sbjct  34   SRVCCSPSRAMETNDDTSKAKGLSFDD------FLSKKPYSPPTWASHLKPIPSHVFSLA  87

Query  225  NFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGG  404
            + PTPIH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GG
Sbjct  88   HLPTPIHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGG  147

Query  405  IQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYA  584
            IQSNHCRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYA
Sbjct  148  IQSNHCRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYA  207

Query  585  KVGSVALANILKEKLLHEGRKPYVIPVG  668
            K+GSVAL N+LKE+LL EGR+PYVIPVG
Sbjct  208  KIGSVALTNVLKEQLLKEGRRPYVIPVG  235



>gb|KJB39185.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
 gb|KJB39187.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=296

 Score =   325 bits (833),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 173/208 (83%), Gaps = 11/208 (5%)
 Frame = +3

Query  60   SQICCDYSSVANT-----KKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLG  224
            S++CC  S    T     K K    +D      FL+KKPY PPTWAS L P+PS VFSL 
Sbjct  34   SRVCCSPSRAMETNDDTSKAKGLSFDD------FLSKKPYSPPTWASHLKPIPSHVFSLA  87

Query  225  NFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGG  404
            + PTPIH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GG
Sbjct  88   HLPTPIHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGG  147

Query  405  IQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYA  584
            IQSNHCRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYA
Sbjct  148  IQSNHCRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYA  207

Query  585  KVGSVALANILKEKLLHEGRKPYVIPVG  668
            K+GSVAL N+LKE+LL EGR+PYVIPVG
Sbjct  208  KIGSVALTNVLKEQLLKEGRRPYVIPVG  235



>gb|KJB39181.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=290

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 173/208 (83%), Gaps = 11/208 (5%)
 Frame = +3

Query  60   SQICCDYSSVANT-----KKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLG  224
            S++CC  S    T     K K    +D      FL+KKPY PPTWAS L P+PS VFSL 
Sbjct  34   SRVCCSPSRAMETNDDTSKAKGLSFDD------FLSKKPYSPPTWASHLKPIPSHVFSLA  87

Query  225  NFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGG  404
            + PTPIH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GG
Sbjct  88   HLPTPIHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGG  147

Query  405  IQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYA  584
            IQSNHCRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYA
Sbjct  148  IQSNHCRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYA  207

Query  585  KVGSVALANILKEKLLHEGRKPYVIPVG  668
            K+GSVAL N+LKE+LL EGR+PYVIPVG
Sbjct  208  KIGSVALTNVLKEQLLKEGRRPYVIPVG  235



>gb|KJB39184.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=294

 Score =   325 bits (832),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 173/208 (83%), Gaps = 11/208 (5%)
 Frame = +3

Query  60   SQICCDYSSVANT-----KKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLG  224
            S++CC  S    T     K K    +D      FL+KKPY PPTWAS L P+PS VFSL 
Sbjct  34   SRVCCSPSRAMETNDDTSKAKGLSFDD------FLSKKPYSPPTWASHLKPIPSHVFSLA  87

Query  225  NFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGG  404
            + PTPIH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GG
Sbjct  88   HLPTPIHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGG  147

Query  405  IQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYA  584
            IQSNHCRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYA
Sbjct  148  IQSNHCRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYA  207

Query  585  KVGSVALANILKEKLLHEGRKPYVIPVG  668
            K+GSVAL N+LKE+LL EGR+PYVIPVG
Sbjct  208  KIGSVALTNVLKEQLLKEGRRPYVIPVG  235



>ref|XP_004954079.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Setaria italica]
Length=423

 Score =   329 bits (843),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP+WA+ LSP+PS  FSLG+FPTPIH WNLPNLP  TEVW+KRDDLSGMQLS
Sbjct  54   FLSKKPYAPPSWATHLSPMPSHTFSLGHFPTPIHKWNLPNLPEGTEVWIKRDDLSGMQLS  113

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDK
Sbjct  114  GNKVRKLEFLMADAVAQGADCIITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDK  173

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAHIDLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  174  DPGLVGNLLVERLVGAHIDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  228



>ref|XP_006478104.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
isoform X1 [Citrus sinensis]
Length=428

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FLTK  Y PP+WAS L+P+PS VFSLG+FPTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  56   FKFLTKTSYAPPSWASHLAPIPSHVFSLGHFPTPIHKWNLPNLPHNTEVWLKRDDLSGMQ  115

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRA AVAAKYLNLDCYLILRTSKVLV
Sbjct  116  LSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLV  175

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGL GNLLVERLVGAHI+L+SKEEY+K+GSV L NILKEKLL EGR+PYVIPVG
Sbjct  176  DQDPGLIGNLLVERLVGAHIELISKEEYSKIGSVTLTNILKEKLLKEGRRPYVIPVG  232



>ref|XP_011072033.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Sesamum indicum]
Length=435

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 182/221 (82%), Gaps = 5/221 (2%)
 Frame = +3

Query  21   VISSTKNT-QQKLSSQICCDYSSVA----NTKKKAAIMEDASNPFQFLTKKPYQPPTWAS  185
            +I S KN    K +  +   YSS +        K +I  D+   F FLTKKPY PP+WA+
Sbjct  19   IIGSNKNLLSDKTTQHLQIAYSSYSPPATTYSTKPSIPMDSKPTFDFLTKKPYVPPSWAT  78

Query  186  SLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADA  365
            +L P+PS +FSLG+ PTPIH WNLPNLP NTEV+LKRDDLSGMQLSGNKVRKLEFL+A+A
Sbjct  79   NLCPLPSHIFSLGHLPTPIHKWNLPNLPKNTEVYLKRDDLSGMQLSGNKVRKLEFLLAEA  138

Query  366  VAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLV  545
            VAQGADCIIT+GGIQSNHCRATAVAAKYLNLDC+LILRTSK LVDKDPGLTGNLLVERLV
Sbjct  139  VAQGADCIITIGGIQSNHCRATAVAAKYLNLDCHLILRTSKALVDKDPGLTGNLLVERLV  198

Query  546  GAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            GAHIDLVSKEEYA VGSVAL N LKEKLL EGRKPYVIPVG
Sbjct  199  GAHIDLVSKEEYANVGSVALTNTLKEKLLSEGRKPYVIPVG  239



>ref|XP_002454633.1| hypothetical protein SORBIDRAFT_04g034640 [Sorghum bicolor]
 gb|EES07609.1| hypothetical protein SORBIDRAFT_04g034640 [Sorghum bicolor]
Length=395

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP+WA+ LSP+PS  FSLG FPTPIH WNLPNLP  TEVW+KRDDLSGMQLS
Sbjct  26   FLSKKPYAPPSWATHLSPMPSHTFSLGQFPTPIHKWNLPNLPEGTEVWIKRDDLSGMQLS  85

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL+ADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDK
Sbjct  86   GNKVRKLEFLLADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDK  145

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAHIDLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  146  DPGLVGNLLVERLVGAHIDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  200



>ref|XP_006364399.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Solanum tuberosum]
Length=608

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  132  NPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSG  311
            +PFQFLTKKPY+PP WAS L+P+PS  FSLG+FPTPIH WNLPNLP NTEVWLKRDD+SG
Sbjct  234  SPFQFLTKKPYEPPPWASHLNPIPSHTFSLGHFPTPIHKWNLPNLPKNTEVWLKRDDMSG  293

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            MQLSGNKVRKLEFL+ADAVAQ ADCI+T+G IQSNHCRATAVAAKYLNLDCYLILRTSK+
Sbjct  294  MQLSGNKVRKLEFLLADAVAQSADCIVTIGSIQSNHCRATAVAAKYLNLDCYLILRTSKL  353

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LVDKDPGLTGNLLV+RLVGAHIDLVS EEYAKVGS AL  ILKEKLL+EGRKPYVIPVG
Sbjct  354  LVDKDPGLTGNLLVDRLVGAHIDLVSNEEYAKVGSEALTKILKEKLLNEGRKPYVIPVG  412



>gb|KJB39183.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=346

 Score =   323 bits (829),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 172/203 (85%), Gaps = 1/203 (0%)
 Frame = +3

Query  60   SQICCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTP  239
            S++CC  S    T    +  +  S    FL+KKPY PPTWAS L P+PS VFSL + PTP
Sbjct  34   SRVCCSPSRAMETNDDTSKAKGLSFD-DFLSKKPYSPPTWASHLKPIPSHVFSLAHLPTP  92

Query  240  IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNH  419
            IH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GGIQSNH
Sbjct  93   IHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGGIQSNH  152

Query  420  CRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSV  599
            CRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYAK+GSV
Sbjct  153  CRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYAKIGSV  212

Query  600  ALANILKEKLLHEGRKPYVIPVG  668
            AL N+LKE+LL EGR+PYVIPVG
Sbjct  213  ALTNVLKEQLLKEGRRPYVIPVG  235



>gb|AGK36098.1| 1-aminocyclopropane-1-carboxylate deaminase [Vitis vinifera]
Length=381

 Score =   325 bits (832),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FLTKKPY PP+WAS LSP+PS VFSL + PTPIH WNLPNLP NT++W+KRDDLSGMQ
Sbjct  9    FDFLTKKPYAPPSWASHLSPIPSHVFSLAHVPTPIHKWNLPNLPKNTQLWIKRDDLSGMQ  68

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            +SGNKVRKLEFLMADAVAQG+DCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV
Sbjct  69   MSGNKVRKLEFLMADAVAQGSDCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  128

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGLTGNLLVERL+GA I+LVSKEEYAK+GSV L N+LKE+LL EGR+PYVIPVG
Sbjct  129  DKDPGLTGNLLVERLIGAQIELVSKEEYAKLGSVTLTNLLKERLLKEGRRPYVIPVG  185



>ref|XP_010276234.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=407

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FL++KPY PP WAS LSP+PS VFSLG+FPTP+H WNLPNLP NTEVWLKRDDL+GMQ
Sbjct  47   FGFLSRKPYVPPEWASHLSPIPSHVFSLGHFPTPVHKWNLPNLPKNTEVWLKRDDLTGMQ  106

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADA+  GADCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK LV
Sbjct  107  LSGNKVRKLEFLMADAIQHGADCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKTLV  166

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGLTGNLLVERLVGAH++LVSKEEY+K GSV L N+LKE+LL EGR+PYVIPVG
Sbjct  167  DKDPGLTGNLLVERLVGAHVELVSKEEYSKTGSVVLTNLLKERLLSEGRRPYVIPVG  223



>emb|CBI38261.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FLTKKPY PP+WAS LSP+PS VFSL + PTPIH WNLPNLP NT++W+KRDDLSGMQ
Sbjct  9    FDFLTKKPYAPPSWASHLSPIPSHVFSLAHVPTPIHKWNLPNLPKNTQLWIKRDDLSGMQ  68

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            +SGNKVRKLEFLMADAVAQG+DCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV
Sbjct  69   MSGNKVRKLEFLMADAVAQGSDCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  128

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGLTGNLLVERL+GA I+LVSKEEYAK+GSV L N+LKE+LL EGR+PYVIPVG
Sbjct  129  DKDPGLTGNLLVERLIGAQIELVSKEEYAKLGSVTLTNLLKERLLKEGRRPYVIPVG  185



>ref|XP_010276233.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial isoform X1 [Nelumbo 
nucifera]
Length=419

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FL++KPY PP WAS LSP+PS VFSLG+FPTP+H WNLPNLP NTEVWLKRDDL+GMQ
Sbjct  47   FGFLSRKPYVPPEWASHLSPIPSHVFSLGHFPTPVHKWNLPNLPKNTEVWLKRDDLTGMQ  106

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADA+  GADCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK LV
Sbjct  107  LSGNKVRKLEFLMADAIQHGADCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKTLV  166

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGLTGNLLVERLVGAH++LVSKEEY+K GSV L N+LKE+LL EGR+PYVIPVG
Sbjct  167  DKDPGLTGNLLVERLVGAHVELVSKEEYSKTGSVVLTNLLKERLLSEGRRPYVIPVG  223



>ref|NP_001130254.1| hypothetical protein [Zea mays]
 gb|ACF78422.1| unknown [Zea mays]
 gb|AFW73687.1| hypothetical protein ZEAMMB73_104591 [Zea mays]
Length=395

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP WA+ LSP+P   FSLG+FPTPIH WNLPNLP  TEVW+KRDDLSGMQLS
Sbjct  26   FLSKKPYAPPLWATHLSPMPCHTFSLGHFPTPIHKWNLPNLPEGTEVWIKRDDLSGMQLS  85

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDK
Sbjct  86   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDK  145

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAH+DLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  146  DPGLVGNLLVERLVGAHVDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  200



>gb|ACL52405.1| unknown [Zea mays]
Length=395

 Score =   324 bits (830),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP WA+ LSP+P   FSLG+FPTPIH WNLPNLP  TEVW+KRDDLSGMQLS
Sbjct  26   FLSKKPYAPPLWATHLSPMPCHTFSLGHFPTPIHKWNLPNLPEGTEVWIKRDDLSGMQLS  85

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDK
Sbjct  86   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDK  145

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAH+DLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  146  DPGLVGNLLVERLVGAHVDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  200



>ref|XP_008240383.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
[Prunus mume]
Length=431

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
              FLTKK Y PP+WAS ++P+PS +FSLG+ PTPIH WNLPNLPTNTEVWLKRDDLSGMQ
Sbjct  60   LDFLTKKAYTPPSWASHINPIPSHIFSLGHLPTPIHKWNLPNLPTNTEVWLKRDDLSGMQ  119

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAVA+GADCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV
Sbjct  120  LSGNKVRKLEFLMADAVAKGADCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  179

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLVERLVGAH++L+SKEEYAK GS AL N+LKE+L+ EGR+PYVIPVG
Sbjct  180  DQDPGLTGNLLVERLVGAHVELISKEEYAKFGSGALTNLLKERLIKEGRRPYVIPVG  236



>ref|XP_002263358.2| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X1 [Vitis vinifera]
Length=415

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FLTKKPY PP+WAS LSP+PS VFSL + PTPIH WNLPNLP NT++W+KRDDLSGMQ
Sbjct  43   FDFLTKKPYAPPSWASHLSPIPSHVFSLAHVPTPIHKWNLPNLPKNTQLWIKRDDLSGMQ  102

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            +SGNKVRKLEFLMADAVAQG+DCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV
Sbjct  103  MSGNKVRKLEFLMADAVAQGSDCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  162

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGLTGNLLVERL+GA I+LVSKEEYAK+GSV L N+LKE+LL EGR+PYVIPVG
Sbjct  163  DKDPGLTGNLLVERLIGAQIELVSKEEYAKLGSVTLTNLLKERLLKEGRRPYVIPVG  219



>gb|KJB39180.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=431

 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 172/203 (85%), Gaps = 1/203 (0%)
 Frame = +3

Query  60   SQICCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTP  239
            S++CC  S    T    +  +  S    FL+KKPY PPTWAS L P+PS VFSL + PTP
Sbjct  34   SRVCCSPSRAMETNDDTSKAKGLSFD-DFLSKKPYSPPTWASHLKPIPSHVFSLAHLPTP  92

Query  240  IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNH  419
            IH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GGIQSNH
Sbjct  93   IHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGGIQSNH  152

Query  420  CRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSV  599
            CRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYAK+GSV
Sbjct  153  CRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYAKIGSV  212

Query  600  ALANILKEKLLHEGRKPYVIPVG  668
            AL N+LKE+LL EGR+PYVIPVG
Sbjct  213  ALTNVLKEQLLKEGRRPYVIPVG  235



>ref|XP_010069481.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Eucalyptus grandis]
 gb|KCW57843.1| hypothetical protein EUGRSUZ_H00596 [Eucalyptus grandis]
Length=445

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FL +KPY PP WAS LSP+PS VFSLG+ PTPIH WNLPNLP  TEVWLKRDDLSGMQ
Sbjct  73   FNFLARKPYLPPPWASHLSPIPSHVFSLGHLPTPIHRWNLPNLPKGTEVWLKRDDLSGMQ  132

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFL+ADAVAQGADCIIT+GGIQSNHCRATAVAAKYLNLDC+LILRTSKVLV
Sbjct  133  LSGNKVRKLEFLLADAVAQGADCIITIGGIQSNHCRATAVAAKYLNLDCHLILRTSKVLV  192

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGLTGNLLVERL GAH+ L+SKEEYAK+GSV L  ILKEKLL EGRKPYV+PVG
Sbjct  193  DKDPGLTGNLLVERLAGAHVQLISKEEYAKLGSVTLTEILKEKLLKEGRKPYVVPVG  249



>ref|XP_007209158.1| hypothetical protein PRUPE_ppa006016mg [Prunus persica]
 gb|EMJ10357.1| hypothetical protein PRUPE_ppa006016mg [Prunus persica]
Length=432

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
              FLTKK Y PP+WAS ++P+PS +FSLG+ PTPIH WNLPNLPTNTEVWLKRDDLSGMQ
Sbjct  60   LDFLTKKAYTPPSWASHINPIPSHIFSLGHLPTPIHKWNLPNLPTNTEVWLKRDDLSGMQ  119

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAVA+GADCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV
Sbjct  120  LSGNKVRKLEFLMADAVAKGADCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  179

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLVERLVGAH++L+SKEEYAK GS  L N+LKE+LL EGR+PYVIPVG
Sbjct  180  DQDPGLTGNLLVERLVGAHVELISKEEYAKFGSGDLTNLLKERLLKEGRRPYVIPVG  236



>ref|XP_008393481.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
[Malus domestica]
Length=429

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 170/196 (87%), Gaps = 7/196 (4%)
 Frame = +3

Query  81   SSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLP  260
            ++ +N   KAA M+       FLTKK Y PP WAS ++P+PS  FSLG+ PTPIH WNLP
Sbjct  45   TNTSNATAKAAGMD-------FLTKKVYTPPPWASHINPIPSHTFSLGHLPTPIHKWNLP  97

Query  261  NLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVA  440
            NLP NTEVWLKRDDLSGMQLSGNKVRKLEFLMADAV +GADCI+T+GGIQSNHCRATAVA
Sbjct  98   NLPPNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVEKGADCIVTIGGIQSNHCRATAVA  157

Query  441  AKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILK  620
            AKYLNLDCYLILRTSKVLVD+DPGLTGNLLVERLVGAH+DL+SKEEYAK+GS  L N+LK
Sbjct  158  AKYLNLDCYLILRTSKVLVDQDPGLTGNLLVERLVGAHVDLISKEEYAKIGSGVLTNLLK  217

Query  621  EKLLHEGRKPYVIPVG  668
            EKLL EGR+PYVIPVG
Sbjct  218  EKLLKEGRRPYVIPVG  233



>gb|KHG12264.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Gossypium 
arboreum]
Length=333

 Score =   318 bits (815),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 171/206 (83%), Gaps = 11/206 (5%)
 Frame = +3

Query  60   SQICCDYSSVANT-----KKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLG  224
            S++ C +S    +     K K    +D      FL+KKPY PPTWAS L P+PS VFSL 
Sbjct  34   SRVRCSHSRAMESNDDTSKAKGLSFDD------FLSKKPYSPPTWASHLKPIPSHVFSLA  87

Query  225  NFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGG  404
            + PTPIH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GG
Sbjct  88   HLPTPIHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGG  147

Query  405  IQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYA  584
            IQSNHCRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYA
Sbjct  148  IQSNHCRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYA  207

Query  585  KVGSVALANILKEKLLHEGRKPYVIP  662
            K+GSVAL N+LKE+LL EGR+PYVIP
Sbjct  208  KIGSVALTNVLKEQLLKEGRRPYVIP  233



>gb|ACF86644.1| unknown [Zea mays]
Length=395

 Score =   320 bits (821),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP WA+ LSP+P   FSLG+FPTPIH WNLPNLP  TEVW+KRDDLSGMQLS
Sbjct  26   FLSKKPYAPPLWATHLSPMPCHTFSLGHFPTPIHKWNLPNLPEGTEVWIKRDDLSGMQLS  85

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDK
Sbjct  86   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDK  145

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL  NLLVERLVGAH+DLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  146  DPGLVVNLLVERLVGAHVDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  200



>ref|XP_003525175.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
isoform X1 [Glycine max]
 gb|KHN10517.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Glycine 
soja]
Length=379

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FLTKKPY PP+WAS L P+PS  FSL + PTPIH WNLPNLPTNTE+W+KRDDLSGMQ
Sbjct  7    FEFLTKKPYSPPSWASHLHPLPSHFFSLAHLPTPIHRWNLPNLPTNTELWIKRDDLSGMQ  66

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADA+AQGAD IIT+GGIQSNHCRATAVAAKYLNLDC+LILRTS +LV
Sbjct  67   LSGNKVRKLEFLMADAIAQGADSIITIGGIQSNHCRATAVAAKYLNLDCFLILRTSDLLV  126

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLVER+VGAH+ L+SK+EYAK+GSV L N+LKEKL+ EGR+PYVIPVG
Sbjct  127  DQDPGLTGNLLVERMVGAHVHLISKQEYAKIGSVTLTNVLKEKLIKEGRRPYVIPVG  183



>ref|XP_009761444.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Nicotiana sylvestris]
Length=445

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 173/189 (92%), Gaps = 5/189 (3%)
 Frame = +3

Query  117  MEDASN-----PFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTE  281
            MED+S+     PFQFLTKKPY+PP WAS LSP+PS  FSLG+FPTPIH WNLPNLP +TE
Sbjct  61   MEDSSSQVSPSPFQFLTKKPYEPPQWASHLSPLPSHTFSLGHFPTPIHKWNLPNLPKDTE  120

Query  282  VWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLD  461
            VWLKRDD+SGMQLSGNKVRKLEFL+ DAVAQGADCI+T+GGIQSNHCRATAVAAKYLNLD
Sbjct  121  VWLKRDDISGMQLSGNKVRKLEFLLGDAVAQGADCIVTIGGIQSNHCRATAVAAKYLNLD  180

Query  462  CYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEG  641
            CYLILRTSK+LVDKDPGL GNLLVERLVGAHIDLVSKEEYAKVGS AL  +LKE+LL+EG
Sbjct  181  CYLILRTSKLLVDKDPGLIGNLLVERLVGAHIDLVSKEEYAKVGSEALTKLLKEELLNEG  240

Query  642  RKPYVIPVG  668
            RKPYVIPVG
Sbjct  241  RKPYVIPVG  249



>ref|XP_004299485.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=427

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
              FL+KKPY PP+WAS ++P+PS  FSLG+ PTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  55   LDFLSKKPYTPPSWASHINPIPSHTFSLGHLPTPIHKWNLPNLPNNTEVWLKRDDLSGMQ  114

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAV +GADCIIT+GGIQSNHCRATAVAAKYLNLD YLILRTSKVLV
Sbjct  115  LSGNKVRKLEFLMADAVEKGADCIITIGGIQSNHCRATAVAAKYLNLDSYLILRTSKVLV  174

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLVERLVGAHI+L+SKEEYAK+GSVAL N LKE+L+ EGR+PYVIPVG
Sbjct  175  DQDPGLTGNLLVERLVGAHIELISKEEYAKIGSVALTNTLKERLIKEGRRPYVIPVG  231



>ref|XP_006647985.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Oryza brachyantha]
Length=385

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP+WAS LSP PS  FSLG+FPTPIH WNLPNLP+ TEVW+KRDDLSGMQLS
Sbjct  16   FLSKKPYAPPSWASHLSPAPSQTFSLGHFPTPIHKWNLPNLPSGTEVWIKRDDLSGMQLS  75

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDK
Sbjct  76   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDK  135

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAHIDLVSKEEY K+GSVALA++LK+KLL EGRKPYVIPVG
Sbjct  136  DPGLVGNLLVERLVGAHIDLVSKEEYGKIGSVALADLLKKKLLEEGRKPYVIPVG  190



>gb|ABK95965.1| unknown [Populus trichocarpa]
Length=387

 Score =   318 bits (814),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = +3

Query  120  EDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRD  299
            +++ + F FL++K Y PP+WAS L+P+PS +FSLG+ PTPIH WNLPNLPTNTEV+LKRD
Sbjct  9    QESRSLFDFLSQKAYTPPSWASLLNPIPSHIFSLGHLPTPIHKWNLPNLPTNTEVYLKRD  68

Query  300  DLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILR  479
            DLSGMQLSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRATAVAAKYLNLDCYLILR
Sbjct  69   DLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRATAVAAKYLNLDCYLILR  128

Query  480  TSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVI  659
             SKV+VDKDPGLTGNLLVERLVGA++ L+SKEEYA++GSV L N LKEKL+ EGRKPYVI
Sbjct  129  ASKVVVDKDPGLTGNLLVERLVGANVQLISKEEYAQIGSVNLTNDLKEKLVKEGRKPYVI  188

Query  660  PVG  668
            PVG
Sbjct  189  PVG  191



>ref|XP_009349823.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Pyrus x 
bretschneideri]
Length=429

 Score =   319 bits (817),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
              FLTKK Y PP WAS ++P+PS  FSLG+ PTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  57   MDFLTKKVYTPPPWASHINPIPSHSFSLGHLPTPIHKWNLPNLPPNTEVWLKRDDLSGMQ  116

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAV +GADCI+T+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV
Sbjct  117  LSGNKVRKLEFLMADAVEKGADCIVTIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  176

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLVERLVGAHIDL+SKEEYAK+GS  L N+LKEKLL EGR+PYVIPVG
Sbjct  177  DQDPGLTGNLLVERLVGAHIDLISKEEYAKIGSGVLTNLLKEKLLKEGRRPYVIPVG  233



>ref|XP_009341766.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like isoform 
X1 [Pyrus x bretschneideri]
Length=429

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
              FLTKK Y PP WAS ++P+PS  FSLG+ PTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  57   MDFLTKKVYTPPPWASHINPIPSHSFSLGHLPTPIHKWNLPNLPPNTEVWLKRDDLSGMQ  116

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAV +GADCI+T+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV
Sbjct  117  LSGNKVRKLEFLMADAVEKGADCIVTIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  176

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLVERLVGAHIDL+SKEEYAK+GS  L N+LKEKLL EGR+PYVIPVG
Sbjct  177  DQDPGLTGNLLVERLVGAHIDLISKEEYAKIGSGVLTNLLKEKLLKEGRRPYVIPVG  233



>ref|XP_009341767.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like isoform 
X2 [Pyrus x bretschneideri]
Length=429

 Score =   319 bits (817),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
              FLTKK Y PP WAS ++P+PS  FSLG+ PTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  57   MDFLTKKVYTPPPWASHINPIPSHSFSLGHLPTPIHKWNLPNLPPNTEVWLKRDDLSGMQ  116

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAV +GADCI+T+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV
Sbjct  117  LSGNKVRKLEFLMADAVEKGADCIVTIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  176

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLVERLVGAHIDL+SKEEYAK+GS  L N+LKEKLL EGR+PYVIPVG
Sbjct  177  DQDPGLTGNLLVERLVGAHIDLISKEEYAKIGSGVLTNLLKEKLLKEGRRPYVIPVG  233



>gb|KDO46413.1| hypothetical protein CISIN_1g019410mg [Citrus sinensis]
Length=311

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 4/177 (2%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FLTK  Y PP+WAS L+P+PS VFSLG+FPTPIH WNLPNLP NTE    RDDLSGMQ
Sbjct  15   FKFLTKTSYAPPSWASHLAPIPSHVFSLGHFPTPIHKWNLPNLPHNTE----RDDLSGMQ  70

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRA AVAAKYLNLDCYLILRTSKVLV
Sbjct  71   LSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLDCYLILRTSKVLV  130

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGL GNLLVERLVGAHI+L+SKEEY+K+GSV L NILKEKLL EGR+PYVIPVG
Sbjct  131  DQDPGLIGNLLVERLVGAHIELISKEEYSKIGSVTLTNILKEKLLKEGRRPYVIPVG  187



>gb|EPS62545.1| hypothetical protein M569_12243, partial [Genlisea aurea]
Length=238

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FLT++PY PP+WA+ L+P+PS V SLG+ PTPIH WNLPNLP NTEV+LKRDDLSGMQ
Sbjct  3    FTFLTRRPYDPPSWAAHLNPLPSHVISLGHLPTPIHKWNLPNLPNNTEVYLKRDDLSGMQ  62

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFL+A+A+A GAD +IT+GGIQSNHCRATAVAAKYLNLDC+LILRTSK LV
Sbjct  63   LSGNKVRKLEFLLAEALATGADSVITIGGIQSNHCRATAVAAKYLNLDCHLILRTSKALV  122

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGLTGNLLVERLVGAH++LVSKEEYA VGSVAL NIL EKLL EGRKPYVIPVG
Sbjct  123  DKDPGLTGNLLVERLVGAHVNLVSKEEYAAVGSVALTNILMEKLLSEGRKPYVIPVG  179



>dbj|BAJ94783.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP+WAS L+  P   FSLG+FPTPIH WNLPNLP  TEVW+KRDDLSGMQLS
Sbjct  53   FLSKKPYAPPSWASHLALAPPHTFSLGHFPTPIHKWNLPNLPEGTEVWIKRDDLSGMQLS  112

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL++DAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVD+
Sbjct  113  GNKVRKLEFLLSDAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDE  172

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERL+GAHIDLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  173  DPGLVGNLLVERLLGAHIDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  227



>gb|EEC74091.1| hypothetical protein OsI_09120 [Oryza sativa Indica Group]
Length=385

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+K+PY PP+WAS LSP PS  FSLG+FPTPIH WNLPNLP  TEVW+KRDD+SGMQLS
Sbjct  16   FLSKRPYAPPSWASHLSPAPSQTFSLGHFPTPIHKWNLPNLPNGTEVWIKRDDISGMQLS  75

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKY+NLDCYLILRTSK+LVDK
Sbjct  76   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYINLDCYLILRTSKLLVDK  135

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAHIDLVSKEEY K+GSVALA++LK+KLL EGRKPYVIPVG
Sbjct  136  DPGLVGNLLVERLVGAHIDLVSKEEYGKIGSVALADLLKKKLLEEGRKPYVIPVG  190



>gb|KDO46411.1| hypothetical protein CISIN_1g019410mg [Citrus sinensis]
Length=341

 Score =   313 bits (803),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 165/203 (81%), Gaps = 26/203 (13%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLK--------  293
            F+FLTK  Y PP+WAS L+P+PS VFSLG+FPTPIH WNLPNLP NTEVWLK        
Sbjct  15   FKFLTKTSYAPPSWASHLAPIPSHVFSLGHFPTPIHKWNLPNLPHNTEVWLKSNFSGVSD  74

Query  294  ------------------RDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNH  419
                              RDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNH
Sbjct  75   DFWNLWGFERICYVLLLQRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNH  134

Query  420  CRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSV  599
            CRA AVAAKYLNLDCYLILRTSKVLVD+DPGL GNLLVERLVGAHI+L+SKEEY+K+GSV
Sbjct  135  CRAAAVAAKYLNLDCYLILRTSKVLVDQDPGLIGNLLVERLVGAHIELISKEEYSKIGSV  194

Query  600  ALANILKEKLLHEGRKPYVIPVG  668
             L NILKEKLL EGR+PYVIPVG
Sbjct  195  TLTNILKEKLLKEGRRPYVIPVG  217



>ref|XP_002318328.2| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 ref|XP_006376696.1| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 ref|XP_006376697.1| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 gb|EEE96548.2| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 gb|ERP54493.1| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 gb|ERP54494.1| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
Length=443

 Score =   317 bits (812),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = +3

Query  120  EDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRD  299
            +++ + F FL++K Y PP+WAS L+P+PS +FSLG+ PTPIH WNLPNLPTNTEV+LKRD
Sbjct  65   QESRSLFDFLSQKAYTPPSWASLLNPIPSHIFSLGHLPTPIHKWNLPNLPTNTEVYLKRD  124

Query  300  DLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILR  479
            DLSGMQLSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRATAVAAKYLNLDCYLILR
Sbjct  125  DLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRATAVAAKYLNLDCYLILR  184

Query  480  TSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVI  659
             SKV+VDKDPGLTGNLLVERLVGA++ L+SKEEYA++GSV L N LKEKL+ EGRKPYVI
Sbjct  185  ASKVVVDKDPGLTGNLLVERLVGANVQLISKEEYAQIGSVNLTNDLKEKLVKEGRKPYVI  244

Query  660  PVG  668
            PVG
Sbjct  245  PVG  247



>ref|XP_009598629.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Nicotiana tomentosiformis]
Length=426

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 172/189 (91%), Gaps = 5/189 (3%)
 Frame = +3

Query  117  MEDASNP-----FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTE  281
            MED+S+      FQFLTKKPY+PP WAS LSP+PS  FSLG+FPTPIH WNLPNLP +TE
Sbjct  42   MEDSSSQVSQSLFQFLTKKPYEPPQWASHLSPLPSHTFSLGHFPTPIHKWNLPNLPKDTE  101

Query  282  VWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLD  461
            VWLKRDD+SGMQLSGNKVRKLEFL+ DAVAQGADCI+T+GGIQSNHCRATAVA+KY+NLD
Sbjct  102  VWLKRDDISGMQLSGNKVRKLEFLLGDAVAQGADCIVTIGGIQSNHCRATAVASKYINLD  161

Query  462  CYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEG  641
            CYLILRTSK+LVDKDPGL GNLLVERLVGAHIDLVSKEEYAKVGS AL  +LKEKLL+EG
Sbjct  162  CYLILRTSKLLVDKDPGLIGNLLVERLVGAHIDLVSKEEYAKVGSEALTKLLKEKLLNEG  221

Query  642  RKPYVIPVG  668
            RKPYVIPVG
Sbjct  222  RKPYVIPVG  230



>ref|NP_001048267.1| Os02g0773300 [Oryza sativa Japonica Group]
 dbj|BAD16875.1| putative 1-aminocyclopropane-1-carboxylate deaminase [Oryza sativa 
Japonica Group]
 dbj|BAF10181.1| Os02g0773300 [Oryza sativa Japonica Group]
 gb|EEE57887.1| hypothetical protein OsJ_08555 [Oryza sativa Japonica Group]
Length=385

 Score =   315 bits (806),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+K+PY PP+WAS LSP PS  FSLG+FPTPIH WNLPNLP  TEVW+KRDD+SGMQLS
Sbjct  16   FLSKRPYAPPSWASHLSPAPSQTFSLGHFPTPIHKWNLPNLPNGTEVWIKRDDISGMQLS  75

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKY+NLDCYLILRTSK+LVDK
Sbjct  76   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYINLDCYLILRTSKLLVDK  135

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAHIDLVSKEEY K+GSVALA++LK+KLL EGRKPYVIPVG
Sbjct  136  DPGLVGNLLVERLVGAHIDLVSKEEYGKIGSVALADLLKKKLLEEGRKPYVIPVG  190



>ref|XP_007160569.1| hypothetical protein PHAVU_002G332800g [Phaseolus vulgaris]
 gb|ESW32563.1| hypothetical protein PHAVU_002G332800g [Phaseolus vulgaris]
Length=384

 Score =   313 bits (803),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FLTKKPY PP+WAS L P+PS+VFSL + PTPIH WNLPNLP NTE+W+KRDDLSGMQ
Sbjct  12   FEFLTKKPYTPPSWASHLHPLPSNVFSLAHLPTPIHRWNLPNLPPNTELWIKRDDLSGMQ  71

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADAVAQGAD +IT+GGIQSNHCRATAVAAKYLNLDC+LILRTS +LV
Sbjct  72   LSGNKVRKLEFLMADAVAQGADSVITIGGIQSNHCRATAVAAKYLNLDCFLILRTSNLLV  131

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            ++DPGLTGNLLVERL GAH+ L+SKEEY+K+GSV L  ILKEKL+ EGR+PYVIPVG
Sbjct  132  NQDPGLTGNLLVERLAGAHVHLISKEEYSKIGSVTLTTILKEKLIKEGRRPYVIPVG  188



>ref|XP_006580386.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
isoform X2 [Glycine max]
Length=382

 Score =   313 bits (802),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGN---FPTPIHIWNLPNLPTNTEVWLKRDDLS  308
            F+FLTKKPY PP+WAS L P+PS  FSL +    PTPIH WNLPNLPTNTE+W+KRDDLS
Sbjct  7    FEFLTKKPYSPPSWASHLHPLPSHFFSLAHVCFLPTPIHRWNLPNLPTNTELWIKRDDLS  66

Query  309  GMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSK  488
            GMQLSGNKVRKLEFLMADA+AQGAD IIT+GGIQSNHCRATAVAAKYLNLDC+LILRTS 
Sbjct  67   GMQLSGNKVRKLEFLMADAIAQGADSIITIGGIQSNHCRATAVAAKYLNLDCFLILRTSD  126

Query  489  VLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +LVD+DPGLTGNLLVER+VGAH+ L+SK+EYAK+GSV L N+LKEKL+ EGR+PYVIPVG
Sbjct  127  LLVDQDPGLTGNLLVERMVGAHVHLISKQEYAKIGSVTLTNVLKEKLIKEGRRPYVIPVG  186



>ref|XP_012072903.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Jatropha 
curcas]
 gb|KDP37415.1| hypothetical protein JCGZ_07942 [Jatropha curcas]
Length=425

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
            +FL+KK Y PP+WAS L+P+PS  FSL + PTPIH WNLPNLP  TEVWLKRDDLSGMQL
Sbjct  54   EFLSKKAYIPPSWASHLNPIPSHYFSLAHLPTPIHRWNLPNLPDGTEVWLKRDDLSGMQL  113

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMADAVA GAD IIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD
Sbjct  114  SGNKVRKLEFLMADAVANGADSIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  173

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +DPGLTGNLLV+RLVGAH+ L+SKEEYA++GSV L NILKEKLL EGRKPYVIPVG
Sbjct  174  QDPGLTGNLLVDRLVGAHVQLISKEEYAQIGSVTLTNILKEKLLKEGRKPYVIPVG  229



>ref|XP_011000759.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Populus euphratica]
 ref|XP_011000760.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Populus euphratica]
 ref|XP_011000761.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Populus euphratica]
Length=442

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  120  EDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRD  299
            ++++  F FL++K Y PP+WAS L+P PS +FSLG+ PTPIH WNLPNLPTNTEV+LKRD
Sbjct  64   QESTGLFDFLSQKAYTPPSWASLLNPTPSHIFSLGHLPTPIHKWNLPNLPTNTEVYLKRD  123

Query  300  DLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILR  479
            DLSGMQLSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRATAVAAKYLNLDCY+ILR
Sbjct  124  DLSGMQLSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRATAVAAKYLNLDCYVILR  183

Query  480  TSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVI  659
            T KV VDKDPGLTGNLLVERLVGA++ L+SKEEYA++GSV L N LKEKL+ EGRKPYVI
Sbjct  184  TLKVFVDKDPGLTGNLLVERLVGANVQLISKEEYAQIGSVNLTNDLKEKLVKEGRKPYVI  243

Query  660  PVG  668
            PVG
Sbjct  244  PVG  246



>ref|XP_006849530.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Amborella trichopoda]
 ref|XP_011625271.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Amborella trichopoda]
 gb|ERN11111.1| hypothetical protein AMTR_s00024p00154360 [Amborella trichopoda]
Length=374

 Score =   311 bits (798),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+K PY PP+WA+ L P+P D++SLG  PTPIH WNLP LP NTE+W+KRDDL+GMQLS
Sbjct  6    FLSKVPYSPPSWATHLDPIPCDIYSLGQVPTPIHKWNLPGLPKNTELWIKRDDLTGMQLS  65

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVA+GADC+IT+GGIQSNHCRATAVAAKYLNLDC+LILRTSKVLVDK
Sbjct  66   GNKVRKLEFLMADAVAKGADCVITIGGIQSNHCRATAVAAKYLNLDCFLILRTSKVLVDK  125

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGLTGNLLVERL+GA+++LVSKEEYAK+GSVAL N+LKE+L+ +GR+PYVIPVG
Sbjct  126  DPGLTGNLLVERLIGANVELVSKEEYAKIGSVALGNLLKERLISKGRRPYVIPVG  180



>sp|Q6ZHE5.2|DCYD1_ORYSJ RecName: Full=Putative D-cysteine desulfhydrase 1, mitochondrial; 
AltName: Full=OsD-CDes1; Short=D-CDes1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=426

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+K+PY PP+WAS LSP PS  FSLG+FPTPIH WNLPNLP  TEVW+KRDD+SGMQLS
Sbjct  57   FLSKRPYAPPSWASHLSPAPSQTFSLGHFPTPIHKWNLPNLPNGTEVWIKRDDISGMQLS  116

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKY+NLDCYLILRTSK+LVDK
Sbjct  117  GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYINLDCYLILRTSKLLVDK  176

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAHIDLVSKEEY K+GSVALA++LK+KLL EGRKPYVIPVG
Sbjct  177  DPGLVGNLLVERLVGAHIDLVSKEEYGKIGSVALADLLKKKLLEEGRKPYVIPVG  231



>ref|XP_009417666.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=436

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KK Y PP WAS L PVPS  FSLG+ PTPIH WNLPNLP +TE+W+KRDDLSGMQLS
Sbjct  66   FLSKKRYDPPLWASHLRPVPSHTFSLGHLPTPIHRWNLPNLPEDTELWIKRDDLSGMQLS  125

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVA GADC+IT+GGIQSNHCRATAVAA+YLNLDCYLILRTSKVL D+
Sbjct  126  GNKVRKLEFLMADAVASGADCVITVGGIQSNHCRATAVAARYLNLDCYLILRTSKVLADR  185

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAHIDLVSKEEYAK+GSV LA++LK+KL+ +GRKPYVIPVG
Sbjct  186  DPGLIGNLLVERLVGAHIDLVSKEEYAKIGSVTLADLLKKKLMDQGRKPYVIPVG  240



>gb|ACF84959.1| unknown [Zea mays]
 gb|AFW73685.1| hypothetical protein ZEAMMB73_104591 [Zea mays]
Length=390

 Score =   310 bits (795),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 158/175 (90%), Gaps = 5/175 (3%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP WA+ LSP+P   FSLG+FPTPIH WNLPNLP  TEVW+KRDDLSGMQLS
Sbjct  26   FLSKKPYAPPLWATHLSPMPCHTFSLGHFPTPIHKWNLPNLPEGTEVWIKRDDLSGMQLS  85

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTS     K
Sbjct  86   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTS-----K  140

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAH+DLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  141  DPGLVGNLLVERLVGAHVDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  195



>gb|AFW73686.1| hypothetical protein ZEAMMB73_104591 [Zea mays]
Length=393

 Score =   310 bits (793),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 158/175 (90%), Gaps = 5/175 (3%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP WA+ LSP+P   FSLG+FPTPIH WNLPNLP  TEVW+KRDDLSGMQLS
Sbjct  26   FLSKKPYAPPLWATHLSPMPCHTFSLGHFPTPIHKWNLPNLPEGTEVWIKRDDLSGMQLS  85

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTS     K
Sbjct  86   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTS-----K  140

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAH+DLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  141  DPGLVGNLLVERLVGAHVDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  195



>ref|XP_004503246.1| PREDICTED: putative 1-aminocyclopropane-1-carboxylate deaminase-like 
[Cicer arietinum]
Length=407

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 175/201 (87%), Gaps = 2/201 (1%)
 Frame = +3

Query  72   CDYSSVANTKKKAAIME--DASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIH  245
            C   S+ +T+K + ++E   AS+ F FL+ KPY PP+WAS L P+PS VFSL + PTPIH
Sbjct  11   CPSISILHTRKLSTLVELLMASSSFDFLSLKPYTPPSWASHLDPIPSHVFSLAHLPTPIH  70

Query  246  IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCR  425
             WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+ADA+A+GAD +IT+GGIQSNHCR
Sbjct  71   RWNLPNLPPNTEVWLKRDDLSGMQLSGNKVRKLEFLLADAIAEGADSVITIGGIQSNHCR  130

Query  426  ATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVAL  605
            ATAVAAKYLNLD +LILRTSK+LVD+DP LTGNLLVERLVGA++ L+SKEEYA++GSV L
Sbjct  131  ATAVAAKYLNLDPFLILRTSKLLVDQDPSLTGNLLVERLVGANLQLISKEEYAQIGSVTL  190

Query  606  ANILKEKLLHEGRKPYVIPVG  668
            AN+LK+KL+++GR PYVIPVG
Sbjct  191  ANLLKQKLINQGRNPYVIPVG  211



>ref|XP_010687041.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=379

 Score =   307 bits (787),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F FL  + Y PP+WAS LSP+PS   SL + PTPIH WNLPNLP  TEVWLKRDD+SGMQ
Sbjct  7    FGFLANRAYDPPSWASHLSPIPSHTCSLAHLPTPIHKWNLPNLPPKTEVWLKRDDISGMQ  66

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADA+AQGADCI T+GGIQSNHCRATAVAAKYLNLDC+LILRTSK L 
Sbjct  67   LSGNKVRKLEFLMADALAQGADCITTIGGIQSNHCRATAVAAKYLNLDCFLILRTSKALS  126

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DKDPGL GNLLVERLVGAH++LVSKEEYAK+GSVAL N+LKE+L+ EGRKPYVIPVG
Sbjct  127  DKDPGLIGNLLVERLVGAHVELVSKEEYAKIGSVALTNLLKERLISEGRKPYVIPVG  183



>ref|XP_010091756.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Morus notabilis]
 gb|EXB45119.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Morus notabilis]
Length=374

 Score =   307 bits (786),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
              FLT+KPY PP+WA+ L+ +PS VFSL + PTPIH WNLPNLP NTEVWLKR+DLSGMQ
Sbjct  11   LDFLTRKPYLPPSWANHLTQIPSHVFSLAHVPTPIHKWNLPNLPNNTEVWLKREDLSGMQ  70

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNK RKLEFLMADAVAQGADCIIT+GG+QS+HCRATAVAA+YLNLDCYLILRTS+VLV
Sbjct  71   LSGNKARKLEFLMADAVAQGADCIITIGGVQSSHCRATAVAARYLNLDCYLILRTSEVLV  130

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DPGLTGNLLV RLVGAH++L+S EEYAK+GSVAL N LKEKLL EGR+PYVIP G
Sbjct  131  DQDPGLTGNLLVGRLVGAHVELISVEEYAKIGSVALTNHLKEKLLSEGRRPYVIPAG  187



>gb|AFK42354.1| unknown [Lotus japonicus]
Length=381

 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 161/184 (88%), Gaps = 3/184 (2%)
 Frame = +3

Query  126  ASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLK---R  296
            A + F FL+ KPY PP+WAS L P+PS +FSL + PTPIH WNLPNLP NTEVWLK   R
Sbjct  2    ALSSFDFLSVKPYTPPSWASHLHPLPSHIFSLAHLPTPIHRWNLPNLPANTEVWLKILQR  61

Query  297  DDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLIL  476
            DDLSGMQLSGNKVRKLEFLMADA+AQGAD +IT+GGIQSNHCRATAVAAKYLNLD +LIL
Sbjct  62   DDLSGMQLSGNKVRKLEFLMADAIAQGADSVITIGGIQSNHCRATAVAAKYLNLDPFLIL  121

Query  477  RTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYV  656
            RTSK+LVD+DPGL GNLLVER VGAH+ L+SKEEYA++GSV L NILKEKL+ EGRKPYV
Sbjct  122  RTSKLLVDQDPGLIGNLLVERFVGAHLQLISKEEYAQIGSVTLTNILKEKLIKEGRKPYV  181

Query  657  IPVG  668
            IPVG
Sbjct  182  IPVG  185



>gb|ABK24303.1| unknown [Picea sitchensis]
Length=443

 Score =   306 bits (785),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+K PY PP WA+ L P+PS  +SLG+ PTPIH WNLP LPTNTEVW+KRDDLSGMQLS
Sbjct  71   FLSKFPYTPPPWATYLHPIPSHFYSLGHLPTPIHQWNLPGLPTNTEVWIKRDDLSGMQLS  130

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADA AQGADC+IT+GGIQSNHCRATAVAA+YLNLDCYLILRT++  VD+
Sbjct  131  GNKVRKLEFLMADAKAQGADCVITIGGIQSNHCRATAVAARYLNLDCYLILRTTRAQVDE  190

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGLTGNLLVER+VGA+I+LVSKEEYA+VGSVAL  +L+E+LL EGRKPYVIPVG
Sbjct  191  DPGLTGNLLVERMVGANIELVSKEEYARVGSVALGKLLEERLLKEGRKPYVIPVG  245



>gb|ABR17681.1| unknown [Picea sitchensis]
Length=443

 Score =   306 bits (785),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+K PY PP WA+ L P+PS  +SLG+ PTPIH WNLP LPTNTEVW+KRDDLSGMQLS
Sbjct  71   FLSKFPYTPPPWATYLHPIPSHFYSLGHLPTPIHQWNLPGLPTNTEVWIKRDDLSGMQLS  130

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADA AQGADC+IT+GGIQSNHCRATAVAA+YLNLDCYLILRT++  VD+
Sbjct  131  GNKVRKLEFLMADAKAQGADCVITIGGIQSNHCRATAVAARYLNLDCYLILRTTRAQVDE  190

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGLTGNLLVER+VGA+I+LVSKEEYA+VGSVAL  +L+E+LL EGRKPYVIPVG
Sbjct  191  DPGLTGNLLVERMVGANIELVSKEEYARVGSVALGKLLEERLLKEGRKPYVIPVG  245



>ref|XP_002527688.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Ricinus 
communis]
 gb|EEF34687.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Ricinus 
communis]
Length=427

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KK Y PP+WA+ L+P+P+  FSLG+FPTPIH WNLPNLP  TEVWLKRDDLSGM+LS
Sbjct  57   FLSKKAYNPPSWATHLNPIPTHQFSLGHFPTPIHRWNLPNLPNGTEVWLKRDDLSGMELS  116

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVA+GADC+IT+GGIQSNHCRATAVAAKYLNLD YLILRTSK LVD+
Sbjct  117  GNKVRKLEFLMADAVAKGADCVITIGGIQSNHCRATAVAAKYLNLDSYLILRTSKALVDQ  176

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGLTGNLLVERLVGA+I L+SKEEY+++GSV L  +L+EKLL +GRKPYVIPVG
Sbjct  177  DPGLTGNLLVERLVGANIQLISKEEYSQLGSVTLTKVLEEKLLKQGRKPYVIPVG  231



>gb|KEH21438.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Medicago 
truncatula]
Length=321

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FL+ KPY  P+WAS L P+PS + SL + PTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  16   FEFLSVKPYTAPSWASYLDPIPSHIVSLAHLPTPIHRWNLPNLPANTEVWLKRDDLSGMQ  75

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADA+A+ AD +IT+GGIQSNHCRATAVAAKYLNLD +LILRTSK+LV
Sbjct  76   LSGNKVRKLEFLMADAIAESADSVITIGGIQSNHCRATAVAAKYLNLDPFLILRTSKLLV  135

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DP LTGNLLVERL+GAH+ L+SKEEY+++GSV LAN+LKEKL+++GR+PYVIPVG
Sbjct  136  DQDPTLTGNLLVERLIGAHLQLISKEEYSQIGSVTLANLLKEKLINQGRRPYVIPVG  192



>gb|KEH21437.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Medicago 
truncatula]
Length=295

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FL+ KPY  P+WAS L P+PS + SL + PTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  16   FEFLSVKPYTAPSWASYLDPIPSHIVSLAHLPTPIHRWNLPNLPANTEVWLKRDDLSGMQ  75

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADA+A+ AD +IT+GGIQSNHCRATAVAAKYLNLD +LILRTSK+LV
Sbjct  76   LSGNKVRKLEFLMADAIAESADSVITIGGIQSNHCRATAVAAKYLNLDPFLILRTSKLLV  135

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DP LTGNLLVERL+GAH+ L+SKEEY+++GSV LAN+LKEKL+++GR+PYVIPVG
Sbjct  136  DQDPTLTGNLLVERLIGAHLQLISKEEYSQIGSVTLANLLKEKLINQGRRPYVIPVG  192



>ref|XP_004137385.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Cucumis sativus]
Length=454

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  69   CCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHI  248
            C   S       ++   ++  N   FL+ +PY PP+WAS L+P+P+ + SL   PTPIH 
Sbjct  59   CISQSQSMEINTESKQHDEVPNSLNFLSVRPYVPPSWASHLNPIPTHLSSLARLPTPIHK  118

Query  249  WNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRA  428
            WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+ADA+ QGADCIIT+GGIQSNHCRA
Sbjct  119  WNLPNLPNNTEVWLKRDDLSGMQLSGNKVRKLEFLIADALQQGADCIITIGGIQSNHCRA  178

Query  429  TAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALA  608
            TAVAAKY NLD YLILRTSKVLV++DPGLTGNLLVERLVGAH++L+SKEEYAK+GSVAL 
Sbjct  179  TAVAAKYFNLDTYLILRTSKVLVNEDPGLTGNLLVERLVGAHVELISKEEYAKIGSVALT  238

Query  609  NILKEKLLHEGRKPYVIPVG  668
            + LK KL+ EGRKPYVIPVG
Sbjct  239  DFLKSKLVAEGRKPYVIPVG  258



>gb|KGN63956.1| hypothetical protein Csa_1G031770 [Cucumis sativus]
Length=419

 Score =   303 bits (777),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  69   CCDYSSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHI  248
            C   S       ++   ++  N   FL+ +PY PP+WAS L+P+P+ + SL   PTPIH 
Sbjct  59   CISQSQSMEINTESKQHDEVPNSLNFLSVRPYVPPSWASHLNPIPTHLSSLARLPTPIHK  118

Query  249  WNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRA  428
            WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+ADA+ QGADCIIT+GGIQSNHCRA
Sbjct  119  WNLPNLPNNTEVWLKRDDLSGMQLSGNKVRKLEFLIADALQQGADCIITIGGIQSNHCRA  178

Query  429  TAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALA  608
            TAVAAKY NLD YLILRTSKVLV++DPGLTGNLLVERLVGAH++L+SKEEYAK+GSVAL 
Sbjct  179  TAVAAKYFNLDTYLILRTSKVLVNEDPGLTGNLLVERLVGAHVELISKEEYAKIGSVALT  238

Query  609  NILKEKLLHEGRKPYVIPVG  668
            + LK KL+ EGRKPYVIPVG
Sbjct  239  DFLKSKLVAEGRKPYVIPVG  258



>ref|XP_008467141.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
[Cucumis melo]
Length=456

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 165/196 (84%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   SSVANTKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLP  260
            S     K ++   ++  N   FL+ +PY PP+WAS L+P+P+ + SL   PTPIH WNLP
Sbjct  65   SQAMEIKTESKQHDELPNSLNFLSVRPYVPPSWASHLNPIPTHLSSLARLPTPIHKWNLP  124

Query  261  NLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVA  440
            NLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+ADA+ QGADCIIT+GGIQSNHCRATAVA
Sbjct  125  NLPNNTEVWLKRDDLSGMQLSGNKVRKLEFLIADALQQGADCIITIGGIQSNHCRATAVA  184

Query  441  AKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILK  620
            AKY NLD YLILRTSKVLV++DPGLTGNLLVERLVGAH++L+SKEEYAK+GSVAL + LK
Sbjct  185  AKYFNLDTYLILRTSKVLVNEDPGLTGNLLVERLVGAHVELISKEEYAKIGSVALTDFLK  244

Query  621  EKLLHEGRKPYVIPVG  668
             KL+ EGRKPYVIPVG
Sbjct  245  SKLVAEGRKPYVIPVG  260



>ref|XP_003631148.1| D-cysteine desulfhydrase [Medicago truncatula]
 gb|AET05624.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Medicago 
truncatula]
Length=388

 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FL+ KPY  P+WAS L P+PS + SL + PTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  16   FEFLSVKPYTAPSWASYLDPIPSHIVSLAHLPTPIHRWNLPNLPANTEVWLKRDDLSGMQ  75

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADA+A+ AD +IT+GGIQSNHCRATAVAAKYLNLD +LILRTSK+LV
Sbjct  76   LSGNKVRKLEFLMADAIAESADSVITIGGIQSNHCRATAVAAKYLNLDPFLILRTSKLLV  135

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DP LTGNLLVERL+GAH+ L+SKEEY+++GSV LAN+LKEKL+++GR+PYVIPVG
Sbjct  136  DQDPTLTGNLLVERLIGAHLQLISKEEYSQIGSVTLANLLKEKLINQGRRPYVIPVG  192



>gb|AFK35260.1| unknown [Medicago truncatula]
Length=388

 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FL+ KPY  P+WAS L P+PS + SL + PTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  16   FEFLSVKPYTAPSWASYLDPIPSHIVSLAHLPTPIHRWNLPNLPANTEVWLKRDDLSGMQ  75

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLV  497
            LSGNKVRKLEFLMADA+A+ AD +IT+GGIQSNHCRATAVAAKYLNLD +LILRTSK+LV
Sbjct  76   LSGNKVRKLEFLMADAIAESADSVITIGGIQSNHCRATAVAAKYLNLDPFLILRTSKLLV  135

Query  498  DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            D+DP LTGNLLVERL+GAH+ L+SKEEY+++GSV LAN+LKEKL+++GR+PYVIPVG
Sbjct  136  DQDPTLTGNLLVERLIGAHLQLISKEEYSQIGSVTLANLLKEKLINQGRRPYVIPVG  192



>ref|XP_003570540.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Brachypodium distachyon]
Length=419

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP+WAS LS  P   FSLG+FPTPIH WNLPNLP +TEVW+KRDDLSGMQLS
Sbjct  50   FLSKKPYTPPSWASHLSLAPPHTFSLGHFPTPIHKWNLPNLPEDTEVWIKRDDLSGMQLS  109

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL+ADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDK
Sbjct  110  GNKVRKLEFLLADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDK  169

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERL+GAHIDLVSKEEY ++GSVALA++LK+KLL EGRKPYVIPVG
Sbjct  170  DPGLVGNLLVERLLGAHIDLVSKEEYGQIGSVALADLLKKKLLAEGRKPYVIPVG  224



>gb|KJB39182.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=215

 Score =   286 bits (731),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 152/185 (82%), Gaps = 11/185 (6%)
 Frame = +3

Query  60   SQICCDYSSVANT-----KKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLG  224
            S++CC  S    T     K K    +D      FL+KKPY PPTWAS L P+PS VFSL 
Sbjct  34   SRVCCSPSRAMETNDDTSKAKGLSFDD------FLSKKPYSPPTWASHLKPIPSHVFSLA  87

Query  225  NFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGG  404
            + PTPIH WNLPNLP NTEVWLKRDDLSGMQLSGNKVRKLEFL+A+AVAQGADCIIT+GG
Sbjct  88   HLPTPIHKWNLPNLPQNTEVWLKRDDLSGMQLSGNKVRKLEFLLAEAVAQGADCIITIGG  147

Query  405  IQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYA  584
            IQSNHCRATAVAAKYLNLD YLILRTSK+LVDKDPGLTGNLLVER +GAHI L+SKEEYA
Sbjct  148  IQSNHCRATAVAAKYLNLDSYLILRTSKLLVDKDPGLTGNLLVERFMGAHIQLISKEEYA  207

Query  585  KVGSV  599
            K+GSV
Sbjct  208  KIGSV  212



>gb|EMS48554.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Triticum 
urartu]
Length=412

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 153/175 (87%), Gaps = 8/175 (5%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKP+ PP+WAS L+  PS  FSLG+FPTPIH WNLPNLP  TEVW+K        LS
Sbjct  51   FLSKKPFAPPSWASHLALAPSHTFSLGHFPTPIHKWNLPNLPEGTEVWIK--------LS  102

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL++DAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVD+
Sbjct  103  GNKVRKLEFLLSDAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDQ  162

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERL+GAHIDLVSKEEY K+GSVALA++LK  LL EGRKPYVIPVG
Sbjct  163  DPGLVGNLLVERLLGAHIDLVSKEEYGKIGSVALADLLKNNLLEEGRKPYVIPVG  217



>ref|XP_001777657.1| predicted protein [Physcomitrella patens]
 gb|EDQ57559.1| predicted protein [Physcomitrella patens]
Length=374

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
             LT   Y PP+WAS L P+PS   +LG FPTPIH WNLP LP +TEVW+KRDDL+GMQLS
Sbjct  1    MLTTASYSPPSWASKLHPLPSQFCTLGQFPTPIHRWNLPGLPKDTEVWIKRDDLTGMQLS  60

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL+ADA AQGADC+IT+GGIQSNHCRATAVAAKY NLDCYLILRTS+ +V++
Sbjct  61   GNKVRKLEFLIADAKAQGADCVITIGGIQSNHCRATAVAAKYFNLDCYLILRTSRTVVEQ  120

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVER+VGAH+ LVSKEEY ++GSV L  +L EKL  EGRKPYVIPVG
Sbjct  121  DPGLEGNLLVERMVGAHVSLVSKEEYVQLGSVGLGKLLTEKLKAEGRKPYVIPVG  175



>gb|EMT31928.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Aegilops 
tauschii]
Length=424

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 156/179 (87%), Gaps = 4/179 (2%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLK---RDDLS-G  311
            FL+KKPY PP+WAS L+  PS  FSLG+FPTPIH WNLPNLP  TEVW+K       S  
Sbjct  51   FLSKKPYAPPSWASHLALAPSHTFSLGHFPTPIHQWNLPNLPEGTEVWIKVLHEPHYSVH  110

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
              LSGNKVRKLEFL++DAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+
Sbjct  111  FLLSGNKVRKLEFLLSDAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKL  170

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LVD+DPGL GNLLVERL+GAHIDLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  171  LVDQDPGLVGNLLVERLLGAHIDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  229



>ref|XP_010549032.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Tarenaya hassleriana]
Length=374

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
            +FLT KPY PP WAS L P+PS  FSL + PTPIH WNLPNLP   EVW+KRDDL+GM+L
Sbjct  3    EFLTLKPYSPPPWASHLHPIPSHSFSLAHVPTPIHRWNLPNLPIGAEVWIKRDDLTGMEL  62

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AVA  AD +IT+GGIQSNHCRATAV + YLNL  YLILRTSK+LVD
Sbjct  63   SGNKVRKLEFLMAEAVAHQADSVITIGGIQSNHCRATAVVSNYLNLRPYLILRTSKLLVD  122

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +DPGL GNLLVERLVGAH++L+SKEEYA +GSVAL+++LKE+L +EGRKPYVIPVG
Sbjct  123  EDPGLVGNLLVERLVGAHVNLISKEEYASIGSVALSDVLKERLENEGRKPYVIPVG  178



>ref|XP_010534203.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Tarenaya 
hassleriana]
Length=399

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  126  ASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDL  305
            AS+  +FLT KPY PP WAS L P+PS   SL + PTPIH W+LP LP  TE+W+KRDDL
Sbjct  24   ASSMAEFLTMKPYSPPPWASHLRPIPSSALSLAHVPTPIHRWHLPGLPNGTEIWIKRDDL  83

Query  306  SGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTS  485
            +GM+LSGNKVRKLEFLMA+AVAQ AD +IT+GGIQSNHCRAT+V + YLNL  YLILRTS
Sbjct  84   TGMELSGNKVRKLEFLMAEAVAQQADSVITIGGIQSNHCRATSVVSNYLNLRPYLILRTS  143

Query  486  KVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPV  665
            K+LV+ DPG  GNLLVERLVGAH++L+SKEEYA +GSVAL ++LKE+L +EGRKPYVIPV
Sbjct  144  KLLVNDDPGFVGNLLVERLVGAHVNLISKEEYASIGSVALIDVLKERLENEGRKPYVIPV  203

Query  666  G  668
            G
Sbjct  204  G  204



>ref|XP_002961916.1| hypothetical protein SELMODRAFT_77084 [Selaginella moellendorffii]
 gb|EFJ37176.1| hypothetical protein SELMODRAFT_77084 [Selaginella moellendorffii]
Length=357

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
             L+K  + PP WA  L+P PS ++ L   P+PIH W+LPNLP +T+VW+KRDDL+GMQLS
Sbjct  1    MLSKGAFSPPDWAKHLNPAPSSIYCLAQLPSPIHRWDLPNLPADTQVWIKRDDLTGMQLS  60

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL+A+A  QGADC+IT+GGIQSNHCRATAVAA+YL+LDCYLILRTSKVLV++
Sbjct  61   GNKVRKLEFLLAEAKLQGADCVITIGGIQSNHCRATAVAARYLDLDCYLILRTSKVLVNE  120

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAH++LVSKEEY K GS AL ++L EKL  +GRKPY+IPVG
Sbjct  121  DPGLVGNLLVERLVGAHVELVSKEEYTKHGSEALGDMLVEKLRAQGRKPYLIPVG  175



>ref|XP_012089571.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Jatropha curcas]
Length=395

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  135  PFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGM  314
            P +FLTKK Y PP+WAS L+ +PS  FSL + PTPIH+WNLPNLP  TE+WLKRDDLSG+
Sbjct  22   PVEFLTKKAYSPPSWASHLNHIPSHYFSLAHLPTPIHLWNLPNLPDGTELWLKRDDLSGL  81

Query  315  QLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVL  494
            QLSGNK RKLEFLMADAVA GAD +IT+GGIQSNHCRATAVAAKYLNLDCYLIL TSKVL
Sbjct  82   QLSGNKARKLEFLMADAVANGADSVITIGGIQSNHCRATAVAAKYLNLDCYLILFTSKVL  141

Query  495  VDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            VD+DPGL  NLLV+RLVGAHI L+S+EE+ ++G V L NILKEKLL EG+KPYVIP G
Sbjct  142  VDQDPGLAANLLVDRLVGAHIQLISEEEFTQIGRVTLTNILKEKLLKEGKKPYVIPAG  199



>gb|KDP23066.1| hypothetical protein JCGZ_01161 [Jatropha curcas]
Length=386

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  135  PFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGM  314
            P +FLTKK Y PP+WAS L+ +PS  FSL + PTPIH+WNLPNLP  TE+WLKRDDLSG+
Sbjct  13   PVEFLTKKAYSPPSWASHLNHIPSHYFSLAHLPTPIHLWNLPNLPDGTELWLKRDDLSGL  72

Query  315  QLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVL  494
            QLSGNK RKLEFLMADAVA GAD +IT+GGIQSNHCRATAVAAKYLNLDCYLIL TSKVL
Sbjct  73   QLSGNKARKLEFLMADAVANGADSVITIGGIQSNHCRATAVAAKYLNLDCYLILFTSKVL  132

Query  495  VDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            VD+DPGL  NLLV+RLVGAHI L+S+EE+ ++G V L NILKEKLL EG+KPYVIP G
Sbjct  133  VDQDPGLAANLLVDRLVGAHIQLISEEEFTQIGRVTLTNILKEKLLKEGKKPYVIPAG  190



>ref|XP_002971172.1| hypothetical protein SELMODRAFT_94611 [Selaginella moellendorffii]
 gb|EFJ27770.1| hypothetical protein SELMODRAFT_94611 [Selaginella moellendorffii]
Length=357

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
             L+K  + PP WA  L+P PS ++SL   P+PIH W+LPNLP +T+VW+KRDDL+GMQLS
Sbjct  1    MLSKGAFSPPDWAKHLNPAPSSIYSLAQLPSPIHRWDLPNLPADTQVWIKRDDLTGMQLS  60

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL+A+A  QGADC++T+GGIQSNHCRATAVAA+YL+LDCYLILRTSKVLV++
Sbjct  61   GNKVRKLEFLLAEAKLQGADCVVTIGGIQSNHCRATAVAARYLDLDCYLILRTSKVLVNE  120

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGA ++LVSKEEY K GS AL ++L EKL  +GRKPY+IPVG
Sbjct  121  DPGLVGNLLVERLVGARVELVSKEEYTKHGSEALGDMLVEKLRAQGRKPYLIPVG  175



>gb|KFK36096.1| hypothetical protein AALP_AA4G076800 [Arabis alpina]
Length=382

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FLTK+PY PP+WA+ L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+LS
Sbjct  12   FLTKQPYSPPSWATHLRPLPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDFTGMELS  71

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATAVA+ YLNL+ +LILRTSK+L ++
Sbjct  72   GNKVRKLEFLMAEAVEQNADTVITIGGIQSNHCRATAVASNYLNLNTHLILRTSKLLAEE  131

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL + LKEKL  EGRKPYVIPVG
Sbjct  132  DPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTSALKEKLEKEGRKPYVIPVG  186



>gb|KFK36095.1| hypothetical protein AALP_AA4G076700 [Arabis alpina]
Length=374

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FLTK+PY PP+WA+ LSP+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+LS
Sbjct  4    FLTKQPYSPPSWATHLSPIPSHTFSLAHLPTPIHRWNLPGLPDGTELWIKRDDFTGMELS  63

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEF++ADA+ Q AD IIT+GG+QSNHCRATAVA+ YLNLD +LILRT+K+LV++
Sbjct  64   GNKVRKLEFILADAIDQQADTIITIGGVQSNHCRATAVASNYLNLDTHLILRTTKLLVEE  123

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVER VGA++ L+SKEE++ +GS AL N LKEKL  EGRKPYV+P G
Sbjct  124  DPGLVGNLLVERFVGANVHLISKEEFSSIGSEALTNTLKEKLEKEGRKPYVVPRG  178



>emb|CDX93667.1| BnaA06g03810D [Brassica napus]
Length=381

 Score =   271 bits (693),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FLTK PY PP WAS L P+PS  FSL + PTPIH WNLPNLP  TE+W+KRDD +GM+LS
Sbjct  11   FLTKSPYTPPPWASHLRPLPSHTFSLAHRPTPIHRWNLPNLPNGTELWIKRDDFTGMELS  70

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAV Q AD +IT+GGIQSNHCRAT VA+ YLNL  +LILRTSK+L D 
Sbjct  71   GNKVRKLEFLMADAVEQQADTVITIGGIQSNHCRATTVASNYLNLHTHLILRTSKLLADG  130

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL + LKEKL  +G+KPYVIPVG
Sbjct  131  DPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTSALKEKLEKQGKKPYVIPVG  185



>gb|ACN36628.1| unknown [Zea mays]
Length=373

 Score =   268 bits (685),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 144/175 (82%), Gaps = 22/175 (13%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+KKPY PP WA+ LSP+P   FSLG+                      RDDLSGMQLS
Sbjct  26   FLSKKPYAPPLWATHLSPMPCHTFSLGH----------------------RDDLSGMQLS  63

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMADAVAQGADC+IT+GGIQSNHCRATAVAAKYLNLDCYLILRTSK+LVDK
Sbjct  64   GNKVRKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYLNLDCYLILRTSKLLVDK  123

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGAH+DLVSKEEY K+GSVALA++LK++LL EGRKPYVIPVG
Sbjct  124  DPGLVGNLLVERLVGAHVDLVSKEEYGKIGSVALADLLKKRLLEEGRKPYVIPVG  178



>gb|EMT14169.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Aegilops 
tauschii]
Length=356

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  126  ASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDL  305
            AS    FL+ KPY PP WAS LS  PS  F+LG+FPTPIH W+LP LP +TEVW+KRDDL
Sbjct  30   ASRIGGFLSSKPYAPPPWASGLSHAPSHTFTLGHFPTPIHRWDLPELPRDTEVWIKRDDL  89

Query  306  SGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTS  485
            +GMQLSGNK RKLEFL+ADA A+GADC++T GGIQSNHCRATAVAAKY  LD YLIL TS
Sbjct  90   AGMQLSGNKARKLEFLVADAAARGADCVVTAGGIQSNHCRATAVAAKYAGLDSYLILCTS  149

Query  486  KVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPV  665
            K LVD+DPGL GNLLVERL+GAHI+LVS+ E+ K GSVAL  +L+++LL EGR+PYVIP 
Sbjct  150  KPLVDRDPGLVGNLLVERLLGAHINLVSQREFLKFGSVALTELLEKRLLEEGRRPYVIPA  209

Query  666  G  668
            G
Sbjct  210  G  210



>gb|KDP30412.1| hypothetical protein JCGZ_18090 [Jatropha curcas]
Length=332

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  132  NPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSG  311
             P +FL KK Y PP+WAS L+ +PS  FSL + PTPIH+WNLPNLP  TE+WLKRDDLSG
Sbjct  71   RPVEFLIKKAYSPPSWASHLNHIPSHYFSLAHLPTPIHLWNLPNLPDGTELWLKRDDLSG  130

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            +QLSGNK RKLEFLMADAVA GAD +IT+GGIQSNHCRATAVAAKYLNLDCYLIL TSKV
Sbjct  131  LQLSGNKARKLEFLMADAVANGADSVITIGGIQSNHCRATAVAAKYLNLDCYLILFTSKV  190

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVA  602
            LVD+DPGL  NLLV+RLVGAHI L+S+EE+ ++G VA
Sbjct  191  LVDQDPGLAANLLVDRLVGAHIQLISEEEFTQIGRVA  227



>ref|XP_006393414.1| hypothetical protein EUTSA_v10011539mg [Eutrema salsugineum]
 gb|ESQ30700.1| hypothetical protein EUTSA_v10011539mg [Eutrema salsugineum]
Length=403

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
            +FLTK PY PP+WAS L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+L
Sbjct  32   EFLTKNPYSPPSWASHLRPIPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDFTGMEL  91

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMADAV Q AD +IT+GGIQSNHCRAT VA+ YLNL+ +LILRTSK+L D
Sbjct  92   SGNKVRKLEFLMADAVDQQADTVITIGGIQSNHCRATTVASNYLNLNAHLILRTSKLLAD  151

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL + LKEKL  EG+KPYVIPVG
Sbjct  152  QDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTSALKEKLEKEGKKPYVIPVG  207



>ref|XP_009147970.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Brassica rapa]
Length=400

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
             FLTK PY PP+WAS L P+PS  FSL + PTPIH WNLPNLP  TE+W+KRDD +GM+L
Sbjct  29   DFLTKSPYTPPSWASHLRPLPSHTFSLAHRPTPIHRWNLPNLPNGTELWIKRDDFTGMEL  88

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMADAV Q AD +IT+GGIQSNHCRAT VA+ YLNLD +LILRTSK+L D
Sbjct  89   SGNKVRKLEFLMADAVEQQADTVITIGGIQSNHCRATTVASNYLNLDTHLILRTSKLLAD  148

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL + LKEKL  EG+KPYVIPVG
Sbjct  149  GDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTSALKEKLEKEGKKPYVIPVG  204



>gb|AAL32737.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13324.1| unknown protein [Arabidopsis thaliana]
Length=382

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
             FLTKKPY PP+WAS L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+L
Sbjct  11   DFLTKKPYSPPSWASHLRPLPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDFTGMEL  70

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATA A+ YLNL+ +LILRTSK+L D
Sbjct  71   SGNKVRKLEFLMAEAVDQHADTVITIGGIQSNHCRATATASNYLNLNSHLILRTSKLLAD  130

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL N LKEKL  EG+KPYVIPVG
Sbjct  131  EDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTNALKEKLEKEGKKPYVIPVG  186



>ref|NP_175275.3| 1-aminocyclopropane-1-carboxylate deaminase 1 [Arabidopsis thaliana]
 sp|F4HYF3.1|DCYD1_ARATH RecName: Full=Bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial; AltName: 
Full=1-aminocyclopropane-1-carboxylic acid deaminase 1; Short=AtACD1; 
AltName: Full=AtD-CDes1; Short=D-CDes1; AltName: Full=D-CDES; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32290.1| Dof-type transcription factor TMO6 [Arabidopsis thaliana]
Length=401

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
             FLTKKPY PP+WAS L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+L
Sbjct  30   DFLTKKPYSPPSWASHLRPLPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDFTGMEL  89

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATA A+ YLNL+ +LILRTSK+L D
Sbjct  90   SGNKVRKLEFLMAEAVDQHADTVITIGGIQSNHCRATATASNYLNLNSHLILRTSKLLAD  149

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL N LKEKL  EG+KPYVIPVG
Sbjct  150  EDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTNALKEKLEKEGKKPYVIPVG  205



>gb|AAF79717.1|AC020889_25 T1N15.3 [Arabidopsis thaliana]
 gb|AAD49754.2|AC007932_2 Contains similarity to 1-aminocyclopropane-1-carboxylate deaminase 
from Pseudomonas gb|M73488. ESTs gb|Z18033 and gb|Z34214 
come from this gene [Arabidopsis thaliana]
Length=414

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
             FLTKKPY PP+WAS L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+L
Sbjct  30   DFLTKKPYSPPSWASHLRPLPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDFTGMEL  89

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATA A+ YLNL+ +LILRTSK+L D
Sbjct  90   SGNKVRKLEFLMAEAVDQHADTVITIGGIQSNHCRATATASNYLNLNSHLILRTSKLLAD  149

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL N LKEKL  EG+KPYVIPVG
Sbjct  150  EDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTNALKEKLEKEGKKPYVIPVG  205



>emb|CDY49670.1| BnaC06g01990D [Brassica napus]
Length=402

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = +3

Query  96   TKKKAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTN  275
            TK++   M  A+    FLTK PY PP+WAS L P+PS  FSL + PTPIH WNLP LP  
Sbjct  19   TKRR---MSAATPMADFLTKSPYSPPSWASHLRPLPSHTFSLAHRPTPIHRWNLPGLPNG  75

Query  276  TEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLN  455
            TE+W+KRDD +GM+LSGNKVRKLEFLMADAV Q AD +IT+GGIQSNHCRAT VA+ YLN
Sbjct  76   TELWIKRDDFTGMELSGNKVRKLEFLMADAVEQQADTVITIGGIQSNHCRATTVASNYLN  135

Query  456  LDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLH  635
            LD +LILRTSK+L D DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL + LKEKL  
Sbjct  136  LDTHLILRTSKLLADGDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTSALKEKLEK  195

Query  636  EGRKPYVIPVG  668
            EG+KPYVIPVG
Sbjct  196  EGKKPYVIPVG  206



>ref|XP_010500366.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Camelina 
sativa]
Length=403

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
            +FLTK+PY PP+W+S L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+L
Sbjct  32   EFLTKRPYSPPSWSSHLRPIPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDYTGMEL  91

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATA A+ YLNL  +LILRTSK+L D
Sbjct  92   SGNKVRKLEFLMAEAVEQHADTVITIGGIQSNHCRATATASNYLNLSSHLILRTSKLLAD  151

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL N LKEKL  EG+KPYVIPVG
Sbjct  152  DDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTNALKEKLEKEGKKPYVIPVG  207



>ref|XP_010461660.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Camelina 
sativa]
Length=404

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
            +FLTK+PY PP+W+S L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+L
Sbjct  33   EFLTKRPYSPPSWSSHLRPIPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDYTGMEL  92

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATA A+ YLNL  +LILRTSK+L D
Sbjct  93   SGNKVRKLEFLMAEAVEQHADTVITIGGIQSNHCRATATASNYLNLSSHLILRTSKLLAD  152

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL N LKEKL  EG+KPYVIPVG
Sbjct  153  DDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTNSLKEKLEKEGKKPYVIPVG  208



>ref|XP_002894112.1| D-cysteine desulfhydrase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70371.1| D-cysteine desulfhydrase [Arabidopsis lyrata subsp. lyrata]
Length=402

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
             FLTKK Y PP+WAS L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+L
Sbjct  31   DFLTKKTYSPPSWASHLLPIPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDFTGMEL  90

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATA A+ YLNL+ +LILRTSK+L D
Sbjct  91   SGNKVRKLEFLMAEAVDQNADTVITIGGIQSNHCRATATASNYLNLNSHLILRTSKLLAD  150

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL N LKEKL  EG+KPYVIPVG
Sbjct  151  EDPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTNALKEKLEKEGKKPYVIPVG  206



>ref|XP_006306308.1| hypothetical protein CARUB_v10012175mg, partial [Capsella rubella]
 gb|EOA39206.1| hypothetical protein CARUB_v10012175mg, partial [Capsella rubella]
Length=451

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FLTKKPY PP+WAS L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+LS
Sbjct  68   FLTKKPYSPPSWASHLLPIPSHTFSLAHLPTPIHRWNLPGLPHGTELWIKRDDYTGMELS  127

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATA A+ YLNL+ +LILRTSK+L D 
Sbjct  128  GNKVRKLEFLMAEAVNQLADTVITIGGIQSNHCRATATASNYLNLNSHLILRTSKLLADD  187

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERLVGA++ L+SKEEY+ +GS AL N LKEKL  EG+KPYVIPVG
Sbjct  188  DPGLVGNLLVERLVGANVHLISKEEYSSIGSEALTNALKEKLEKEGKKPYVIPVG  242



>ref|XP_010479263.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Camelina sativa]
Length=383

 Score =   251 bits (640),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
            +FLTK+PY PP+W+S L P+PS  FSL + PTPIH WNLP LP  TE+W+KRDD +GM+L
Sbjct  12   EFLTKRPYSPPSWSSHLRPIPSHTFSLAHLPTPIHRWNLPGLPNGTELWIKRDDYTGMEL  71

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AV Q AD +IT+GGIQSNHCRATA A+ YLNL  +LILRTSK+L D
Sbjct  72   SGNKVRKLEFLMAEAVEQHADTVITIGGIQSNHCRATATASNYLNLTSHLILRTSKLLAD  131

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             DPGL GNLLVERLVGA++ L+SKEEY+ +GS  L   LKEKL  EG+KPYVIPVG
Sbjct  132  DDPGLVGNLLVERLVGANVHLISKEEYSSIGSEVLTKALKEKLEKEGKKPYVIPVG  187



>ref|XP_002955139.1| hypothetical protein VOLCADRAFT_65498 [Volvox carteri f. nagariensis]
 gb|EFJ43893.1| hypothetical protein VOLCADRAFT_65498 [Volvox carteri f. nagariensis]
Length=403

 Score =   246 bits (628),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL  +PY PPTWAS +  VP+  F LG  PTPIH W LP LP    V +KRDDLSGMQ+S
Sbjct  24   FLQLEPYSPPTWASHIPLVPTHRFRLGILPTPIHEWRLPGLPEGVRVLIKRDDLSGMQMS  83

Query  324  GNKV-RKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            GNKV RKLEFLMA+AV  G DC++T+GGIQSNH RATAVAA+YL LDC+LILRTS+ LVD
Sbjct  84   GNKVVRKLEFLMAEAVQGGYDCVVTIGGIQSNHARATAVAARYLGLDCHLILRTSRQLVD  143

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             DPGL GNLLVERL GA + LV+KEEYA +GS AL   L+  L   GRKPY+IPVG
Sbjct  144  SDPGLVGNLLVERLAGAQLHLVTKEEYATLGSGALLEQLRSDLKSTGRKPYIIPVG  199



>gb|KIY95661.1| hypothetical protein MNEG_12301, partial [Monoraphidium neglectum]
Length=338

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL  + + PP WA  L   P+  + LG  PTPIH ++ P +P + E+W+KRDDLSGMQ+S
Sbjct  4    FLQLQSFSPPAWAKGLI-APAQRYRLGILPTPIHRFSPPGVPADVELWIKRDDLSGMQMS  62

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFLMA+A  QGADC++T+GGIQSNH RATAVAA+YL LDC+LILRTS+ LVD 
Sbjct  63   GNKVRKLEFLMAEAKQQGADCVVTVGGIQSNHTRATAVAARYLGLDCHLILRTSRALVDG  122

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERL GA +  ++KEEYA  G  AL   L E+L  EGRKPY IPVG
Sbjct  123  DPGLVGNLLVERLAGAVVHKITKEEYAAKGGDALGQQLAEQLKAEGRKPYFIPVG  177



>ref|XP_009341768.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=315

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +3

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            MQLSGNKVRKLEFLMADAV +GADCI+T+GGIQSNHCRATAVAAKYLNLDCYLILRTSKV
Sbjct  1    MQLSGNKVRKLEFLMADAVEKGADCIVTIGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  60

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LVD+DPGLTGNLLVERLVGAHIDL+SKEEYAK+GS  L N+LKEKLL EGR+PYVIPVG
Sbjct  61   LVDQDPGLTGNLLVERLVGAHIDLISKEEYAKIGSGVLTNLLKEKLLKEGRRPYVIPVG  119



>ref|XP_010645769.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X2 [Vitis vinifera]
Length=315

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            MQ+SGNKVRKLEFLMADAVAQG+DCIIT+GGIQSNHCRATAVAAKYLNLDCYLILRTSKV
Sbjct  1    MQMSGNKVRKLEFLMADAVAQGSDCIITIGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  60

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LVDKDPGLTGNLLVERL+GA I+LVSKEEYAK+GSV L N+LKE+LL EGR+PYVIPVG
Sbjct  61   LVDKDPGLTGNLLVERLIGAQIELVSKEEYAKLGSVTLTNLLKERLLKEGRRPYVIPVG  119



>ref|XP_005649299.1| pyridoxal phosphate-depend, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24755.1| pyridoxal phosphate-depend, partial [Coccomyxa subellipsoidea 
C-169]
Length=373

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  153  KKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNK  332
            ++ Y PP WA +    P + F +   PTP+H W+ P++P   ++W+KRDDLSG QLSGNK
Sbjct  32   RQKYSPPAWAPAWLKAPEERFMMALLPTPVHEWHPPDVPEGVQIWIKRDDLSGSQLSGNK  91

Query  333  VRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG  512
            VRKLEFL+ADA+ Q AD ++T+GGIQSNHCRATAVAA+Y  LDC+L+LR S+   ++DPG
Sbjct  92   VRKLEFLVADALEQKADTLVTIGGIQSNHCRATAVAARYAGLDCHLVLRNSRHAAEQDPG  151

Query  513  LTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            L GNLLV+R+VGAHI  V+KEEY KVG   L + L++ L  +G++PYV+P+G
Sbjct  152  LVGNLLVDRMVGAHIHQVTKEEYGKVGGTRLVHHLRDLLQSQGKRPYVVPLG  203



>gb|KCW57844.1| hypothetical protein EUGRSUZ_H00596 [Eucalyptus grandis]
Length=315

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +3

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            MQLSGNKVRKLEFL+ADAVAQGADCIIT+GGIQSNHCRATAVAAKYLNLDC+LILRTSKV
Sbjct  1    MQLSGNKVRKLEFLLADAVAQGADCIITIGGIQSNHCRATAVAAKYLNLDCHLILRTSKV  60

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LVDKDPGLTGNLLVERL GAH+ L+SKEEYAK+GSV L  ILKEKLL EGRKPYV+PVG
Sbjct  61   LVDKDPGLTGNLLVERLAGAHVQLISKEEYAKLGSVTLTEILKEKLLKEGRKPYVVPVG  119



>ref|XP_010932486.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Elaeis guineensis]
Length=315

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            MQLSGNKVRKLEFLMADAVA GADCIIT+GGIQSNHCRATAVAA+YLNLDCYLILRTSKV
Sbjct  1    MQLSGNKVRKLEFLMADAVANGADCIITVGGIQSNHCRATAVAARYLNLDCYLILRTSKV  60

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LVD+DPGL GNLLVERLVGAH++L+SKEEYAK+GSV LA++LK++LL EGRKPYVIPVG
Sbjct  61   LVDRDPGLVGNLLVERLVGAHVELISKEEYAKIGSVTLADLLKKRLLSEGRKPYVIPVG  119



>gb|KJB39189.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=315

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +3

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            MQLSGNKVRKLEFL+A+AVAQGADCIIT+GGIQSNHCRATAVAAKYLNLD YLILRTSK+
Sbjct  1    MQLSGNKVRKLEFLLAEAVAQGADCIITIGGIQSNHCRATAVAAKYLNLDSYLILRTSKL  60

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LVDKDPGLTGNLLVER +GAHI L+SKEEYAK+GSVAL N+LKE+LL EGR+PYVIPVG
Sbjct  61   LVDKDPGLTGNLLVERFMGAHIQLISKEEYAKIGSVALTNVLKEQLLKEGRRPYVIPVG  119



>ref|XP_002505216.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66474.1| predicted protein [Micromonas sp. RCC299]
Length=360

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
             +T  P+ PP WA      P+  ++L   PTP+H W+LP  P   EV++KRDDL+GMQLS
Sbjct  1    MMTVGPWSPPAWAD-FPGAPTRRYNLARTPTPVHRWHLPGTPDGCEVYIKRDDLTGMQLS  59

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL+A+A+ + ADC+IT+GG+QSNHCRATAVAA+YL LD +LILR  + + + 
Sbjct  60   GNKVRKLEFLLAEAMDEDADCVITIGGVQSNHCRATAVAARYLGLDSHLILRAPQSIAET  119

Query  504  -DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             DPGL GNLLVER VGA+I LV+K EYA  GSVALA  L+ +L  EG++PYV+PVG
Sbjct  120  GDPGLVGNLLVERAVGANIHLVTKREYAAHGSVALAESLRRRLEREGKRPYVVPVG  175



>ref|XP_009625167.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Nicotiana tomentosiformis]
Length=258

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  294  RDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLI  473
             DD+ GMQLSGNKVRKLE L+   +AQGADCI+T+GGIQSNHCRATAVAAKYLNLDCYLI
Sbjct  68   HDDIPGMQLSGNKVRKLELLLGHVIAQGADCIVTIGGIQSNHCRATAVAAKYLNLDCYLI  127

Query  474  LRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPY  653
            LRTSK+LVDKDPGL GNLLVERL+GAHIDLVSKEEYAKVGS AL  +LKEK L+EGRK Y
Sbjct  128  LRTSKLLVDKDPGLIGNLLVERLIGAHIDLVSKEEYAKVGSEALTKLLKEKFLNEGRKLY  187

Query  654  VIPVG  668
            VIPVG
Sbjct  188  VIPVG  192



>ref|XP_006580387.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
isoform X3 [Glycine max]
Length=315

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +3

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            MQLSGNKVRKLEFLMADA+AQGAD IIT+GGIQSNHCRATAVAAKYLNLDC+LILRTS +
Sbjct  1    MQLSGNKVRKLEFLMADAIAQGADSIITIGGIQSNHCRATAVAAKYLNLDCFLILRTSDL  60

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LVD+DPGLTGNLLVER+VGAH+ L+SK+EYAK+GSV L N+LKEKL+ EGR+PYVIPVG
Sbjct  61   LVDQDPGLTGNLLVERMVGAHVHLISKQEYAKIGSVTLTNVLKEKLIKEGRRPYVIPVG  119



>ref|XP_001700834.1| hypothetical protein CHLREDRAFT_98369 [Chlamydomonas reinhardtii]
 gb|EDP07088.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=352

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL+ + Y PP WAS +   PS  F LG  PTPIH W LP LP    V +KRDDLSGMQLS
Sbjct  5    FLSLEDYTPPDWASGIPLAPSRRFRLGMLPTPIHEWRLPGLPEGVRVLVKRDDLSGMQLS  64

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL+A A A G DC++T+GGIQSNH RATAVAA+YL LDC+LILRTS+  VD 
Sbjct  65   GNKVRKLEFLLAAAAAGGHDCVVTIGGIQSNHARATAVAARYLGLDCHLILRTSRQDVDS  124

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLLVERL GA + +V+KEEY  VGS AL   L  +L   G+ PYVIPVG
Sbjct  125  DPGLVGNLLVERLAGAQLHMVTKEEYGAVGSTALLEQLALELQAAGKNPYVIPVG  179



>ref|XP_006441357.1| hypothetical protein CICLE_v100243012mg, partial [Citrus clementina]
 gb|ESR54597.1| hypothetical protein CICLE_v100243012mg, partial [Citrus clementina]
Length=122

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  138  FQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQ  317
            F+FLTK PY  P+WAS L+P+PS VFSLG+FPTPIH WNLPNLP NTEVWLKRDDLSGMQ
Sbjct  15   FKFLTKTPYASPSWASHLTPIPSHVFSLGHFPTPIHKWNLPNLPHNTEVWLKRDDLSGMQ  74

Query  318  LSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLD  461
            LSGNKVRKLEFLMADAVAQGADCIIT+GGIQSNHCRA AVAAKYLNLD
Sbjct  75   LSGNKVRKLEFLMADAVAQGADCIITIGGIQSNHCRAAAVAAKYLNLD  122



>gb|AAN74942.1| putative 1-aminocyclopropane-1-carboxylate deaminase [Betula 
pendula]
Length=229

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +3

Query  342  LEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTG  521
            LEFLMADAVAQGADC+IT+GGIQSNHCRATAV AKYLNLDCYLILRTSKVLVD+DPGLTG
Sbjct  1    LEFLMADAVAQGADCVITIGGIQSNHCRATAVTAKYLNLDCYLILRTSKVLVDQDPGLTG  60

Query  522  NLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            NLLVERLVGAHIDL+SKEEYAK+GS +L N+LKEKLL+EGR+PYVIPVG
Sbjct  61   NLLVERLVGAHIDLISKEEYAKIGSESLTNLLKEKLLNEGRRPYVIPVG  109



>gb|EMT11299.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Aegilops 
tauschii]
Length=429

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 124/188 (66%), Gaps = 37/188 (20%)
 Frame = +3

Query  105  KAAIMEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEV  284
            + A    AS    FL+KK Y PP WAS LS +PS  ++LG FPTPIH WNLPNLP  TEV
Sbjct  27   RVAHTSSASQIGSFLSKKVYTPPPWASELSVIPSHNYTLGQFPTPIHKWNLPNLPEGTEV  86

Query  285  WLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDC  464
            W+KRDDL+GM+LSGNKVRKLEF+MADAVAQGADC+IT+GGIQSNHCRATAVAAKY+NLDC
Sbjct  87   WIKRDDLTGMELSGNKVRKLEFMMADAVAQGADCVITIGGIQSNHCRATAVAAKYVNLDC  146

Query  465  YLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGR  644
            YL+L +SK L D                                     +LK++LL +G 
Sbjct  147  YLVLVSSKALTD-------------------------------------LLKKRLLEKGW  169

Query  645  KPYVIPVG  668
            KPYVI  G
Sbjct  170  KPYVISGG  177



>ref|XP_009840456.1| hypothetical protein H257_14374 [Aphanomyces astaci]
 gb|ETV70013.1| hypothetical protein H257_14374 [Aphanomyces astaci]
Length=407

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 131/177 (74%), Gaps = 5/177 (3%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL  + Y PPTWAS+L+  P++   LGNFPTPI  +  P LP   ++++KRDD SG+++S
Sbjct  32   FLKTESYAPPTWASALANPPTERVVLGNFPTPIFPFRPPGLPDGVQMFIKRDDYSGLEMS  91

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNK RKLEFL+A+A+ QGADC++T GG+QSNHCRATAVAA+ + LD YL+LRTS    + 
Sbjct  92   GNKARKLEFLLAEALRQGADCVVTCGGVQSNHCRATAVAARMMGLDSYLLLRTSD--TET  149

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGS--VALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLL++RLVGA + LV + EYAK G     +A  + EKL  +GRKPY IPVG
Sbjct  150  DPGLVGNLLIDRLVGAELILVPRREYAKQGGGDYFIAKTV-EKLRKQGRKPYGIPVG  205



>ref|XP_005850727.1| hypothetical protein CHLNCDRAFT_34235 [Chlorella variabilis]
 gb|EFN58625.1| hypothetical protein CHLNCDRAFT_34235 [Chlorella variabilis]
Length=373

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 130/183 (71%), Gaps = 5/183 (3%)
 Frame = +3

Query  126  ASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDL  305
            AS  FQ    +PY PP WA++L+ +P     L   PTPIH W +P +P   E+ +KRDDL
Sbjct  6    ASQMFQL---QPYTPPAWATNLALLPKQRCHLAQLPTPIHPWPVPGVPPGCELHIKRDDL  62

Query  306  SGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTS  485
            +GMQLSGNKVRKLEFLMA+AV +G D IIT+GGIQSNH RATAVAA+YL L C+LILR S
Sbjct  63   TGMQLSGNKVRKLEFLMAEAVQRGHDSIITIGGIQSNHARATAVAARYLGLPCHLILRNS  122

Query  486  KVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHE--GRKPYVI  659
            K L D DPGL GNLLVERL+GAHI  V+KEEY + G  AL   L  +L     G  P+VI
Sbjct  123  KHLADSDPGLVGNLLVERLIGAHIWQVTKEEYGRYGGPALGERLAAQLRQAPWGLNPFVI  182

Query  660  PVG  668
            PVG
Sbjct  183  PVG  185



>ref|XP_006343533.1| PREDICTED: uncharacterized protein LOC102604926 [Solanum tuberosum]
Length=231

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/100 (94%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +3

Query  294  RDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLI  473
            RDD+SGMQLSGNKVRKLEFL+ADAVAQGADCI+T+GGIQSNHCRATAVAAKYLNLDCYLI
Sbjct  99   RDDMSGMQLSGNKVRKLEFLLADAVAQGADCIVTIGGIQSNHCRATAVAAKYLNLDCYLI  158

Query  474  LRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVG  593
            LRTSK+LVDKDPGLTGNLLV+RLVGAHIDLVSKEEYAKVG
Sbjct  159  LRTSKLLVDKDPGLTGNLLVDRLVGAHIDLVSKEEYAKVG  198



>ref|XP_008604210.1| hypothetical protein SDRG_00508 [Saprolegnia diclina VS20]
 gb|EQC42787.1| hypothetical protein SDRG_00508 [Saprolegnia diclina VS20]
Length=377

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 126/176 (72%), Gaps = 3/176 (2%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL ++PY  PTWA+ L+  P +   LGNFPTPI+ +  P LP +  +++KRDD SG+++S
Sbjct  6    FLEREPYTAPTWATELANAPKERVVLGNFPTPIYPFRPPGLPADVTMYIKRDDYSGLEIS  65

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNK RKLEFL+A+A+AQGADC++T GGIQSNHCRATAVAA+ L LD  +ILR        
Sbjct  66   GNKARKLEFLLAEALAQGADCVVTCGGIQSNHCRATAVAARMLGLDATIILRADDPTA--  123

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSV-ALANILKEKLLHEGRKPYVIPVG  668
            DPGL GNLL++RLVGA + +VS+ +YAK G          E+L  +GRKPY IPVG
Sbjct  124  DPGLVGNLLIDRLVGAELLMVSRSDYAKHGGGDYFIEKTCERLRAQGRKPYGIPVG  179



>ref|XP_009515993.1| hypothetical protein PHYSODRAFT_309478 [Phytophthora sojae]
 gb|EGZ28718.1| hypothetical protein PHYSODRAFT_309478 [Phytophthora sojae]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = +3

Query  159  PYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVR  338
            P+ PP WAS+L   P+    LG+FPTPI  +  P LP    +++KRDD SGM+ SGNK+R
Sbjct  6    PFAPPAWASALRRPPAQKLRLGHFPTPILPFTPPGLPEGVRLFIKRDDFSGMETSGNKIR  65

Query  339  KLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLT  518
            KLEFL+A+A+ Q ADCI+T GGIQSNHCRATA  A+ L LD YL+LRT+K   D+DPGL 
Sbjct  66   KLEFLLAEALEQKADCIVTCGGIQSNHCRATAAVARMLGLDSYLLLRTNK--PDEDPGLV  123

Query  519  GNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            GN+L +R++ A++  +S++EY K GS A+     E+L  EGR+PY IPVG
Sbjct  124  GNVLFDRMLDANLIQMSRQEYGKYGSEAMIKRTCERLKKEGRRPYAIPVG  173



>gb|KDO27924.1| hypothetical protein SPRG_07198, partial [Saprolegnia parasitica 
CBS 223.65]
Length=390

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 132/189 (70%), Gaps = 16/189 (8%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            FL ++PY  PTWA+ L+  P +   LGNFPTPI+ +  P LP +  +++KRDD SG+++S
Sbjct  6    FLEREPYTAPTWATELANAPKERVVLGNFPTPIYPFRPPGLPADVTMYIKRDDYSGLEIS  65

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNK RKLEFL+A+A+AQGADC++T GGIQSNHCRATAVAA+ L LD  +ILR        
Sbjct  66   GNKARKLEFLLAEALAQGADCVVTCGGIQSNHCRATAVAARMLGLDATIILRADDPTA--  123

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGS----------VALANI--LK--EKLLHEG  641
            DPGL GNLL++RLVGA + +VS+ +YAK G            ALA+   LK  E+L  +G
Sbjct  124  DPGLVGNLLIDRLVGAELLMVSRSDYAKHGGGDYFIEVCVLRALASPCGLKTCERLRAQG  183

Query  642  RKPYVIPVG  668
            RKPY IPVG
Sbjct  184  RKPYGIPVG  192



>ref|XP_008898732.1| hypothetical protein PPTG_06545 [Phytophthora parasitica INRA-310]
 gb|ETI31124.1| hypothetical protein F443_21848 [Phytophthora parasitica P1569]
 gb|ETK71508.1| hypothetical protein L915_21243 [Phytophthora parasitica]
 gb|ETL24952.1| hypothetical protein L916_21110 [Phytophthora parasitica]
 gb|ETM31430.1| hypothetical protein L914_20985 [Phytophthora parasitica]
 gb|ETN16401.1| hypothetical protein PPTG_06545 [Phytophthora parasitica INRA-310]
 gb|ETP00943.1| hypothetical protein F441_21730 [Phytophthora parasitica CJ01A1]
 gb|ETP29080.1| hypothetical protein F442_21709 [Phytophthora parasitica P10297]
Length=370

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  147  LTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSG  326
            L   P+ PP WAS+L   P+    LG+FPTPI  ++ P LP    +++KRDD SGM+ SG
Sbjct  2    LKSVPFVPPAWASALRRPPAQKLRLGHFPTPILPFSPPGLPDGVRMFIKRDDFSGMETSG  61

Query  327  NKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKD  506
            NK+RKLEFL+A+A+ Q ADC +T GGIQSNHCRATA  A+ L LD YL+LRT+K   D+D
Sbjct  62   NKIRKLEFLLAEALDQKADCFVTCGGIQSNHCRATAAVARILGLDSYLLLRTNK--PDED  119

Query  507  PGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            PGL GN+L +R++ A++  +S++EY K GS A+     E+L  EGR PY IPVG
Sbjct  120  PGLVGNVLFDRMLDANLIQMSRQEYGKYGSEAMIKRTCERLRKEGRHPYAIPVG  173



>ref|XP_002906856.1| D-cysteine desulfhydrase, putative [Phytophthora infestans T30-4]
 gb|EEY66257.1| D-cysteine desulfhydrase, putative [Phytophthora infestans T30-4]
Length=370

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  147  LTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSG  326
            L   P+ PP WAS+L   P     LG+FPTPI  ++ P LP    + +KRDD SGM+ SG
Sbjct  2    LKSVPFVPPAWASALRSPPGQKLHLGHFPTPILPFSPPGLPDGVRMLIKRDDFSGMETSG  61

Query  327  NKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKD  506
            NK+RKLEFL+A+A+ Q ADCI+T GG+QSNHCRATA  A+ L LD YL+LRT+K   D+D
Sbjct  62   NKIRKLEFLLAEALEQKADCIVTCGGMQSNHCRATAAVARMLGLDSYLLLRTNK--PDED  119

Query  507  PGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            PGL GN+L +R++ A++  +S++EY K GS A+     ++L +EGR+PY IPVG
Sbjct  120  PGLVGNVLFDRMLDANLIQMSRQEYGKCGSEAMIKRTCDRLRNEGRRPYAIPVG  173



>ref|XP_011399663.1| Putative 1-aminocyclopropane-1-carboxylate deaminase, partial 
[Auxenochlorella protothecoides]
 gb|KFM26725.1| Putative 1-aminocyclopropane-1-carboxylate deaminase, partial 
[Auxenochlorella protothecoides]
Length=399

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 128/176 (73%), Gaps = 0/176 (0%)
 Frame = +3

Query  141  QFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL  320
              ++ + Y PP+WA+ L   P+    L   P+ +H W LP LP   E+++KRDDL+GMQL
Sbjct  4    HMVSLEAYTPPSWAAHLPNPPTQRLRLAVTPSLLHPWPLPGLPPGLELFIKRDDLTGMQL  63

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFL+A A A+G D +IT+GGIQSNH RATAVAA+Y  LD +LILRTS++  D
Sbjct  64   SGNKVRKLEFLLAKAKAEGHDSVITIGGIQSNHARATAVAARYCGLDSHLILRTSRLAAD  123

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             DPGL GNLLVERLVGAHI  V+KEEYA  GS AL   L+ +L  +G  PYVIPVG
Sbjct  124  SDPGLVGNLLVERLVGAHIHTVTKEEYAAAGSRALTAQLERQLRGQGANPYVIPVG  179



>gb|ETL78167.1| hypothetical protein L917_20968 [Phytophthora parasitica]
Length=370

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  147  LTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSG  326
            L   P+ P  WAS+L   P+    LG+FPTPI  ++ P LP    +++KRDD SGM+ SG
Sbjct  2    LKSVPFVPTAWASALRRPPAQKLRLGHFPTPILPFSPPGLPDGVRMFIKRDDFSGMETSG  61

Query  327  NKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKD  506
            NK+RKLEFL+A+A+ Q ADCI+T GGIQSNHCRATA  A+ L LD YL+LRT+K   D+D
Sbjct  62   NKIRKLEFLLAEALDQKADCIVTCGGIQSNHCRATAAVARILGLDSYLLLRTNK--PDED  119

Query  507  PGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            PGL GN+L +R++ A++  +S++EY K GS A+     E+L  EGR PY IPVG
Sbjct  120  PGLVGNVLFDRMLDANLIQMSRQEYGKYGSEAMIKRTCERLRKEGRHPYAIPVG  173



>gb|ETO59840.1| hypothetical protein F444_21871 [Phytophthora parasitica P1976]
Length=370

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +3

Query  147  LTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSG  326
            L   P+ P  WAS+L   P+    LG+FPTPI  ++ P LP    +++KRDD SGM+ SG
Sbjct  2    LKSVPFVPTAWASALRRPPAQKLRLGHFPTPILPFSPPGLPDGVRMFIKRDDFSGMETSG  61

Query  327  NKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKD  506
            NK+RKLEFL+A+A+ Q ADC +T GGIQSNHCRATA  A+ L LD YL+LRT+K   D+D
Sbjct  62   NKIRKLEFLLAEALDQKADCFVTCGGIQSNHCRATAAVARILGLDSYLLLRTNK--PDED  119

Query  507  PGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            PGL GN+L +R++ A++  +S++EY K GS A+     E+L  EGR PY IPVG
Sbjct  120  PGLVGNVLFDRMLDANLIQMSRQEYGKYGSEAMIKRTCERLRKEGRHPYAIPVG  173



>ref|XP_001637312.1| predicted protein [Nematostella vectensis]
 gb|EDO45249.1| predicted protein [Nematostella vectensis]
Length=364

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 118/172 (69%), Gaps = 7/172 (4%)
 Frame = +3

Query  159  PYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVR  338
            PY PP+W  +L  +PS    L    TPIH W+ P LP + ++ +KRDDL+G  LSGNKVR
Sbjct  6    PYVPPSWVRNLRKIPSHYVELARRNTPIHPWHPPGLPGDFKLCIKRDDLTGSTLSGNKVR  65

Query  339  KLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDP--G  512
            KLEFLMADA+ +  D +IT GGIQSNHCRATAVAA+ LN+DCYL+LR      DKDP  G
Sbjct  66   KLEFLMADAIKKKCDTVITCGGIQSNHCRATAVAARELNMDCYLLLRHK----DKDPPAG  121

Query  513  LTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
              GNLL+ RLVG+H+ LV  E Y     + + N L EKL  +G+ PYVIP+G
Sbjct  122  YHGNLLLNRLVGSHLMLVPYEGYESGLKMRMEN-LAEKLRQQGKSPYVIPLG  172



>ref|XP_005835247.1| hypothetical protein GUITHDRAFT_136785 [Guillardia theta CCMP2712]
 gb|EKX48267.1| hypothetical protein GUITHDRAFT_136785 [Guillardia theta CCMP2712]
Length=212

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 119/178 (67%), Gaps = 18/178 (10%)
 Frame = +3

Query  186  SLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADA  365
            +LS +PS    + + PT I  W +P +P    +W+KRDD SGM LSGNKVRKLEFLMA+A
Sbjct  10   NLSSIPSHFVPMASLPTGIEPWRIP-VPDGINLWIKRDDKSGMGLSGNKVRKLEFLMAEA  68

Query  366  VAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK--------------  503
            +A+G DC++T+GG+QSNHCRATAVAAK L L+ YLILR +   + +              
Sbjct  69   LARGCDCVVTIGGVQSNHCRATAVAAKKLGLESYLILRQTDAELQQKIDPGKCLRIPSKS  128

Query  504  ---DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                PGLTGNL++ R+VGA++ +VSK EYA+ G   L N L E+L  EG+KPY I VG
Sbjct  129  FTFQPGLTGNLMISRMVGANLVMVSKSEYARFGQKVLLNNLIEQLEQEGKKPYGIAVG  186



>ref|XP_008877014.1| hypothetical protein H310_11927 [Aphanomyces invadans]
 gb|ETV94252.1| hypothetical protein H310_11927 [Aphanomyces invadans]
Length=411

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 115/157 (73%), Gaps = 3/157 (2%)
 Frame = +3

Query  201  PSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGA  380
            P++   LGNFPTPI  +  P LP   ++++KRDD SG+++SGNK RKLEFL+A+A+ +GA
Sbjct  53   PTERVVLGNFPTPIFPFRPPGLPEGVQMFIKRDDYSGLEMSGNKARKLEFLLAEALREGA  112

Query  381  DCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHID  560
            DC++T GG+QSNHCRATAV+A+ L LD YL+LRTS    + DPGL GNLL++RLVG+ + 
Sbjct  113  DCVVTCGGVQSNHCRATAVSARMLGLDSYLLLRTSD--TESDPGLIGNLLIDRLVGSELI  170

Query  561  LVSKEEYAKVGSV-ALANILKEKLLHEGRKPYVIPVG  668
            LV + EYAK G          EKL  +GRKPY IPVG
Sbjct  171  LVPRLEYAKQGGGDYFIEKTVEKLRLQGRKPYGIPVG  207



>ref|XP_005783691.1| hypothetical protein EMIHUDRAFT_418319 [Emiliania huxleyi CCMP1516]
 gb|EOD31262.1| hypothetical protein EMIHUDRAFT_418319 [Emiliania huxleyi CCMP1516]
Length=409

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVW-LKRDDLSGMQL  320
             L +  Y PP WAS+L+        LG+ PTP+  W    L      W +KRDDLSG +L
Sbjct  5    LLQRLSYTPPPWASALAAPTHGRIKLGHLPTPLMRWACGALSELGVRWSIKRDDLSGNEL  64

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AVA G DC++T+GG+QSNHCRATA AA+ + +D +LIL        
Sbjct  65   SGNKVRKLEFLMAEAVAGGHDCVVTIGGVQSNHCRATAAAARLVGIDAHLILLVRDKSFG  124

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGS-VALANILKEK----LLHEGRKPYVIPV  665
             +PGL GNLL++RL+GA + L S  +Y + G  +A  N + E+    L  +GR PY++PV
Sbjct  125  DEPGLQGNLLLDRLLGATLHLCSGSDYLRQGGDLAAMNRINEQVAAELRRQGRVPYIVPV  184

Query  666  G  668
            G
Sbjct  185  G  185



>ref|XP_005787529.1| hypothetical protein EMIHUDRAFT_429282 [Emiliania huxleyi CCMP1516]
 gb|EOD35100.1| hypothetical protein EMIHUDRAFT_429282 [Emiliania huxleyi CCMP1516]
Length=408

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  144  FLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVW-LKRDDLSGMQL  320
             L +  Y PP WAS+L+        LG+ PTP+  W    L      W +KRDDLSG +L
Sbjct  5    LLQRLSYTPPPWASALAAPTHGRIKLGHLPTPLMRWACGALSELGVRWSIKRDDLSGNEL  64

Query  321  SGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD  500
            SGNKVRKLEFLMA+AVA G DC++T+GG+QSNHCRATA AA+ + +D +LIL        
Sbjct  65   SGNKVRKLEFLMAEAVAGGHDCVVTIGGVQSNHCRATAAAARLVGIDAHLILLVRDKSFG  124

Query  501  KDPGLTGNLLVERLVGAHIDLVSKEEYAKVGS-VALANILKEK----LLHEGRKPYVIPV  665
             +PGL GNLL++RL+GA + L S  +Y + G  +A  N + E+    L  +GR PY++PV
Sbjct  125  DEPGLQGNLLLDRLLGATLHLCSGSDYLRQGGDLAAMNRINEQVAAELRRQGRVPYIVPV  184

Query  666  G  668
            G
Sbjct  185  G  185



>ref|XP_001630448.1| predicted protein [Nematostella vectensis]
 gb|EDO38385.1| predicted protein [Nematostella vectensis]
Length=370

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 109/169 (64%), Gaps = 3/169 (2%)
 Frame = +3

Query  162  YQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRK  341
            ++PPTWA+ L  +P     L    TP+H W+LP++P   ++ +KRDD++G  +SGNKVRK
Sbjct  14   FEPPTWAAGLKNLPKYYVKLAQHNTPVHEWDLPDIPNGFQIGIKRDDMTGSNMSGNKVRK  73

Query  342  LEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTG  521
            LEFL+ADA+ +  D I TLG I SNHCR+TA+A K L L+CYL +R  +   + D G  G
Sbjct  74   LEFLLADALEKKCDTIFTLGSIYSNHCRSTAIATKQLGLECYLFMRHRE--KNTDIGSMG  131

Query  522  NLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            N+L  R+ G+H+ L   E Y  + +    + LKEKL  EG+  Y+IP G
Sbjct  132  NMLFNRMTGSHMILTEYEPY-DIATYPKMDRLKEKLEKEGKSVYIIPAG  179



>ref|XP_011664993.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial isoform X2 [Strongylocentrotus 
purpuratus]
Length=331

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 119/187 (64%), Gaps = 12/187 (6%)
 Frame = +3

Query  117  MEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKR  296
            M+ +  PF      PY+PP+WA++L+ +P   F L N  TPIH W LP  P + EV++KR
Sbjct  1    MQKSDYPFL-----PYEPPSWAANLALIPKFKFQLANLNTPIHKWRLPRTPDDFEVFVKR  55

Query  297  DDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLIL  476
            DD++G  LSGNK+RKLEFL+ADAV +G + I+T GG++SNHCRATA+++  L L+C+L L
Sbjct  56   DDMTGSVLSGNKIRKLEFLLADAVDKGCEVILTCGGVRSNHCRATAISSCQLGLECHLFL  115

Query  477  --RTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE-EYAKVGSVALANILKEKLLHEGRK  647
              RT     D     TGN L++R+VGA+  LV  E  + K     +  + +  +   G+K
Sbjct  116  WSRTK----DLKGQFTGNTLLDRMVGANFYLVPSECSFQKEIYPRMQQLQEHIMKTSGKK  171

Query  648  PYVIPVG  668
             Y IP+G
Sbjct  172  CYSIPLG  178



>ref|XP_782004.3| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X1 [Strongylocentrotus purpuratus]
Length=378

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 119/187 (64%), Gaps = 12/187 (6%)
 Frame = +3

Query  117  MEDASNPFQFLTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKR  296
            M+ +  PF      PY+PP+WA++L+ +P   F L N  TPIH W LP  P + EV++KR
Sbjct  1    MQKSDYPFL-----PYEPPSWAANLALIPKFKFQLANLNTPIHKWRLPRTPDDFEVFVKR  55

Query  297  DDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLIL  476
            DD++G  LSGNK+RKLEFL+ADAV +G + I+T GG++SNHCRATA+++  L L+C+L L
Sbjct  56   DDMTGSVLSGNKIRKLEFLLADAVDKGCEVILTCGGVRSNHCRATAISSCQLGLECHLFL  115

Query  477  --RTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE-EYAKVGSVALANILKEKLLHEGRK  647
              RT     D     TGN L++R+VGA+  LV  E  + K     +  + +  +   G+K
Sbjct  116  WSRTK----DLKGQFTGNTLLDRMVGANFYLVPSECSFQKEIYPRMQQLQEHIMKTSGKK  171

Query  648  PYVIPVG  668
             Y IP+G
Sbjct  172  CYSIPLG  178



>ref|XP_001630447.1| predicted protein [Nematostella vectensis]
 gb|EDO38384.1| predicted protein [Nematostella vectensis]
Length=370

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 109/171 (64%), Gaps = 3/171 (2%)
 Frame = +3

Query  156  KPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKV  335
            + ++PPTWA+ L  +P     L    TP+H W+L ++P   ++ +KRDD++G  +SGNKV
Sbjct  12   QRFEPPTWAAGLKNLPKYYVKLAQHNTPVHEWDLLDIPNGFQIGIKRDDMTGSNMSGNKV  71

Query  336  RKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGL  515
            RKLEFL+ADA+ +  D I T+G I SNHCR+TA+A K L L+CYL +R  +   + + G 
Sbjct  72   RKLEFLLADALEKKCDTIFTMGSIYSNHCRSTAIATKQLGLECYLFVRHRE--KNTNIGS  129

Query  516  TGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             GN+L  R+ G+HI L     Y  V +    + LKEKL  EG+  Y+IPVG
Sbjct  130  MGNMLFNRMTGSHIILTEYGPYEIV-TYPKMDRLKEKLEKEGKSVYIIPVG  179



>ref|NP_001229618.1| uncharacterized protein LOC578025 [Strongylocentrotus purpuratus]
Length=378

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 107/177 (60%), Gaps = 13/177 (7%)
 Frame = +3

Query  156  KPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKV  335
            K Y    W   L  +P     L    TPIH WNLP  P N +V++KRDD++G  LSGNK+
Sbjct  7    KSYSAAPWMEELKHIPRHRLELAMLNTPIHRWNLPGTPANFDVFIKRDDMTGSSLSGNKI  66

Query  336  RKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGL  515
            RKLEFL+ADAV+QG D +IT GG++SNHCR TAVA + L +DC+L+LR+     + D   
Sbjct  67   RKLEFLLADAVSQGCDTVITCGGVRSNHCRTTAVATRQLGMDCHLLLRSEA--TNLDGSF  124

Query  516  TGNLLVERLVGAHIDLVSKEE------YAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            TGN L++ +VG    L+ K+       Y ++    L   L++ L   G+K Y IP+G
Sbjct  125  TGNTLLDSMVGCSFYLIPKKSQYNSHIYPRM--QQLVEYLRDSL---GKKAYPIPIG  176



>ref|XP_009053466.1| hypothetical protein LOTGIDRAFT_175080 [Lottia gigantea]
 gb|ESO95839.1| hypothetical protein LOTGIDRAFT_175080 [Lottia gigantea]
Length=383

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = +3

Query  156  KPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKV  335
            KPY P  W S L  +PS +  L   PTPI  WNLP +P   ++ +KRDD++G  LSGNKV
Sbjct  11   KPYHPAPWMSDLHGIPSHIVELSQKPTPIQPWNLPRVPDGYQISIKRDDMTGSTLSGNKV  70

Query  336  RKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDP--  509
            RKLEFL+ADA+ +    +IT+GGIQSNHCRA A+AA+ L L  +L LR+     +K+   
Sbjct  71   RKLEFLLADAIHKECQHVITIGGIQSNHCRAVAIAARQLGLTPHLFLRSE----EKEEFY  126

Query  510  -GLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLH-EGRKPYVIPVG  668
             G  GNLL++++VG++I  + K+   K   +     L E +    G K Y+IPVG
Sbjct  127  NGSEGNLLLDKMVGSNIYFIPKKSTYKKDCLPRMEQLAEHIQSTRGEKSYIIPVG  181



>ref|XP_003383708.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Amphimedon 
queenslandica]
Length=373

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 106/174 (61%), Gaps = 4/174 (2%)
 Frame = +3

Query  153  KKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNK  332
            + PY PP WA  L+ +P     L   PTPIH W++P LP   ++++KRDDL+G  LSGNK
Sbjct  12   QSPYTPPDWAKGLAVIPKTRIKLAQLPTPIHSWSVPGLPDGFQLYIKRDDLTGSTLSGNK  71

Query  333  VRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG  512
            VRKLEF+ ++ + QG D +IT G +QSNH RATAV AK L +D + +L      V+ +P 
Sbjct  72   VRKLEFIFSEVLDQGCDTVITGGSLQSNHARATAVVAKELGMDSHCVLFNKDTDVNIEP-  130

Query  513  LTGNLLVERLVGAHIDLVSKEEYAKVGSV--ALANILKEKLLHEGRKPYVIPVG  668
              GNLL+ RL  + I L+ +       +V   +   L  KL  +G+KPYVI +G
Sbjct  131  -KGNLLLSRLTDSLIGLIPQGNLNDAFNVYSRIFTDLSNKLQAKGKKPYVIELG  183



>ref|XP_011409801.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Amphimedon 
queenslandica]
Length=380

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 110/181 (61%), Gaps = 15/181 (8%)
 Frame = +3

Query  156  KPYQPPTWASSL-SPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNK  332
            +PY PP W   L SP P+    +   PTPIH W++P LP   ++++KRDDL+G  L+GNK
Sbjct  19   QPYTPPEWTKKLQSPPPTHRLHIAQLPTPIHSWSVPGLPDGFQLYIKRDDLTGAALTGNK  78

Query  333  VRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG  512
            +RKLEFLMADAV +  D +IT+GGIQSNH RATAV  + L +  +L+LR     VD   G
Sbjct  79   IRKLEFLMADAVDKQCDSVITIGGIQSNHARATAVLGRQLGMQPHLLLR-----VDDPVG  133

Query  513  LTGNLLVERLVGAHI---------DLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPV  665
             +GNLL++RL+G+ I         D ++++     G   + +   + L  +G  PY I +
Sbjct  134  CSGNLLLDRLMGSDIILCPQRKKEDKITQDGTLVKGMDTIMDEYAQFLRSKGHNPYPITI  193

Query  666  G  668
            G
Sbjct  194  G  194



>gb|ELT93489.1| hypothetical protein CAPTEDRAFT_123695 [Capitella teleta]
Length=362

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  162  YQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRK  341
            Y PP+WA  L  VP+    LG+  TP+H W LP LP + ++ +KRDD++G  L GNK+RK
Sbjct  13   YTPPSWAEKLKNVPTHRIQLGHLNTPVHSWKLPGLPRDVQLAIKRDDMTGSTLGGNKIRK  72

Query  342  LEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTG  521
            LEFL ADA+ +G   +IT GG+QSNHCRA AVA   L L C+L+LR+    V KD G  G
Sbjct  73   LEFLFADALQKGCRHVITCGGLQSNHCRAVAVACAQLGLKCHLVLRSGLKDV-KDAGCEG  131

Query  522  NLLVERLVGAHIDLV-SKEEY  581
            N+ +++++GA +  V +K EY
Sbjct  132  NVFLDKMMGASLYYVPTKAEY  152



>ref|XP_002895266.1| D-cysteine desulfhydrase, putative [Phytophthora infestans T30-4]
 gb|EEY59031.1| D-cysteine desulfhydrase, putative [Phytophthora infestans T30-4]
Length=314

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +3

Query  312  MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKV  491
            M+ SGNK+RKLEFL+A+A+ Q ADCI+T GG+QSNHCRATA  A+ L LD YL+LRT+K 
Sbjct  1    METSGNKIRKLEFLLAEALEQKADCIVTCGGMQSNHCRATAAVARMLGLDSYLLLRTNK-  59

Query  492  LVDKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
              D+DPGL GN+L +R++ A++  +S++EY K GS A+     ++L +EGR+PY IPVG
Sbjct  60   -PDEDPGLVGNVLFDRMLDANLIQMSRQEYGKCGSEAMIKRTCDRLRNEGRRPYAIPVG  117



>ref|XP_006823418.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Saccoglossus kowalevskii]
Length=398

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 105/173 (61%), Gaps = 9/173 (5%)
 Frame = +3

Query  162  YQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRK  341
            Y PP WA +L  +P     L  + TPIH WN+P +P   ++ +KRDDL+G  LSGNKVRK
Sbjct  36   YDPPEWAKTLKRIPECKVKLSMYDTPIHPWNIPGIPNEFKLHIKRDDLTGSTLSGNKVRK  95

Query  342  LEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDP---G  512
            LEFL+ +AV  G   IIT GGIQSN  R+ AVAA+ L L+ +L+LR+       DP   G
Sbjct  96   LEFLLGEAVNTGCTSIITCGGIQSNFARSAAVAARQLGLESHLLLRSEGT----DPDLIG  151

Query  513  LTGNLLVERLVGAHIDLVSKE-EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
              GNLL+ R+VG+HI L+ +  +Y     V +   L +K+   G K Y + VG
Sbjct  152  CEGNLLLNRMVGSHIYLIPRTCKYEPDIRVRMEK-LAQKIDDGGGKSYPMEVG  203



>ref|WP_012830343.1| D-cysteine desulfhydrase [Haliangium ochraceum]
 gb|ACY17751.1| pyridoxal phosphate-dependent enzyme, D- cysteine desulfhydrase 
family [Haliangium ochraceum DSM 14365]
Length=337

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            SL   PTP+            ++W+KRDDL+G++++GNKVRKLEFL+ADA+A+GAD +IT
Sbjct  11   SLARLPTPLEPLPATGAMLGVDLWIKRDDLTGVEMTGNKVRKLEFLLADALAKGADTLIT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GG QSNHCRATA AA+   +D  L+LRT     ++ P   GN+L++RLVGA I  +  +
Sbjct  71   CGGEQSNHCRATAFAARQAGMDALLLLRTRD--PEQPPPARGNILLDRLVGAEIQWIDHQ  128

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             Y        A    E+L   GR PY+IP G
Sbjct  129  TYGNRAQRMAAE--AERLRSAGRTPYIIPEG  157



>ref|XP_002288615.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94051.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=412

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 118/190 (62%), Gaps = 20/190 (11%)
 Frame = +3

Query  159  PYQPPTWASS-LSPVPSD-VFSLGNFPTPIHIWN-----------LPNLPT-NTEVWLKR  296
            PYQPP WA   L+ VP++    L N PTPIH+             L  L   N ++++KR
Sbjct  11   PYQPPAWAEGKLTNVPTNGRLLLANLPTPIHLIGSKADGGGKNSILSRLKELNIKLYIKR  70

Query  297  DDLSG-MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLI  473
            DD +G  +L GNK+RKLEFL+ADA+A+G D ++T+GG QSNHCRATA A++ + +  +LI
Sbjct  71   DDATGGAELGGNKIRKLEFLLADALAKGCDSVVTIGGEQSNHCRATAAASRMVGMSPHLI  130

Query  474  LRTSKV-LVDK---DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEG  641
            LRT +   +D    + G  GN+L +R+VG+ I   +  EY ++GS  L + + + L  + 
Sbjct  131  LRTRRADSIDNKTDEMGWNGNILFDRMVGSTIYTCTPGEYGRLGSNKLVDGVCDYLQFKA  190

Query  642  RK-PYVIPVG  668
            ++ PY IPVG
Sbjct  191  KQNPYAIPVG  200



>ref|XP_796433.2| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
 ref|XP_011666977.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
Length=379

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 110/178 (62%), Gaps = 17/178 (10%)
 Frame = +3

Query  159  PYQPPTWASSLSP--VPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNK  332
            PY+ P+W S+++   +P     LG   TPI  W LP++P + EV++KRDD++G  L+GNK
Sbjct  11   PYEAPSWTSTINKDMIPKYTIKLGTLNTPIQRWRLPDIPDDFEVFVKRDDMTGSVLTGNK  70

Query  333  VRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG  512
            VRKLEFLMAD V +G   +I  GGI SN CRA A+AA+ + LD +L+L + +     +  
Sbjct  71   VRKLEFLMADCVDKGCQAVIACGGIFSNSCRAAAIAARQMGLDSHLLLWSKET----EMP  126

Query  513  LTGNLLVERLVGAHIDLVSK------EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             TGN L++RLVG++  L+ K      + Y ++  +  A+ILK      G+K Y IP G
Sbjct  127  FTGNALLDRLVGSNFYLMPKDCPFQTDVYPRMRQL-YAHILKT----SGKKAYQIPFG  179



>gb|EJK45891.1| hypothetical protein THAOC_35476 [Thalassiosira oceanica]
Length=419

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 110/187 (59%), Gaps = 20/187 (11%)
 Frame = +3

Query  162  YQPPTWASSL---SPVPSDVFSLGNFPTPIH----------IWNLPNLPTNTEVWLKRDD  302
            Y+PP++A +      +P+    L N PTP+H          +  L  L  N ++++KRDD
Sbjct  10   YEPPSFAKNFFDEGAMPTHRLRLANLPTPVHRVIGGAQDGILARLKEL--NIKLYIKRDD  67

Query  303  LSG-MQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILR  479
             +G  +L GNKVRKLE LM DA+A+  D ++T+GG QSNHCRATA A++ +NL  +LILR
Sbjct  68   ATGGAELGGNKVRKLEMLMCDAIAKRCDSVVTIGGEQSNHCRATAAASRMMNLSPHLILR  127

Query  480  TSKVLV----DKDPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRK  647
            T +       D+  G TGN+L +R+VG+ I   +  EY ++GS  L   + + L   G  
Sbjct  128  TRRADAIERNDEGMGYTGNVLFDRMVGSTIYTCTPGEYGRLGSNTLVGSVCDHLESNGFN  187

Query  648  PYVIPVG  668
            P  IPVG
Sbjct  188  PNAIPVG  194



>ref|WP_020209703.1| hypothetical protein [Gilvimarinus chinensis]
Length=332

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 92/150 (61%), Gaps = 6/150 (4%)
 Frame = +3

Query  219  LGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITL  398
            L   PTP     +P    +  +W+KRDDL+G  LSGNKVRKLEF +A+A++QGAD +IT 
Sbjct  12   LAQLPTPFKPLPIPTYSGDRRLWIKRDDLTGSLLSGNKVRKLEFTLAEALSQGADTLITC  71

Query  399  GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEE  578
            GG+QSNHCRATAV A    L C LILR     V       GN+L+ +L GA + +    E
Sbjct  72   GGLQSNHCRATAVLAAEHGLGCELILRGDPPAVSD-----GNMLLAQLAGAKLHIYGARE  126

Query  579  YAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            Y    S  L +   E+L+ EGR+PY+IP G
Sbjct  127  YQHKLSSLLVD-HSEQLVREGRRPYIIPTG  155



>ref|XP_011424021.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like isoform 
X1 [Crassostrea gigas]
Length=388

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 107/175 (61%), Gaps = 8/175 (5%)
 Frame = +3

Query  156  KPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKV  335
            K + PP+WA  L  +P  +  L      I++WNLP +P + +V+++R+D +G  +SGNK+
Sbjct  26   KRFSPPSWAQGLRNIPKFIIPLSVKNNQINLWNLPGVPDSFKVFMRREDTNGAVISGNKI  85

Query  336  RKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGL  515
            RKLEFL+ADA+      +IT GGIQSNHCR TA+AA+ L L  +L+LR     VD + G 
Sbjct  86   RKLEFLLADALHTECKHVITCGGIQSNHCRITALAARELGLTPHLVLRGDVQNVD-EVGC  144

Query  516  TGNLLVERLVGAHIDLVSKEE----YAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             GN+L+ RL GAH+ +V +        K     LAN ++E     G + Y+IPVG
Sbjct  145  EGNVLLNRLCGAHMYMVPRLSPYLTELKPRMEKLANTIRET---TGEESYLIPVG  196



>ref|XP_003383705.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Amphimedon 
queenslandica]
Length=374

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 104/187 (56%), Gaps = 27/187 (14%)
 Frame = +3

Query  156  KPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKV  335
            +PY PP WA  LS +P     L   PTPIH W++P LP   ++++KRDDL+G  LSGNKV
Sbjct  9    QPYYPPDWAKELSVIPKTRIKLAQLPTPIHSWSVPGLPDGFQLYIKRDDLTGSTLSGNKV  68

Query  336  RKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLIL------RTSKVLV  497
            RKLEF+ ++A+ QG D +IT GG+QSNH RATAV AK L L    IL           L 
Sbjct  69   RKLEFIFSEALDQGCDTVITGGGLQSNHTRATAVVAKELGLSSLNILYLPPEKTHESSLS  128

Query  498  DKDPGLTGNLLVERLVGAHIDLV----------SKEEYAKVGSVALANILKEKLLHEGRK  647
             K+    GNLL+  +VGA  + V            EEY K  S        ++L+ +G  
Sbjct  129  SKE---KGNLLLSCMVGATSETVPFLAAETRFKQMEEYMKATS--------DRLIVKGHL  177

Query  648  PYVIPVG  668
            P ++ +G
Sbjct  178  PCIVELG  184



>ref|XP_011424022.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like isoform 
X2 [Crassostrea gigas]
Length=373

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 107/175 (61%), Gaps = 8/175 (5%)
 Frame = +3

Query  156  KPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKV  335
            K + PP+WA  L  +P  +  L      I++WNLP +P + +V+++R+D +G  +SGNK+
Sbjct  11   KRFSPPSWAQGLRNIPKFIIPLSVKNNQINLWNLPGVPDSFKVFMRREDTNGAVISGNKI  70

Query  336  RKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGL  515
            RKLEFL+ADA+      +IT GGIQSNHCR TA+AA+ L L  +L+LR     VD + G 
Sbjct  71   RKLEFLLADALHTECKHVITCGGIQSNHCRITALAARELGLTPHLVLRGDVQNVD-EVGC  129

Query  516  TGNLLVERLVGAHIDLVSKEE----YAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             GN+L+ RL GAH+ +V +        K     LAN ++E     G + Y+IPVG
Sbjct  130  EGNVLLNRLCGAHMYMVPRLSPYLTELKPRMEKLANTIRET---TGEESYLIPVG  181



>ref|WP_016403095.1| 1-aminocyclopropane-1-carboxylate deaminase [Agarivorans albus]
 dbj|GAD03328.1| 1-aminocyclopropane-1-carboxylate deaminase [Agarivorans albus 
MKT 106]
Length=325

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 97/152 (64%), Gaps = 11/152 (7%)
 Frame = +3

Query  216  SLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTP+H + NL       ++++KRDDLSG+ L GNKVRKLEFL+ DA+ Q ADCII
Sbjct  10   SLGFFPTPVHPLSNLSAHLAGPQIYIKRDDLSGLALGGNKVRKLEFLLGDAMQQKADCII  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T G  QSNHCR TA AA  LNL CYL+L  S   + +     GN+L+++L GA I    +
Sbjct  70   TAGAAQSNHCRQTAAAAAKLNLPCYLLLGGSAPTLAQ-----GNVLLDKLFGATIIWAGQ  124

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +   + G   LA    ++L+ +G  PYV+P G
Sbjct  125  QRKGE-GIEELA----QQLMQKGMNPYVVPYG  151



>ref|XP_787534.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
 ref|XP_011664376.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
Length=384

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = +3

Query  159  PYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVR  338
            PY  P W S L+ +P     LG+  TPI  W LP +P + +V +KRDD++G  LSGNKVR
Sbjct  15   PYDAPEWTSRLAVIPKYRVQLGSLGTPIQRWRLPGMPEDFQVHIKRDDMTGSVLSGNKVR  74

Query  339  KLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLT  518
            KLEFLMAD + QG + IIT GG+ SN CRA A+AA+ + LD +L L +       D   T
Sbjct  75   KLEFLMADCLDQGCESIITCGGVFSNSCRAGAIAARQMGLDSHLFLWSEST----DLPFT  130

Query  519  GNLLVERLVGAHIDLV  566
            GN L++RLVG +  L+
Sbjct  131  GNALLDRLVGCNFYLM  146



>gb|EKC20722.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Crassostrea 
gigas]
Length=2239

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 108/175 (62%), Gaps = 8/175 (5%)
 Frame = +3

Query  156   KPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKV  335
             K + PP+WA  L  +P  +  L      I++WNLP +P + +V+++R+D +G  +SGNK+
Sbjct  1881  KRFSPPSWAQGLRNIPKFIIPLSVKNNQINLWNLPGVPDSFKVFMRREDTNGAVISGNKI  1940

Query  336   RKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGL  515
             RKLEFL+ADA+      +IT GGIQSNHCR TA+AA+ L L  +L+LR     VD + G 
Sbjct  1941  RKLEFLLADALHTECKHVITCGGIQSNHCRITALAARELGLTPHLVLRGDVQNVD-EVGC  1999

Query  516   TGNLLVERLVGAHIDLVSK-EEY---AKVGSVALANILKEKLLHEGRKPYVIPVG  668
              GN+L+ RL GAH+ +V +   Y    K     LAN ++E     G + Y+IPVG
Sbjct  2000  EGNVLLNRLCGAHMYMVPRLSPYLTELKPRMEKLANTIRETT---GEESYLIPVG  2051



>ref|XP_002121189.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Ciona intestinalis]
Length=391

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 99/173 (57%), Gaps = 9/173 (5%)
 Frame = +3

Query  162  YQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRK  341
            YQ P WA  +   P     L   PTPIH W L  LP + E+++KRDD++G  LSGNKVRK
Sbjct  33   YQAPEWAKDILKKPEKRVKLAVLPTPIHKWRLDGLPQDVELFIKRDDMTGSTLSGNKVRK  92

Query  342  LEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTG  521
            LEF++ DA+++G   +IT G IQSNHCRATAVAA+ L LD YL+LR    ++     L G
Sbjct  93   LEFILGDALSRGCKAVITCGSIQSNHCRATAVAARELGLDSYLLLRNKSPILPCFDNL-G  151

Query  522  NLLVERLVGAHIDLVSK----EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            N L   L G+ I  + K    E   K     LA  ++EK    G     IPVG
Sbjct  152  N-LPSMLCGSQIYFIPKNSKYETTIKPKQEQLAREIEEK---TGNPVCCIPVG  200



>ref|WP_007103711.1| D-cysteine desulfhydrase [Glaciecola polaris]
 dbj|GAC31907.1| D-cysteine desulfhydrase [Glaciecola polaris LMG 21857]
Length=332

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 95/152 (63%), Gaps = 13/152 (9%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG FPTPIH +  L       ++++KRDDL+G+ L GNK RKLE+L+ADAVAQG DC+IT
Sbjct  11   LGVFPTPIHKLARLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADAVAQGCDCVIT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLT-GNLLVERLVGAHIDLVSK  572
             G  QSNHCR TA  A  L L C+L      VL  + P +  GNLL++ L GAHI    +
Sbjct  71   AGAAQSNHCRQTAAGAAKLGLGCHL------VLGGQAPNMANGNLLLDALFGAHIHWSGE  124

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +   +     +  ++ E LL +G+KPYV+P G
Sbjct  125  KRKGE----DIPKLVNE-LLSQGKKPYVVPYG  151



>ref|XP_001619528.1| hypothetical protein NEMVEDRAFT_v1g42395 [Nematostella vectensis]
 gb|EDO27428.1| predicted protein, partial [Nematostella vectensis]
Length=269

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 82/115 (71%), Gaps = 7/115 (6%)
 Frame = +3

Query  330  KVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDP  509
            +VRKLEFLMADA+ +  D +IT GGIQSNHCRATAVAA+ LN+DCYL+LR      DKDP
Sbjct  1    QVRKLEFLMADAIKKKCDTVITCGGIQSNHCRATAVAARELNMDCYLLLRHK----DKDP  56

Query  510  --GLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
              G  GNLL+ RLVG+H+ LV  E Y     + + N L EKL  +G+ PYVIP+G
Sbjct  57   PAGYHGNLLLNRLVGSHLMLVPYEGYESGLKMRMEN-LAEKLRQQGKSPYVIPLG  110



>ref|WP_015595624.1| D-cysteine desulfhydrase [Bacillus sp. 1NLA3E]
 gb|AGK55582.1| D-cysteine desulfhydrase [Bacillus sp. 1NLA3E]
Length=326

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 7/151 (5%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            ++ N PT I   N  N   N  V++KRDD +GM  SGNK+RKLE+L+ DA  Q  D +IT
Sbjct  5    TIANVPTKIEKLNFFNKHLNKTVFIKRDDQTGMATSGNKIRKLEYLLQDAQNQKCDYLIT  64

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GGIQSNH RATAV A    +   LIL+  ++       + GNL   +LVGA I LVS+ 
Sbjct  65   SGGIQSNHARATAVLAAKFRMKTLLILKAGEI-----NRMEGNLFFNQLVGAKIKLVSEN  119

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            EY  +    +   LKE+L+  G +PYVIP+G
Sbjct  120  EYRDL--TPMIEELKEELIDSGHRPYVIPMG  148



>ref|WP_045451759.1| cysteine desulfhydrase [Psychrobacter sp. JCM 18903]
Length=326

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 95/155 (61%), Gaps = 17/155 (11%)
 Frame = +3

Query  216  SLGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTP I +  L        +++KRDD +G+ L GNK RKLEF+M DA+AQGADC+I
Sbjct  10   SLGFFPTPLIALSRLSKALDGPTIFMKRDDNTGLALGGNKTRKLEFIMGDALAQGADCLI  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLT-GNLLVERLVGAHIDLVS  569
            T G  QSNHCR TA AA  L L+C+L      VL  ++P  T GNLL++++ G+HI    
Sbjct  70   TAGAAQSNHCRQTAAAAASLGLECHL------VLGGEEPEQTSGNLLLDKIFGSHIHWAG  123

Query  570  KEEYAKVGSVALANILK--EKLLHEGRKPYVIPVG  668
                 +       +I K  E+L  +G+KPYVIP G
Sbjct  124  ANRKGE-------DIPKIVEQLTKQGKKPYVIPYG  151



>dbj|GAF58324.1| LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate deaminase 
[Psychrobacter sp. JCM 18902]
Length=326

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 95/155 (61%), Gaps = 17/155 (11%)
 Frame = +3

Query  216  SLGNFPTPI-HIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTP+  +  L        +++KRDD +G+ L GNK RKLEF+M DA+AQGADC+I
Sbjct  10   SLGFFPTPLRELSRLSKALDGPTIFMKRDDNTGLALGGNKTRKLEFIMGDALAQGADCVI  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLT-GNLLVERLVGAHIDLVS  569
            T G  QSNHCR TA AA  L L+C+L      VL  ++P  T GNLL++++ G+HI    
Sbjct  70   TAGAAQSNHCRQTAAAAASLGLECHL------VLGGEEPEQTSGNLLLDKIFGSHIHWAG  123

Query  570  KEEYAKVGSVALANILK--EKLLHEGRKPYVIPVG  668
                 +       +I K  E+L  +G+KPYVIP G
Sbjct  124  ANRKGE-------DIPKIVEQLTKQGKKPYVIPYG  151



>ref|XP_002109431.1| hypothetical protein TRIADDRAFT_53453 [Trichoplax adhaerens]
 gb|EDV27597.1| hypothetical protein TRIADDRAFT_53453 [Trichoplax adhaerens]
Length=383

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = +3

Query  162  YQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPN-LP----TNTEVWLKRDDLSGMQLSG  326
            Y PP+WAS+L  +P     L    TPI+ W+LP   P    +N ++++KRDD++G  LSG
Sbjct  11   YTPPSWASTLCYIPQYYLKLAQRLTPIYQWDLPAAFPNRSISNFQIYIKRDDMTGSVLSG  70

Query  327  NKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVD--  500
            NKVRKLEFL+ADA+ +    I+T GGIQSNHCR TAVAA+ L L  YL LR  + +    
Sbjct  71   NKVRKLEFLLADALQKKCTSILTAGGIQSNHCRTTAVAARQLGLSSYLFLRCDEEMRSNL  130

Query  501  KDPGLTGNLLVERLVGAHIDLVSKE  575
            +  G TGN+ +  +V + + L+ ++
Sbjct  131  QLVGCTGNVFLNSMVASKVFLIERK  155



>ref|XP_004342345.1| Dcysteine desulfhydrase [Acanthamoeba castellanii str. Neff]
 gb|ELR20235.1| Dcysteine desulfhydrase [Acanthamoeba castellanii str. Neff]
Length=651

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 108/175 (62%), Gaps = 21/175 (12%)
 Frame = +3

Query  156  KPYQPPTWA--SSLSPVPSDVFSL--GNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLS  323
            +PY  P WA  + L  VP+   SL     PT +H W+LP++    EVW+KRDD +G+  S
Sbjct  305  RPYVAPKWAQEAGLKVVPTKFVSLTSSTGPTRLHRWHLPSV-DGVEVWIKRDDETGLVTS  363

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNK+RKL+FL+ADA+ +  DCI+T+              A+ L ++C+LILRT      +
Sbjct  364  GNKIRKLQFLLADAIDKEHDCIVTI--------------ARELGIECHLILRTD--YTPE  407

Query  504  DPGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +  +TGN+ ++ ++ A + LVS  EY +VGS  L + L ++L  EG+KPY+IPVG
Sbjct  408  NIPITGNVALDMMMNAQLHLVSVAEYNRVGSPQLLSDLGKRLEQEGKKPYLIPVG  462



>ref|WP_025650556.1| MULTISPECIES: cysteine desulfhydrase [Psychrobacter]
Length=333

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 93/154 (60%), Gaps = 15/154 (10%)
 Frame = +3

Query  216  SLGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTP I +  L +      +++KRDD +G+ L GNK RKLEF+M DA+AQGADC+I
Sbjct  10   SLGFFPTPLIELTRLSDKLGGPTIFMKRDDNTGLALGGNKTRKLEFIMGDALAQGADCVI  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T G  QSNHCR TA A   L LDC+L+L       ++    +GNLL++++ G HI     
Sbjct  70   TAGAAQSNHCRQTAAAVASLGLDCHLVLGG-----EEPEQASGNLLLDKIFGCHIHWAGA  124

Query  573  EEYAKVGSVALANILK--EKLLHEGRKPYVIPVG  668
                +       +I K  E+L  +G+KPYVIP G
Sbjct  125  HRKGE-------DIPKIVEQLKTQGKKPYVIPYG  151



>ref|WP_007087484.1| D-cysteine desulfhydrase [Bacillus bataviensis]
 gb|EKN64837.1| D-cysteine desulfhydrase [Bacillus bataviensis LMG 21833]
Length=324

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 9/152 (6%)
 Frame = +3

Query  213  FSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
              + N PTPI   +         ++LKRDD +GM++SGNKVRKLEF +ADA+ QG D +I
Sbjct  4    LQIANLPTPIQKLDRLGEELGVNLYLKRDDFTGMEISGNKVRKLEFSVADALQQGCDTLI  63

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T GGIQSNHCRATA  A  L L C LI+R      +      GNL + + +GA + L+S 
Sbjct  64   TAGGIQSNHCRATAAVAAKLGLGCDLIIRG-----EIPNHFEGNLFMNKALGARVHLISP  118

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            EE  +       + + E L  +G KPY+IPVG
Sbjct  119  EESRE----EKMDEIVENLKSQGHKPYLIPVG  146



>ref|WP_036860353.1| cysteine desulfhydrase [Porticoccus hydrocarbonoclasticus]
Length=338

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 97/157 (62%), Gaps = 11/157 (7%)
 Frame = +3

Query  207  DVFSLGNFPTPIHIWNLPNLPTNT---EVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQG  377
            D  +L   PTP+    LP L T      +W+KRDDL+G  +SGNKVRKLEF++A A+A+G
Sbjct  4    DKLNLAQLPTPLQF--LPRLSTELAGPRIWVKRDDLTGCAVSGNKVRKLEFVLARAIAEG  61

Query  378  ADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHI  557
            AD ++T GG+QSNHCRATAV    L L  +LILR    L ++ P   GNLL++ LVGA I
Sbjct  62   ADTLLTSGGLQSNHCRATAVLGAQLGLKVHLILRGE--LPERPP--DGNLLLDSLVGAEI  117

Query  558  DLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +++Y  +    L +   +     GRKPYVIP G
Sbjct  118  SCYPQKQYQHLPE--LIDHWLDFYRSRGRKPYVIPTG  152



>emb|CBY35070.1| unnamed protein product [Oikopleura dioica]
Length=363

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 98/178 (55%), Gaps = 12/178 (7%)
 Frame = +3

Query  147  LTKKPYQPPTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTN-TEVWLKRDDLSGMQLS  323
            L  +P+  P W  +    PS    L N PTPI  W+L +      + ++KRDDL+G  L+
Sbjct  5    LRSQPWTAPQWVPAAVKRPSSRCVLANVPTPIERWSLKDFGDGKQQFFIKRDDLTGTSLT  64

Query  324  GNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDK  503
            GNKVRKLEFL+ADA+ QG D II  G   SNHCR+TAVA   L L+C+L+      L  K
Sbjct  65   GNKVRKLEFLLADAIEQGCDSIIAWGASTSNHCRSTAVACTELGLECHLL------LTSK  118

Query  504  DPGLT---GNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +P +T   GN+ +  L GAH  +   E  A   +      L  +L   G+K YVIP G
Sbjct  119  EPEITYASGNITLAALSGAH--MYRMEACAFDEADRRMKKLSARLAESGKKAYVIPRG  174



>ref|WP_039994916.1| cysteine desulfhydrase [Glaciecola agarilytica]
Length=333

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 94/153 (61%), Gaps = 15/153 (10%)
 Frame = +3

Query  219  LGNFPTPIHIWNLPNLPTNT---EVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
            LG FPTPIH   LP L  +    ++++KRDDL+G+ L GNK RKLE+L+ADA+A+ +DCI
Sbjct  11   LGVFPTPIH--KLPRLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADALAKDSDCI  68

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT G  QSNHCR TA AA  L L+C+L+L      V       GNLL+++L  AHI    
Sbjct  69   ITAGAAQSNHCRQTAAAAAMLGLECHLVLGGQAPNV-----ANGNLLLDQLFAAHIHWSG  123

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +   +     + NI+   L  +GR PYV+P G
Sbjct  124  DKRKGE----DIPNIVA-ALREQGRNPYVVPYG  151



>dbj|GAC03960.1| D-cysteine desulfhydrase [Glaciecola agarilytica NO2]
Length=349

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 94/153 (61%), Gaps = 15/153 (10%)
 Frame = +3

Query  219  LGNFPTPIHIWNLPNLPTNT---EVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
            LG FPTPIH   LP L  +    ++++KRDDL+G+ L GNK RKLE+L+ADA+A+ +DCI
Sbjct  27   LGVFPTPIH--KLPRLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADALAKDSDCI  84

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT G  QSNHCR TA AA  L L+C+L+L      V       GNLL+++L  AHI    
Sbjct  85   ITAGAAQSNHCRQTAAAAAMLGLECHLVLGGQAPNV-----ANGNLLLDQLFAAHIHWSG  139

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +   +     + NI+   L  +GR PYV+P G
Sbjct  140  DKRKGE----DIPNIVA-ALREQGRNPYVVPYG  167



>ref|WP_003503279.1| D-cysteine desulfhydrase [[Clostridium] symbiosum]
 gb|EGA92513.1| D-cysteine desulfhydrase [ [[Clostridium] symbiosum WAL-14163]
 gb|EGB17447.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [ [[Clostridium] symbiosum WAL-14673]
Length=333

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 99/161 (61%), Gaps = 8/161 (5%)
 Frame = +3

Query  189  LSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAV  368
            + P P+ +  L N PT I      +  T   V++KRDDL+GM+ SGNK+RKLE+ + +A+
Sbjct  1    MKPFPNKI-PLANLPTKIEKLERFSEQTGISVYIKRDDLTGMEYSGNKIRKLEYAVREAL  59

Query  369  AQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVG  548
             QGAD +IT GG+QSNHCRATA AA  L L+  L+LR++    DK+P + GN  ++ L+G
Sbjct  60   DQGADTLITCGGLQSNHCRATAAAAVKLGLNTCLVLRSA----DKEPPVDGNYFIDCLLG  115

Query  549  AHIDLVSKEEY-AKVGSVALANILKEKLLHEGRKPYVIPVG  668
            A + ++  E Y ++ G +        +    GRK Y+IP G
Sbjct  116  ADVRIIDAESYRSRRGEIMEEL--AAEYAAAGRKAYIIPEG  154



>ref|WP_041523161.1| cysteine desulfhydrase [Gilvimarinus agarilyticus]
Length=332

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 92/157 (59%), Gaps = 13/157 (8%)
 Frame = +3

Query  207  DVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADC  386
            D  SL   PTP+   +LP +  +  +W KRDDL+G  LSGNK+RKLEF++A+A AQGAD 
Sbjct  9    DRLSLAQLPTPLQPLSLPGIGEH-RLWCKRDDLTGCLLSGNKIRKLEFVIAEAQAQGADT  67

Query  387  IITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLV  566
            +IT GG+QSNHCRATA+ A  L   C L+LR  +  V       GNLL+ +L GA I   
Sbjct  68   LITCGGLQSNHCRATALLAAQLGFGCELVLRGDEPQVAD-----GNLLLSQLAGAAISYH  122

Query  567  SKEEYAKVGSVALANILKEKLLHE---GRKPYVIPVG  668
                +       L  +L+E    +   GR PYVIP G
Sbjct  123  PVRRFQH----HLPQLLQEAADRQRAAGRTPYVIPTG  155



>ref|WP_022665909.1| D-cysteine desulfhydrase [Desulfospira joergensenii]
Length=327

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 17/154 (11%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            L  FPTPIH + NL        +++KRDDL+ + L GNK RKLEFL+ +A+ QG D ++T
Sbjct  11   LAEFPTPIHYLENLSKSTGGPGIFMKRDDLTSLGLGGNKTRKLEFLIGEALKQGKDTLVT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGL--TGNLLVERLVGAHIDLVS  569
             GGIQSNHCR TA AA    LDC+L+L       + +P +   GNLL++R+ GA I   +
Sbjct  71   AGGIQSNHCRLTAAAANRAGLDCHLVL-------NGEPPIHPNGNLLLDRIYGATIHFCT  123

Query  570  K-EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +    A++  VA      E+L  +G+ PYVIPVG
Sbjct  124  RPARDARMDEVA------EELTRDGKAPYVIPVG  151



>ref|WP_011574605.1| D-cysteine desulfhydrase [Pseudoalteromonas atlantica]
 gb|ABG40305.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Pseudoalteromonas atlantica T6c]
Length=332

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 93/151 (62%), Gaps = 11/151 (7%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG FPTPIH +  L       ++++KRDDL+G+ L GNK RKLE+L+AD +AQG DCI+T
Sbjct  11   LGVFPTPIHKLARLSAHLVGPQIYIKRDDLTGLALGGNKTRKLEYLLADGLAQGCDCIVT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNHCR TA AA  L ++C+LIL     +        GNLL+++L GA I    ++
Sbjct  71   AGAAQSNHCRQTAAAAATLGVECHLILGGQAPI-----SANGNLLLDQLFGARIHWAGQK  125

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               +     + +I+   L  +G++PYV+P G
Sbjct  126  RKGE----DIPDIV-STLQKQGKRPYVVPYG  151



>ref|WP_023050567.1| hypothetical protein [Cetobacterium somerae]
 gb|ERT69060.1| hypothetical protein HMPREF0202_01027 [Cetobacterium somerae 
ATCC BAA-474]
Length=330

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 93/151 (62%), Gaps = 6/151 (4%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            ++ N PT I      +      ++ KRDD +G ++SGNKVRKLE+ + +A+ QG D +IT
Sbjct  6    NIANLPTKIEKLEKISAELGVNIFFKRDDQTGSEVSGNKVRKLEYSIKEAIDQGCDTLIT  65

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GGIQSNH R+TA AA    L   L+LRT     +++P + GN  V+RL+GA I  ++ +
Sbjct  66   CGGIQSNHARSTAAAAIKAGLSSVLVLRT-----NEEPEVDGNYFVDRLLGADIRFITSD  120

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            EY+      + +I+KE L  +GRK Y+IP G
Sbjct  121  EYSNSRQEIMESIVKE-LEKDGRKGYIIPEG  150



>ref|WP_020443970.1| D-cysteine desulfhydrase [Psychrobacter sp. G]
 gb|AGP49445.1| D-cysteine desulfhydrase [Psychrobacter sp. G]
Length=340

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (62%), Gaps = 13/152 (9%)
 Frame = +3

Query  219  LGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG FPTP I +  L       ++++KRDD +G+ L GNK RKLEF++ DA+AQGAD I+T
Sbjct  17   LGFFPTPLIELTRLSKALNGPKIYMKRDDNTGLALGGNKTRKLEFIIGDALAQGADTIVT  76

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDP-GLTGNLLVERLVGAHIDLVSK  572
             G  QSNHCR TA AA  L L+C+L      VL  ++P  L GNLL++++ G HI     
Sbjct  77   AGAAQSNHCRQTAAAAASLGLECHL------VLGGQEPEQLQGNLLLDKIFGCHIHWAGS  130

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +     + +I+ E+L  EG+KPY++P G
Sbjct  131  NRKGE----DIPDIV-EQLKKEGKKPYIVPYG  157



>ref|WP_011514148.1| D-cysteine desulfhydrase [Psychrobacter cryohalolentis]
 gb|ABE75605.1| Pyridoxal phosphate-dependent deaminase [Psychrobacter cryohalolentis 
K5]
Length=340

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (62%), Gaps = 13/152 (9%)
 Frame = +3

Query  219  LGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG FPTP I +  L       ++++KRDD +G+ L GNK RKLEF++ DA+AQGAD I+T
Sbjct  17   LGFFPTPLIELTRLSKALDGPKIYMKRDDNTGLALGGNKTRKLEFIIGDALAQGADTIVT  76

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDP-GLTGNLLVERLVGAHIDLVSK  572
             G  QSNHCR TA AA  L L+C+L      VL  ++P  L GNLL++++ G HI     
Sbjct  77   AGAAQSNHCRQTAAAAASLGLECHL------VLGGQEPEQLQGNLLLDKIFGCHIHWAGS  130

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +     + +I+ E+L  EG+KPY++P G
Sbjct  131  NRKGE----DIPDIV-EQLKKEGKKPYIVPYG  157



>ref|WP_009298784.1| D-cysteine desulfhydrase [Clostridium sp. 7_3_54FAA]
 gb|EHF03773.1| hypothetical protein HMPREF1020_04314 [Clostridium sp. 7_3_54FAA]
Length=333

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 99/161 (61%), Gaps = 8/161 (5%)
 Frame = +3

Query  189  LSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAV  368
            + P P+ +  L + PT I      +  T   V++KRDDL+GM+ SGNK+RKLE+ + +A+
Sbjct  1    MKPFPNKI-PLASLPTKIEKLERFSEQTGISVYIKRDDLTGMEYSGNKIRKLEYAVREAL  59

Query  369  AQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVG  548
             QGAD +IT GG+QSNHCRATA AA  L L+  L+LR++    DK+P + GN  ++ L+G
Sbjct  60   DQGADTLITCGGLQSNHCRATAAAAVKLGLNTCLVLRSA----DKEPPVDGNYFIDCLLG  115

Query  549  AHIDLVSKEEY-AKVGSVALANILKEKLLHEGRKPYVIPVG  668
            A + ++  E Y ++ G +        +    GRK Y+IP G
Sbjct  116  ADVRIIDAESYRSRRGEIMEEL--AAEYAAAGRKAYIIPEG  154



>ref|WP_044832725.1| cysteine desulfhydrase [Thalassomonas actiniarum]
 gb|KJE41133.1| cysteine desulfhydrase [Thalassomonas actiniarum]
Length=334

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 90/152 (59%), Gaps = 14/152 (9%)
 Frame = +3

Query  219  LGNFPTPIHIWNLPNLPT--NTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            LG FPTP+    LP L      E+W+KRDD++G+   GNK RKLE+++ DA+A+G D II
Sbjct  11   LGFFPTPL--VKLPRLSQALGCEIWMKRDDMTGLAFGGNKTRKLEYILGDALAKGCDTII  68

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T G  QSNHCR TA AA  LNL+C+LIL   +   DK     GNLL++ L G HI    +
Sbjct  69   TAGAAQSNHCRQTAAAAAQLNLECHLILGGEQ--PDK---AQGNLLLDNLFGCHIHWAGE  123

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +         L + L  EG++PY++P G
Sbjct  124  NRKGED-----IPALYQSLQAEGKRPYIVPYG  150



>ref|WP_028398585.1| cysteine desulfhydrase [Bacillus sp. FJAT-14578]
Length=326

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = +3

Query  207  DVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADC  386
            D  ++ N PT I   +  +   N  V++KRDD +GM  SGNK+RKLE+L+ DA  +  D 
Sbjct  2    DKMTIANLPTKIEKVHFFSKHLNKSVFIKRDDQTGMATSGNKIRKLEYLLKDAQNKKCDY  61

Query  387  IITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLV  566
            +IT GGIQSNH RATAV A   ++   LIL+ S++         GNLL  +LVGA I LV
Sbjct  62   LITSGGIQSNHARATAVLAAKYHMKSLLILKESEI-----NKTEGNLLFNKLVGAKIKLV  116

Query  567  SKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            S++EY  +    +   L+++L   G KPYVIP+G
Sbjct  117  SEDEYQDL--TPIIGKLEKELTDSGHKPYVIPMG  148



>ref|WP_011280868.1| D-cysteine desulfhydrase [Psychrobacter arcticus]
 gb|AAZ19452.1| putative Pyridoxal phosphate-dependent deaminase family protein 
[Psychrobacter arcticus 273-4]
Length=340

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (62%), Gaps = 13/152 (9%)
 Frame = +3

Query  219  LGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG FPTP I +  L       ++++KRDD +G+ L GNK RKLEF++ DA+AQGAD I+T
Sbjct  17   LGFFPTPLIELTRLSKALNGPKIYMKRDDNTGLALGGNKTRKLEFIIGDALAQGADTIVT  76

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG-LTGNLLVERLVGAHIDLVSK  572
             G  QSNHCR TA AA  L L+C+L      VL  ++P  L GNLL++++ G HI     
Sbjct  77   AGAAQSNHCRQTAAAAASLGLECHL------VLGGQEPDQLNGNLLLDKIFGCHIHWAGN  130

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +     + +I+ E+L + G+KPYV+P G
Sbjct  131  NRKGE----DIPDIV-EQLENAGKKPYVVPYG  157



>gb|EAW31256.1| D-cysteine desulfhydrase [marine gamma proteobacterium HTCC2143]
Length=335

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 9/154 (6%)
 Frame = +3

Query  213  FSLGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             SL   PTP I I  +  +     +W+KRDD++G  +SGNK+RKLEF +A A+ +G D I
Sbjct  9    LSLAQTPTPLIAIDRISEVVGGPRIWVKRDDMTGSAVSGNKIRKLEFSLAKALDEGCDTI  68

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GG+QSNHCR TAV    L L C+LILR       +D  + GNLL++RLVGA I   +
Sbjct  69   ITCGGVQSNHCRTTAVLCAQLGLKCHLILRGP-----EDSEIEGNLLLDRLVGAEISFYT  123

Query  570  KEEYAKVGSVALANILKEKLLHE-GRKPYVIPVG  668
              EY +     + + ++    HE G K + IPVG
Sbjct  124  NREYQQKSDEIIQHWMQH--YHEQGSKVFSIPVG  155



>ref|WP_013753524.1| D-cysteine desulfhydrase [Glaciecola sp. 4H-3-7+YE-5]
 gb|AEE22717.1| pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase 
family protein [Glaciecola sp. 4H-3-7+YE-5]
Length=333

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 93/153 (61%), Gaps = 15/153 (10%)
 Frame = +3

Query  219  LGNFPTPIHIWNLPNLPTNT---EVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
            LG FPTPI    LP L  +    ++++KRDDL+G+ L GNK RKLE+L+ADA+A+ +DCI
Sbjct  11   LGVFPTPIQ--KLPRLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADALAKDSDCI  68

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT G  QSNHCR TA AA  L L+C+L+L      V       GNLL+++L  AHI    
Sbjct  69   ITAGAAQSNHCRQTAAAAAMLGLECHLVLGGQAPNV-----ANGNLLLDQLFAAHIHWSG  123

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +   +     + NI+   L  +GR PYV+P G
Sbjct  124  DKRKGE----DIPNIVA-ALREQGRNPYVVPYG  151



>ref|WP_040823088.1| cysteine desulfhydrase [marine gamma proteobacterium HTCC2143]
Length=336

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 9/154 (6%)
 Frame = +3

Query  213  FSLGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             SL   PTP I I  +  +     +W+KRDD++G  +SGNK+RKLEF +A A+ +G D I
Sbjct  10   LSLAQTPTPLIAIDRISEVVGGPRIWVKRDDMTGSAVSGNKIRKLEFSLAKALDEGCDTI  69

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GG+QSNHCR TAV    L L C+LILR       +D  + GNLL++RLVGA I   +
Sbjct  70   ITCGGVQSNHCRTTAVLCAQLGLKCHLILRGP-----EDSEIEGNLLLDRLVGAEISFYT  124

Query  570  KEEYAKVGSVALANILKEKLLHE-GRKPYVIPVG  668
              EY +     + + ++    HE G K + IPVG
Sbjct  125  NREYQQKSDEIIQHWMQH--YHEQGSKVFSIPVG  156



>ref|WP_021642770.1| putative D-cysteine desulfhydrase [[Clostridium] symbiosum]
 gb|ERI77381.1| putative D-cysteine desulfhydrase [ [[Clostridium] symbiosum 
ATCC 14940]
Length=333

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 98/161 (61%), Gaps = 8/161 (5%)
 Frame = +3

Query  189  LSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAV  368
            + P P+ +  L N PT I      +  T   +++KRDDL+GM+ SGNK+RKLE+ + +A+
Sbjct  1    MKPFPNKI-PLANLPTKIEKLERFSEQTGISIYIKRDDLTGMEYSGNKIRKLEYAVREAL  59

Query  369  AQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVG  548
             QGAD +IT GG+QSNHCRATA AA  L L+  L+LR++    DK+P + GN  ++ L+G
Sbjct  60   DQGADTLITCGGLQSNHCRATAAAAVKLGLNTCLVLRSA----DKEPPVDGNYFIDCLLG  115

Query  549  AHIDLVSKEEY-AKVGSVALANILKEKLLHEGRKPYVIPVG  668
            A + ++  E Y ++ G +      +       RK Y+IP G
Sbjct  116  ADVRIIDAESYRSRRGEIMEELAAEYAAAS--RKAYIIPEG  154



>ref|WP_041324464.1| cysteine desulfhydrase [Saccharophagus degradans]
Length=334

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 6/152 (4%)
 Frame = +3

Query  216  SLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SL N PT +  +  +  +     +WLKRDDL+G  LSGNKVRKLE+++A+A++ GAD +I
Sbjct  10   SLANLPTALQPLDRVSQILGGPRIWLKRDDLTGSTLSGNKVRKLEYVVAEALSNGADTLI  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T GG+QSNHCRATA+ A  L L  +LILR  +    K     GNLL++ L GA I   S 
Sbjct  70   TCGGLQSNHCRATALVAAQLGLKAHLILRGQQ----KGSAADGNLLLDDLAGAQISQYSV  125

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +Y+K    +L +  +     +GRK + IP G
Sbjct  126  ADYSK-NLTSLFSHWQNHYAQQGRKAWCIPTG  156



>ref|WP_039992873.1| cysteine desulfhydrase [Glaciecola chathamensis]
Length=333

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 93/155 (60%), Gaps = 15/155 (10%)
 Frame = +3

Query  213  FSLGNFPTPIHIWNLPNLPTNT---EVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGAD  383
              LG FPTPI    LP L  +    ++++KRDDL+G+ L GNK RKLE+L+ADA+A+ +D
Sbjct  9    IQLGVFPTPIQ--KLPRLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADALAKDSD  66

Query  384  CIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDL  563
            CIIT G  QSNHCR TA AA  L L+C+L+L      V       GNLL+++L  AHI  
Sbjct  67   CIITAGAAQSNHCRQTAAAAAMLGLECHLVLGGQAPNV-----ANGNLLLDQLFAAHIHW  121

Query  564  VSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               +   +     + NI+   L  +GR PYV+P G
Sbjct  122  SGDKRKGE----DIPNIVA-ALREQGRNPYVVPYG  151



>gb|ABD80923.1| Pyridoxal phosphate-dependent deaminase [Saccharophagus degradans 
2-40]
Length=336

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 6/152 (4%)
 Frame = +3

Query  216  SLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SL N PT +  +  +  +     +WLKRDDL+G  LSGNKVRKLE+++A+A++ GAD +I
Sbjct  12   SLANLPTALQPLDRVSQILGGPRIWLKRDDLTGSTLSGNKVRKLEYVVAEALSNGADTLI  71

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T GG+QSNHCRATA+ A  L L  +LILR  +    K     GNLL++ L GA I   S 
Sbjct  72   TCGGLQSNHCRATALVAAQLGLKAHLILRGQQ----KGSAADGNLLLDDLAGAQISQYSV  127

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +Y+K    +L +  +     +GRK + IP G
Sbjct  128  ADYSK-NLTSLFSHWQNHYAQQGRKAWCIPTG  158



>dbj|GAC12138.1| D-cysteine desulfhydrase [Glaciecola chathamensis S18K6]
Length=349

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 93/153 (61%), Gaps = 15/153 (10%)
 Frame = +3

Query  219  LGNFPTPIHIWNLPNLPTNT---EVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
            LG FPTPI    LP L  +    ++++KRDDL+G+ L GNK RKLE+L+ADA+A+ +DCI
Sbjct  27   LGVFPTPIQ--KLPRLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADALAKDSDCI  84

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT G  QSNHCR TA AA  L L+C+L+L      V       GNLL+++L  AHI    
Sbjct  85   ITAGAAQSNHCRQTAAAAAMLGLECHLVLGGQAPNV-----ANGNLLLDQLFAAHIHWSG  139

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +   +     + NI+   L  +GR PYV+P G
Sbjct  140  DKRKGE----DIPNIVA-ALREQGRNPYVVPYG  167



>ref|WP_014733258.1| 1-aminocyclopropane-1-carboxylate deaminase [Pyrococcus sp. ST04]
 ref|YP_006353807.1| 1-aminocyclopropane-1-carboxylate deaminase [Pyrococcus sp. ST04]
 gb|AFK21732.1| 1-aminocyclopropane-1-carboxylate deaminase [Pyrococcus sp. ST04]
Length=332

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  171  PTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEF  350
            P  AS L+  P     L  + TPI      +     EV++KRDDL+G+ + GNKVRKLE+
Sbjct  3    PKIASLLAKFPR--VELIPWETPIQYLPKVSEMLGVEVYIKRDDLTGLGIGGNKVRKLEY  60

Query  351  LMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLL  530
            L+ DA+A+GAD +IT+G + SNH   TA+AAK L LD  L+LR  +V       L GN L
Sbjct  61   LLGDALAKGADVVITMGAVHSNHAFVTALAAKKLGLDAVLVLRGKEV-------LRGNYL  113

Query  531  VERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +++L+G    +   E   ++  +  A  + E+L  +G++PY+IPVG
Sbjct  114  LDKLMGVETRIYEAENSFEL--MKYAEEVAEELREQGKRPYIIPVG  157



>ref|WP_038029883.1| cysteine desulfhydrase [Thermonema rossianum]
Length=319

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 92/158 (58%), Gaps = 14/158 (9%)
 Frame = +3

Query  201  PSDVFSLGNFPTPIHIWN--LPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQ  374
            P    +LG FPTP+H     + NLP   E+W+KRDD +G+   GNK RKLE+L+A+A+AQ
Sbjct  3    PLQKVNLGFFPTPLHPLKRIVKNLPY--ELWIKRDDQTGLATGGNKCRKLEYLLAEALAQ  60

Query  375  GADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAH  554
            GAD ++T G  QSNHCR TA A   L L+C+L+L      V+     TGNL + RL+GAH
Sbjct  61   GADTVLTAGAQQSNHCRQTAAACAALGLECHLMLGGVPPAVE-----TGNLKLSRLLGAH  115

Query  555  IDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            I    +    +         L  +L   G++ YVIP G
Sbjct  116  IHFTGQNRKGEA-----LPALYRRLQDAGKRCYVIPYG  148



>ref|WP_043332804.1| cytochrome C biogenesis protein CcmE [Cobetia marina]
 gb|KGA02748.1| cytochrome C biogenesis protein CcmE [Cobetia marina]
Length=337

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 90/151 (60%), Gaps = 5/151 (3%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG+  TP+  + NL  L     +W+KRDD +G+   GNK RKLEFLMADA+ QGAD IIT
Sbjct  11   LGHLSTPLEPMDNLSKLLGGPRLWIKRDDCTGLSTGGNKTRKLEFLMADALEQGADTIIT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNH R TA AA  L L+C+++L       D+     GN+ +++L GA    V+K 
Sbjct  71   QGATQSNHARQTAAAACKLGLECHILLEDRTGSDDRSYNYNGNVFLDQLHGA---TVAKR  127

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            E       A    L +KL+ +G+KPY+IP G
Sbjct  128  E-GGADMAAEMEALADKLIGKGKKPYIIPGG  157



>ref|WP_039207249.1| cytochrome C biogenesis protein CcmE [Brevibacterium linens]
 gb|KHS53711.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Brevibacterium linens]
Length=340

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 95/169 (56%), Gaps = 12/169 (7%)
 Frame = +3

Query  186  SLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADA  365
            +L+ VP   ++ G  P   H+  L       ++W+KRDD  G+   GNK RKLE+L+ADA
Sbjct  3    ALNEVPRRSYTDGATPLE-HLQRLSAELGGPQIWIKRDDQLGLTQGGNKTRKLEYLIADA  61

Query  366  VAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTS--------KVLVDKDPGLTG  521
            + QGAD +IT+GG+QSNHCR T  AA+   LDC+LI+                  P  TG
Sbjct  62   LNQGADALITVGGVQSNHCRLTLSAARVEGLDCHLIVEEDLGPEGTALGPAGSNPPEYTG  121

Query  522  NLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            N L+  L+GA+   V       +G    A IL +KL  EGRKPYVIPVG
Sbjct  122  NFLLFDLLGANSVTVLGHGADLLGE---AEILADKLRAEGRKPYVIPVG  167



>ref|WP_034836925.1| cytochrome C biogenesis protein CcmE [Inquilinus limosus]
 gb|KGM33907.1| cytochrome C biogenesis protein CcmE [Inquilinus limosus MP06]
Length=336

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 5/153 (3%)
 Frame = +3

Query  213  FSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             SL + PTP+  +  L  L     +W+KRDD +G+   GNK RKLEFL ADA+ +GAD I
Sbjct  9    ISLAHLPTPLEPMKRLSELLGGPRLWIKRDDCTGLSSGGNKTRKLEFLGADAITRGADTI  68

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT G  QSNH R TA  A  L ++C+L+L       D    L GN+L++RL GA    VS
Sbjct  69   ITQGATQSNHARQTAAMAAKLGMECHLLLEDRTGSDDPSYNLNGNVLLDRLYGA---TVS  125

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            K       ++ +   L E+L  +GRKPYVIP G
Sbjct  126  KRPGGADMTMEMEK-LAERLRQDGRKPYVIPGG  157



>dbj|GAF60526.1| 1-aminocyclopropane-1-carboxylate deaminase [Psychrobacter sp. 
JCM 18903]
Length=303

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 16/132 (12%)
 Frame = +3

Query  282  VWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLD  461
            +++KRDD +G+ L GNK RKLEF+M DA+AQGADC+IT G  QSNHCR TA AA  L L+
Sbjct  10   IFMKRDDNTGLALGGNKTRKLEFIMGDALAQGADCLITAGAAQSNHCRQTAAAAASLGLE  69

Query  462  CYLILRTSKVLVDKDPGLT-GNLLVERLVGAHIDLVSKEEYAKVGSVALANILK--EKLL  632
            C+L      VL  ++P  T GNLL++++ G+HI         +       +I K  E+L 
Sbjct  70   CHL------VLGGEEPEQTSGNLLLDKIFGSHIHWAGANRKGE-------DIPKIVEQLT  116

Query  633  HEGRKPYVIPVG  668
             +G+KPYVIP G
Sbjct  117  KQGKKPYVIPYG  128



>ref|WP_007232100.1| D-cysteine desulfhydrase [gamma proteobacterium HTCC2207]
 gb|EAS47451.1| D-cysteine desulfhydrase [gamma proteobacterium HTCC2207]
Length=330

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 90/153 (59%), Gaps = 8/153 (5%)
 Frame = +3

Query  213  FSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             +L   PTP + +  L        +W+KRDDL+G   SGNKVRKLEFL+A+A+A+G D +
Sbjct  8    LNLAQTPTPFYPLERLSKQLGGPRIWIKRDDLTGAATSGNKVRKLEFLLAEALAKGCDTL  67

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GG+QSNHCR+ A+    L L  +L+LR      D +P   GNLL+++L GA I   S
Sbjct  68   ITSGGVQSNHCRSVALLGAQLGLKVHLLLR-----ADIEPKPVGNLLLDQLAGATISHYS  122

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +EY   G   L N  +E     GRK Y IP G
Sbjct  123  LDEYR--GLNKLFNQWQEHYAALGRKAYAIPTG  153



>ref|WP_035518186.1| cytochrome C biogenesis protein CcmE [Pseudohaliea rubra]
 gb|KGE04228.1| 1-aminocyclopropane-1-carboxylate deaminase [Haliea rubra DSM 
19751]
Length=334

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 92/163 (56%), Gaps = 11/163 (7%)
 Frame = +3

Query  189  LSPVPSDVFSLGNFPTPIHIWNLPNLPT---NTEVWLKRDDLSGMQLSGNKVRKLEFLMA  359
            LS  P   ++  + PTP+    LP L        +W+KRDD +G+   GNK RKLEFL+ 
Sbjct  3    LSRFPRRPYA--HLPTPLE--PLPRLSAALGGPALWIKRDDCTGLAGGGNKTRKLEFLLG  58

Query  360  DAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVER  539
            DA+AQGADC+IT G  QSNH R  A A     L C+L+L       D +    GN+L++R
Sbjct  59   DALAQGADCVITQGATQSNHVRQAAAACAREGLPCHLLLEDRTGFTDAEYRENGNVLMDR  118

Query  540  LVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            L+GA ++    E  A     A   ++ E+L  EGR+PYVIP G
Sbjct  119  LLGATLE----ERPAGTDMDAAMAVVAERLASEGRRPYVIPGG  157



>ref|WP_045993656.1| cytochrome C biogenesis protein CcmE [Halomonas sp. S2151]
 gb|KJZ10003.1| cytochrome C biogenesis protein CcmE [Halomonas sp. S2151]
Length=337

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 88/151 (58%), Gaps = 5/151 (3%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG+ PTP+  + NL  L     +W+KRDD +G+   GNK RKLEFLMADA+ QGAD IIT
Sbjct  11   LGHMPTPLEPMDNLSKLLGGPRLWIKRDDCTGLSTGGNKTRKLEFLMADALEQGADTIIT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNH R T  AA  L L+C+++L       D +    GN+ +++L GA ++    +
Sbjct  71   QGATQSNHARQTVAAACKLGLECHILLEDRTGSEDSNYNYNGNVFLDQLHGASVE----K  126

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                    A    L ++L  EG+KPY+IP G
Sbjct  127  RPGGADMAAEMEGLADRLKSEGKKPYIIPGG  157



>gb|EIF44157.1| D-cysteine desulfhydrase [gamma proteobacterium BDW918]
Length=347

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 97/168 (58%), Gaps = 10/168 (6%)
 Frame = +3

Query  168  PPTWASSLSPVPSDVFSLGNFPTPIHIWN-LPNLPTNTEVWLKRDDLSGMQLSGNKVRKL  344
            PP + S+ +P P     L   PTP+ + + L    +   +W+KRDDLSG  LSGNK+RKL
Sbjct  11   PPDFVSANNP-PR--LHLAQLPTPMQLLSRLSERYSGPRIWVKRDDLSGSVLSGNKIRKL  67

Query  345  EFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGN  524
            EF +A A+A+G D +IT GGIQSNHCRATA+    L L C+L+LR  +          GN
Sbjct  68   EFNLAQALAEGCDTVITCGGIQSNHCRATALLCAQLGLKCHLLLRGHRA-----DSADGN  122

Query  525  LLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LL+++L GA I      ++ +     L +  ++     GRK ++IP G
Sbjct  123  LLLDQLAGAEISYYPPAQFQRELDSLLLDC-QQAYASSGRKAFIIPTG  169



>ref|WP_040802912.1| cysteine desulfhydrase [gamma proteobacterium BDW918]
Length=339

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 97/168 (58%), Gaps = 10/168 (6%)
 Frame = +3

Query  168  PPTWASSLSPVPSDVFSLGNFPTPIHIWN-LPNLPTNTEVWLKRDDLSGMQLSGNKVRKL  344
            PP + S+ +P P     L   PTP+ + + L    +   +W+KRDDLSG  LSGNK+RKL
Sbjct  3    PPDFVSANNP-PR--LHLAQLPTPMQLLSRLSERYSGPRIWVKRDDLSGSVLSGNKIRKL  59

Query  345  EFLMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGN  524
            EF +A A+A+G D +IT GGIQSNHCRATA+    L L C+L+LR  +          GN
Sbjct  60   EFNLAQALAEGCDTVITCGGIQSNHCRATALLCAQLGLKCHLLLRGHRA-----DSADGN  114

Query  525  LLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            LL+++L GA I      ++ +     L +  ++     GRK ++IP G
Sbjct  115  LLLDQLAGAEISYYPPAQFQRELDSLLLDC-QQAYASSGRKAFIIPTG  161



>ref|WP_005978024.1| D-cysteine desulfhydrase [Fusobacterium ulcerans]
 gb|EFS26431.1| D-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Fusobacterium ulcerans ATCC 49185]
Length=326

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 92/154 (60%), Gaps = 12/154 (8%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            +L NFPT I      +  +   ++LKRDD +G ++SGNK+RKLE+ + +A+  G D +IT
Sbjct  6    NLANFPTKIEKLEKISKDSGVNIYLKRDDQTGSEISGNKIRKLEYSIYEAIENGCDTLIT  65

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GGIQSNH RATA A   L +   L+LR+     D+ P L GN  +++++GA + ++S +
Sbjct  66   CGGIQSNHARATAAAGIKLGMRAILVLRS-----DETPELEGNYFLDKVIGADVRIISSD  120

Query  576  EYAKVGSVALANILKEKLLH---EGRKPYVIPVG  668
            +Y +      A I+KE       EG K Y+IP G
Sbjct  121  DYRE----RRAEIMKEIKAESNAEGHKAYIIPEG  150



>ref|WP_008697125.1| D-cysteine desulfhydrase [Fusobacterium ulcerans]
 gb|EHO81487.1| D-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Fusobacterium ulcerans 12-1B]
Length=326

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 92/154 (60%), Gaps = 12/154 (8%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            +L NFPT I      +  +   ++LKRDD +G ++SGNK+RKLE+ + +A+  G D +IT
Sbjct  6    NLANFPTKIEKLEKISKDSGVNIYLKRDDQTGSEISGNKIRKLEYSIYEAIENGCDTLIT  65

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GGIQSNH RATA A   L +   L+LR+     D+ P L GN  +++++GA + ++S +
Sbjct  66   CGGIQSNHARATAAAGIKLGMRAILVLRS-----DETPELEGNYFLDKVIGADVRIISSD  120

Query  576  EYAKVGSVALANILKEKLLH---EGRKPYVIPVG  668
            +Y +      A I+KE       EG K Y+IP G
Sbjct  121  DYRE----RRAEIMKEIKAESDAEGHKAYIIPEG  150



>ref|WP_011989078.1| D-cysteine desulfhydrase [Clostridium kluyveri]
 gb|EDK32563.1| Predicted pyridoxal-phosphate dependent deaminase [Clostridium 
kluyveri DSM 555]
 dbj|BAH05497.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
Length=329

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 92/153 (60%), Gaps = 19/153 (12%)
 Frame = +3

Query  249  WNLPNLPTNTE-------------VWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             N+ NLPT  E             +++KRDD +G ++SGNK+RKLEF  A+A+ +G + +
Sbjct  8    MNMANLPTKIEKMERLSQKLGGPDIYIKRDDQTGTEISGNKIRKLEFSAAEALNKGCNTL  67

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GGIQSNHCRATA  A  L   C L+L  S      D  + GNLL+++L+GA I  VS
Sbjct  68   ITCGGIQSNHCRATAAVAVKLGFKCCLVLNGS-----NDTEVDGNLLLDKLLGAEIYFVS  122

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            ++EY     + +   +K  + ++G KPY+IP G
Sbjct  123  QKEYENR-RMEIMKEIKTNMENKGLKPYIIPEG  154



>ref|WP_018706755.1| hypothetical protein [Bacillus fordii]
Length=339

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 93/167 (56%), Gaps = 19/167 (11%)
 Frame = +3

Query  189  LSPVPSDVFSLGNFPTPIHIWN-LPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADA  365
            LS +P   ++     TPI   N L +L     +++KRDDL G+   GNK RKLEFLMADA
Sbjct  3    LSKIPRRSYT--QVQTPIEKLNRLTHLLNGPNIFIKRDDLLGLTGGGNKTRKLEFLMADA  60

Query  366  VAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLV  545
            +A+GAD I+T G +QSNHCR T  AA    L C L+L    V    DP   GN L+ +L+
Sbjct  61   IAKGADTIVTCGALQSNHCRLTLAAAVKEGLKCQLVLEEG-VSTTYDPNANGNNLLYKLL  119

Query  546  GAHIDLVSK------EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            GA   +V K      +E   VG         EKL+  GR PY+IPVG
Sbjct  120  GAEEIIVVKNGSDLNDEMQAVG---------EKLIASGRNPYIIPVG  157



>ref|WP_034834091.1| hypothetical protein [Inquilinus limosus]
 gb|KGM34804.1| hypothetical protein P409_08120 [Inquilinus limosus MP06]
Length=337

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 97/159 (61%), Gaps = 17/159 (11%)
 Frame = +3

Query  213  FSLGNFPTPIHIWNLPNLPT---NTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGAD  383
              L + PTP+    LP L       ++W+KRDD +G+ L GNKVRKLEFL+ DA+AQGAD
Sbjct  10   LRLQHAPTPLE--PLPRLTEALGGPQLWIKRDDCTGLALGGNKVRKLEFLLGDALAQGAD  67

Query  384  CIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGL--TGNLLVERLVGAHI  557
             IIT GG QSNH R TA AA  L LDC L+L  +  +  +DP    +GNL+++ L GA I
Sbjct  68   TIITAGGPQSNHARQTAAAAARLGLDCVLVL--TDAVAGRDPSYHTSGNLMLDELFGARI  125

Query  558  DL--VSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +L   + +  A++  VA      E+   EG  PYV+PVG
Sbjct  126  ELHPGTADADAEMARVA------EECRAEGGTPYVVPVG  158



>ref|WP_023398581.1| pyridoxal phosphate-dependent, D-cysteine desulfhydrase family 
protein [Pseudoalteromonas luteoviolacea]
 gb|ESP93977.1| pyridoxal phosphate-dependent, D-cysteine desulfhydrase family 
protein [Pseudoalteromonas luteoviolacea 2ta16]
Length=330

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 90/155 (58%), Gaps = 19/155 (12%)
 Frame = +3

Query  219  LGNFPTPI-HIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG  PTP+  + NL       E+ +KRDDL+G+ L GNK RKLE+++ DA+A+G D ++T
Sbjct  15   LGFSPTPVVKLTNLSRHLGGPEILMKRDDLTGLALGGNKTRKLEYILGDALAKGCDTVVT  74

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHI----DL  563
             G  QSNHCR TA AA  LN+ C+L+L       DK    TGNLL++ L GA +    D 
Sbjct  75   AGAQQSNHCRQTAAAAAKLNMSCHLLLGG-----DKPDEATGNLLLDTLFGAQLHYCKDN  129

Query  564  VSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               E+  +         L E L  +GRKPYVIP G
Sbjct  130  RKGEDIPR---------LIEDLKSQGRKPYVIPYG  155



>ref|WP_013902062.1| cytochrome C biogenesis protein CcmE [Ramlibacter tataouinensis]
 gb|AEG93831.1| Candidate D-cysteine desulfhydrase [Ramlibacter tataouinensis 
TTB310]
Length=338

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 87/151 (58%), Gaps = 5/151 (3%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG+ PTP+  + NL        +W+KRDD +G+   GNK RKLEFLMADA+AQGAD +IT
Sbjct  11   LGHMPTPLEPMKNLSAALGGPNLWIKRDDCTGLATGGNKTRKLEFLMADALAQGADTVIT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNH R T  AA  L +  ++IL       D +   +GN+ +++L+GA +  V   
Sbjct  71   QGATQSNHARQTVAAAVRLGMQSHIILEDRTGYTDPEYKQSGNVFLDQLMGASVSEVPGG  130

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                     LA+ L+ +    GRKPY+IP G
Sbjct  131  SDMDAAMRRLADELRSR----GRKPYIIPGG  157



>gb|EDM30233.1| D-cysteine desulfhydrase [Roseovarius sp. TM1035]
Length=366

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 93/164 (57%), Gaps = 7/164 (4%)
 Frame = +3

Query  180  ASSLSPVPSDVFSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLM  356
            AS+L+  P     LG+FPTP+  +  L         W+KRDD +G+   GNK RKLEFLM
Sbjct  28   ASALAAFPR--VRLGHFPTPLEPMDRLTEHLGGPRFWVKRDDCTGLSSGGNKTRKLEFLM  85

Query  357  ADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVE  536
            ADA+ +GAD IIT G  QSNH R TA AA  L + C+++L       D +  L+GN+ ++
Sbjct  86   ADALGEGADTIITQGATQSNHARQTAAAAARLGMACHILLEDRTGSADPEYTLSGNVFLD  145

Query  537  RLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            RL GA +     +        A   +L  +L  +GRKPYVIP G
Sbjct  146  RLHGATV----AKRRGGADMTAEMELLAVELRADGRKPYVIPGG  185



>ref|WP_012097186.1| D-cysteine desulfhydrase [Anaeromyxobacter sp. Fw109-5]
 gb|ABS26599.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Anaeromyxobacter sp. Fw109-5]
Length=337

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 89/151 (59%), Gaps = 4/151 (3%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            +L   PTP+            E+  KRDDL+G++LSGNK RKLE+L+A+A    AD ++T
Sbjct  13   ALACLPTPLERSPRLGRELGLELLYKRDDLTGLELSGNKARKLEYLLAEAEETQADTLVT  72

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GG+QSNHCRATA AA    L   ++LR +     + P L  N L++RL GA I  VS +
Sbjct  73   CGGVQSNHCRATAFAAAKRGLSAVVLLRVTD--PSRPPPLEANALLDRLAGAQIRWVSHD  130

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            EY + G   L     ++L   GR+PYVIP G
Sbjct  131  EYRRRGE--LMRSAADELRAAGRRPYVIPEG  159



>ref|WP_034600917.1| cysteine desulfhydrase [Clostridiisalibacter paucivorans]
Length=331

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 7/153 (5%)
 Frame = +3

Query  216  SLGNFPTPIHIWNL--PNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
            SL N PT I         L     +++KRDD +G ++SGNK+RKLEF + +A+ + +D +
Sbjct  8    SLANLPTKIEKLERLSEKLVGGPNIFIKRDDQTGTEISGNKIRKLEFSIREALDENSDVL  67

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GGIQSNH RATA  A  L L   L+LRT K   D D    GN  +++L+GA I  +S
Sbjct  68   ITCGGIQSNHARATAAIATKLGLKSVLVLRTDKEKEDID----GNYFLDKLLGADIRFIS  123

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             E+Y+K     + N +K+ L  EG + Y+IP G
Sbjct  124  SEDYSKR-RTEIMNDIKDNLKKEGLRGYIIPEG  155



>ref|WP_006247534.1| MULTISPECIES: D-cysteine desulfhydrase [Mycobacterium]
 gb|AEV73471.1| 1-aminocyclopropane-1-carboxylate deaminase [Mycobacterium rhodesiae 
NBB3]
Length=324

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 88/150 (59%), Gaps = 8/150 (5%)
 Frame = +3

Query  219  LGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITL  398
            L   PTP+H     +     EVWLKRDDL+G+ L GNKVR LE+L+ DA+AQG DC++T 
Sbjct  12   LATLPTPLHPAPRLSEAIGVEVWLKRDDLTGLGLGGNKVRGLEYLIGDALAQGCDCLVTG  71

Query  399  GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEE  578
             G QSN    +A+AA+   LD +L+   S V     P  TGNLL++ L+GA +    + +
Sbjct  72   AGPQSNWAMLSALAARRCGLDPHLVFYGSPV----SP--TGNLLLDELIGAEVHYTGEPD  125

Query  579  YAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               V   A    L EKL   GR+PY++P G
Sbjct  126  RTSVD--AGIEALAEKLRAAGRRPYILPRG  153



>ref|WP_025777723.1| cytochrome C biogenesis protein CcmE [Brevibacterium sp. VCM10]
Length=340

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 98/177 (55%), Gaps = 28/177 (16%)
 Frame = +3

Query  186  SLSPVPSDVFSLGNFPTPI-HIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMAD  362
            +L+ +P   ++ G  PTP+ H+  L       E+W+KRDD  G+   GNK RKLE+L+AD
Sbjct  3    ALNEIPRRRYTAG--PTPLEHLRRLSAELGGPEIWIKRDDRLGLTQGGNKTRKLEYLIAD  60

Query  363  AVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKD------------  506
            A+ QGAD +IT+GG+QSNHCR T  AA+   LDC+LI       V++D            
Sbjct  61   ALNQGADTLITVGGVQSNHCRLTLSAARAEGLDCHLI-------VEEDLGPDGTALGPAG  113

Query  507  ---PGLTGNLLVERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               P  TGN L+  L+GA    V       +G    A IL EKL  EG  PY+IPVG
Sbjct  114  ANPPEHTGNFLLLDLLGADSVTVLGHGADLLGE---AEILAEKLRGEGGIPYIIPVG  167



>ref|WP_014805412.1| D-cysteine desulfhydrase [Mycobacterium chubuense]
 gb|AFM20121.1| 1-aminocyclopropane-1-carboxylate deaminase [Mycobacterium chubuense 
NBB4]
Length=324

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 88/150 (59%), Gaps = 8/150 (5%)
 Frame = +3

Query  219  LGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIITL  398
            L   PTP+H     +     EVWLKRDDL+G+ L GNKVR LE+L+ DA+AQG DC++T 
Sbjct  12   LATLPTPLHPAPRLSEAIGVEVWLKRDDLTGLGLGGNKVRGLEYLIGDALAQGCDCLVTG  71

Query  399  GGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKEE  578
             G QSN    +A+AA+   LD +L+   S V     P  TGNLL++ L+GA +    + +
Sbjct  72   AGPQSNWAMLSALAARRCGLDPHLVFYGSPV----SP--TGNLLLDELIGAEVHYTGEPD  125

Query  579  YAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               V   A    L EKL   GR+PY++P G
Sbjct  126  RTSVD--AGIEALAEKLRAAGRRPYILPRG  153



>ref|WP_020593864.1| hypothetical protein [Kiloniella laminariae]
Length=334

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = +3

Query  216  SLGNFPTPIHIWN-LPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SL   PTP+   + L +      +W+KRDD +G+   GNK RKLEFL+ADA+ +GAD II
Sbjct  10   SLAFLPTPLQALDRLSDYLGGPRIWIKRDDCTGLAGGGNKTRKLEFLIADALEKGADSII  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T GG+QSNH R TA AA    LDCYLIL  +    D     +GN  ++ L+GA + +   
Sbjct  70   TTGGLQSNHVRQTAAAAARYGLDCYLILVRNVEWSDPAYQTSGNRTLDHLLGAKVSVYP-  128

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               A      +   L E L  EG+ PY+IPVG
Sbjct  129  ---AGTDRDQIMVDLAENLKTEGKTPYIIPVG  157



>ref|WP_035488452.1| cysteine desulfhydrase [Gammaproteobacteria bacterium MOLA455]
 gb|ETN92326.1| L-cysteate sulfo-lyase [Gammaproteobacteria bacterium MOLA455]
Length=330

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 87/153 (57%), Gaps = 8/153 (5%)
 Frame = +3

Query  213  FSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             +L   PTP + +  L        +W+KRDDL+G   SGNKVRKLEFL+A+A+A G D +
Sbjct  8    LNLAQTPTPFYPLERLSEQLGGPRIWIKRDDLTGAATSGNKVRKLEFLLAEALANGCDTL  67

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GG+QSNHCR+ A+    L L  +L+LR      D +P   GNLL++ L GA I   S
Sbjct  68   ITSGGVQSNHCRSVALLGAQLGLKVHLLLR-----ADIEPKPIGNLLLDHLAGARISHYS  122

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +EY  +    L     E     GRK Y+IP G
Sbjct  123  VDEYRSLDK--LFAQWAEHYAEMGRKAYLIPTG  153



>ref|WP_010475890.1| D-cysteine desulfhydrase [Acaryochloris sp. CCMEE 5410]
Length=335

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 87/152 (57%), Gaps = 11/152 (7%)
 Frame = +3

Query  216  SLGNFPTPI-HIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTPI  +  L  +     + +KRDD +G+ L GNK RKLEFL+A+A+ Q  DC+I
Sbjct  10   SLGFFPTPIVELPRLSQVLDGPRILMKRDDQTGLALGGNKTRKLEFLIAEALHQHCDCVI  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T G  QSNHCR TA AA  + LDC+L+L  +           GNLL++ L+GA I     
Sbjct  70   TAGASQSNHCRQTAAAAAMVGLDCHLVLGGT-----PSEQAYGNLLLDELLGAQIHWTGT  124

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +   +  S      +  +L  +GR PYVIP G
Sbjct  125  DRKGEQLSA-----IASQLQAQGRHPYVIPYG  151



>ref|WP_040971292.1| cytochrome C biogenesis protein CcmE [Mesorhizobium sp. ORS3324]
 emb|CDX16702.1| D-cysteine desulfhydrase, PLP-dependent [Mesorhizobium sp. ORS3324]
Length=334

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 92/154 (60%), Gaps = 9/154 (6%)
 Frame = +3

Query  216  SLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            +LG+ PTP+  + NL       E+W+KRDD +G+   GNK RKLEFLMA+A+A+GAD II
Sbjct  10   ALGHLPTPLEKLENLTRELNGPEIWIKRDDCTGLSTGGNKTRKLEFLMAEALAEGADTII  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDL--V  566
            T G  QSNH R TA AA  L++ C+L+L       D D    GN+L++RL GA I+    
Sbjct  70   TQGATQSNHARQTAAAAAKLSMACHLMLEDRTGKTDFDYNENGNVLLDRLHGATIERRPA  129

Query  567  SKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            S +   ++   A      E+L  EGRK Y IP G
Sbjct  130  SPDMNGEMEKAA------ERLRAEGRKVYAIPGG  157



>ref|WP_022957125.1| D-cysteine desulfhydrase [Spongiibacter tropicus]
Length=337

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 90/155 (58%), Gaps = 14/155 (9%)
 Frame = +3

Query  219  LGNFPTPIHIWNL--PNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            L   PTP+   +      P    +W+KRDDL+G  LSGNK+RKLEF +A A+ +G D +I
Sbjct  14   LAQLPTPLQPLDRLQQRYPDGPRIWVKRDDLTGCALSGNKIRKLEFSLAQALEEGCDTVI  73

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T GG+QSNHCRATA+    L L C+L+LR      +  P   GNLL+++L GA I +   
Sbjct  74   TCGGLQSNHCRATALLCAQLGLKCHLLLRG-----EHRPPADGNLLLDQLAGAEISVYPA  128

Query  573  EEYAKVGSVALANILKEKLLH---EGRKPYVIPVG  668
             ++ +     L  + +  + H   +GR+ +VIP G
Sbjct  129  PQFTR----ELTTLFEHWVQHYAAQGRRAFVIPTG  159



>ref|WP_007640691.1| D-cysteine desulfhydrase [Glaciecola psychrophila]
 dbj|GAC39014.1| D-cysteine desulfhydrase [Glaciecola psychrophila 170]
 gb|AGH42982.1| D-cysteine desulfhydrase [Glaciecola psychrophila 170]
Length=333

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 90/152 (59%), Gaps = 11/152 (7%)
 Frame = +3

Query  216  SLGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTP + +  L +     ++++KRDDL+G+ L GNK RKLE+++ADA+ QG D +I
Sbjct  10   SLGFFPTPLVELSRLSDFLGGPKIFMKRDDLTGLALGGNKTRKLEYILADALKQGCDTVI  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T G  QSNHCR TA AA  LNL+C+L+L       +  P   GNLL++ +  + I     
Sbjct  70   TAGAAQSNHCRQTAAAAAKLNLECHLLLGG-----EAPPEAQGNLLLDHIFDSKIHWTGS  124

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +     +A I  E L   G+KPY++P G
Sbjct  125  NRKGE----DIARIFAE-LKAAGKKPYLVPYG  151



>ref|WP_045670987.1| cysteine desulfhydrase [Paenibacillus beijingensis]
 gb|AJY75558.1| cysteine desulfhydrase [Paenibacillus beijingensis]
Length=331

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 96/151 (64%), Gaps = 19/151 (13%)
 Frame = +3

Query  255  LPNLPTNTE-------------VWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            L NLPT  E             +++KRDD +G + SGNKVRKLE+ + +A+A G D +IT
Sbjct  10   LANLPTKIEKLERLSAQLGGPSLFIKRDDQTGTEFSGNKVRKLEYSLKEALAAGHDYVIT  69

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GGIQSNHCR+TA AA  L L  YL+LR ++    ++P   GNLL++ L+GA I  ++ E
Sbjct  70   CGGIQSNHCRSTAAAAAKLGLKSYLVLRGNE---PQEP--DGNLLLDHLLGAQIRYITAE  124

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            EY +  +  + ++ K+KL  +G KPY+IP G
Sbjct  125  EYRERRAEIMESV-KDKLTGQGYKPYIIPEG  154



>ref|WP_025647111.1| MULTISPECIES: cysteine desulfhydrase [Psychrobacter]
Length=329

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 92/152 (61%), Gaps = 11/152 (7%)
 Frame = +3

Query  216  SLGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTP I +  L        +++KRDD +G+ L GNK RKL++++ DA+A+GAD +I
Sbjct  9    SLGYFPTPLIELTRLSKTLGGPNIYMKRDDNTGLALGGNKTRKLKYIIGDALAKGADTVI  68

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T G IQSNHCR TA AA  L L+C+L+L   +    + P   GNLL++++ G HI    +
Sbjct  69   TAGAIQSNHCRQTAGAAASLGLECHLVLGGEE---PEQP--QGNLLLDKVYGCHIHWAGE  123

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +     +A     +L  EG+KPYVIP G
Sbjct  124  NRKGEDIPALVA-----QLKAEGKKPYVIPYG  150



>ref|WP_033187553.1| cysteine desulfhydrase [Pseudoalteromonas sp. PLSV]
Length=332

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 11/151 (7%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG FPTPIH +  L       ++++KRDDL+G+ L GNK RKLE+L+AD +A+G DCIIT
Sbjct  11   LGVFPTPIHKLARLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADGLAKGCDCIIT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNHCR TA AA  L L+C+L+L              GNLL+++L GA I    ++
Sbjct  71   AGAAQSNHCRQTAAAAATLGLECHLVLGGQ-----APSSANGNLLLDQLFGARIHWAGEK  125

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               +     + NI+   L ++G++PYV+P G
Sbjct  126  RKGE----DIPNIV-STLQNQGKRPYVVPYG  151



>ref|WP_035134048.1| cysteine desulfhydrase [Clostridium sulfidigenes]
 gb|KEZ85667.1| cysteine desulfhydrase [Clostridium sulfidigenes]
Length=335

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 93/158 (59%), Gaps = 8/158 (5%)
 Frame = +3

Query  198  VPSDVFSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQ  374
            +P  +  L N PT I  +     +     +++KRDD +G+++SGNK+RKLEF   DA+ +
Sbjct  10   IPERI-KLANMPTKIEKLERFSKMLGGPNIYIKRDDQTGLEVSGNKIRKLEFTAKDAINK  68

Query  375  GADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAH  554
            GA+ +IT GGIQSNHCRATA  A  L +   L+LR S   ++ D    GNL +++L+GA 
Sbjct  69   GANVLITCGGIQSNHCRATAAVAARLGIKSVLVLRGSSN-IESD----GNLFIDKLLGAD  123

Query  555  IDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            I  ++ EEY    S  +  I KE    +G   Y+IP G
Sbjct  124  IRFITAEEYKNSRSEIMEQIKKE-YDKKGYTSYIIPEG  160



>ref|WP_006992457.1| D-cysteine desulfhydrase [Glaciecola mesophila]
 dbj|GAC24306.1| D-cysteine desulfhydrase [Glaciecola mesophila KMM 241]
Length=332

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 11/151 (7%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG FPTPIH +  L       ++++KRDDL+G+ L GNK RKLE+L+AD +A+G DCIIT
Sbjct  11   LGVFPTPIHKLARLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADGLAKGCDCIIT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNHCR TA AA  L L+C+L+L              GNLL+++L GA I    ++
Sbjct  71   AGAAQSNHCRQTAAAAATLGLECHLVLGGQ-----APSSANGNLLLDQLFGARIHWAGEK  125

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               +     + NI+   L ++G++PYV+P G
Sbjct  126  RKGE----DIPNIV-STLQNQGKRPYVVPYG  151



>ref|WP_021282477.1| hypothetical protein [Clostridium sp. BL8]
 gb|EQB89061.1| hypothetical protein M918_03220 [Clostridium sp. BL8]
Length=329

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 21/153 (14%)
 Frame = +3

Query  252  NLPNLPTNTE-------------VWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            N+ NLPT  E             +++KRDD +G ++SGNKVRKLEF + +A+  G D +I
Sbjct  9    NIANLPTRIEKLERLSKELQGPNIFIKRDDETGTEISGNKVRKLEFSVQEALNLGCDVLI  68

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG-LTGNLLVERLVGAHIDLVS  569
            T GGIQSNHCRATA  A  L L   L+LR S      D G   GNL + +L+GA I  ++
Sbjct  69   TCGGIQSNHCRATAAVATKLGLKSLLVLRGS------DEGSYDGNLFLNKLLGADIKFIT  122

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             EEY K   +++   LK    ++G KPY+IP G
Sbjct  123  SEEY-KNNRLSIMEDLKLSYENKGYKPYIIPEG  154



>ref|WP_009019997.1| D-cysteine desulfhydrase [Luminiphilus syltensis]
 gb|EED35251.1| D-cysteine desulfhydrase [Luminiphilus syltensis NOR5-1B]
Length=337

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 87/152 (57%), Gaps = 9/152 (6%)
 Frame = +3

Query  219  LGNFPTPIH--IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            L   PTP+   I           +W+KRDD++G  L+GNKVRKLEF+ A A+    D +I
Sbjct  13   LAQTPTPLQPLIRAAERWTPGKRLWIKRDDMTGSLLTGNKVRKLEFIAAHALDTDVDVLI  72

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T GG+QSNHCRATAV A  L L C+L+LR +       P   GN L++RLVGA I  V+ 
Sbjct  73   TCGGLQSNHCRATAVVAAQLGLRCHLVLRGTP------PSDEGNTLLDRLVGAAITPVAP  126

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            E+Y K    AL     E+    G KP VIP G
Sbjct  127  EDYRK-NLRALLEATAEEYRCAGLKPLVIPTG  157



>gb|EHM00187.1| putative D-cysteine desulfhydrase [Lactobacillus parafarraginis 
F0439]
Length=341

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 92/156 (59%), Gaps = 7/156 (4%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL-SGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTP+H  N  +      ++LKRDD +G  L  GNK+RKLE+L+ DA+ QGAD +I
Sbjct  10   SLGFFPTPVHRLNRLSDQLGINLYLKRDDFTGPNLFGGNKIRKLEYLLGDAMNQGADTVI  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS-  569
            T G  QSNH   TAVAA+ L L   L L T      +D    GN+L+++++GA I  VS 
Sbjct  70   TFGATQSNHAMETAVAARKLGLATILYLETITPNDQQDD--RGNILIDKILGATIHYVSM  127

Query  570  -KEEYAKVGSVALANILKEK--LLHEGRKPYVIPVG  668
                 ++   VA+   LKEK  L  +G   Y+IPVG
Sbjct  128  VDRTESEADEVAMQAALKEKARLEADGHTVYIIPVG  163



>ref|WP_027872533.1| cysteine desulfhydrase [Melitea salexigens]
Length=336

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 88/153 (58%), Gaps = 7/153 (5%)
 Frame = +3

Query  213  FSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
              L N PTP+  +  L        +W+KRDDL+G  LSGNK+RKLEF +A A+ +G D I
Sbjct  12   LGLANLPTPLQPLTRLQEARPGPRIWVKRDDLTGCALSGNKIRKLEFSLAQALEEGCDTI  71

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GG+QSNHCRATA+    L L C+L+LR      +K     GNLL+++L GA I    
Sbjct  72   ITCGGLQSNHCRATALLCAQLGLKCHLVLRG-----EKPEHADGNLLLDQLAGAQISAYP  126

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +++       LA   ++     GR+ ++IP G
Sbjct  127  AKQFQAQLPQLLAQ-WQQYYADRGRRAFIIPTG  158



>ref|WP_017417108.1| hypothetical protein [Clostridium tunisiense]
Length=329

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 94/158 (59%), Gaps = 16/158 (10%)
 Frame = +3

Query  225  NFPTPIHIWNLPNLPTNTE----------VWLKRDDLSGMQLSGNKVRKLEFLMADAVAQ  374
            N P  ++I NLP      E          +++KRDD +G ++SGNK+RKLEF + +A+ Q
Sbjct  3    NIPEKLNIANLPTKIQKLERLTKELQGPNIFIKRDDETGSEVSGNKIRKLEFSVKEALNQ  62

Query  375  GADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAH  554
            G + +IT GGIQSNHCRATA  A  L L   L+LR S+    KD  + GNL + +L+GA 
Sbjct  63   GCNLLITCGGIQSNHCRATAAIAAKLGLKSSLVLRGSEA---KD--IDGNLFLNKLLGAD  117

Query  555  IDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            I  ++ E+Y     + + N LK +   +G KPY+IP G
Sbjct  118  IKFITAEDYKHNRMLIMEN-LKTEYEKQGFKPYIIPEG  154



>ref|WP_012162178.1| D-cysteine desulfhydrase [Acaryochloris marina]
 gb|ABW26657.1| D-cysteine desulfhydrase [Acaryochloris marina MBIC11017]
Length=331

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 88/152 (58%), Gaps = 11/152 (7%)
 Frame = +3

Query  216  SLGNFPTPI-HIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTPI  +  L  +     + +KRDD +G+ L GNK RKLEFL+A+A+ Q  DC++
Sbjct  10   SLGFFPTPIVELPRLSQVLDGPRILMKRDDQTGLALGGNKTRKLEFLIAEALHQHCDCVL  69

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSK  572
            T G  QSNHCR TA AA  + LDC+L+L  +    D+     GNLL++ L+GA I     
Sbjct  70   TAGASQSNHCRQTAAAAAMVGLDCHLVLGGTP--PDR---ANGNLLLDELLGAQIHWTGT  124

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +  S      +  +L  +GR PYVIP G
Sbjct  125  NRKGEQLSA-----IASQLQAQGRHPYVIPYG  151



>ref|WP_026573864.1| cysteine desulfhydrase [Bacillus sp. UNC438CL73TsuS30]
Length=332

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 91/151 (60%), Gaps = 7/151 (5%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
             + N PT +   +  N   N  V++KRDD +GM  SGNK+RKLE+L+ADA  +  D +IT
Sbjct  11   EIANVPTKVEKVDFFNKHLNKSVFIKRDDQTGMGSSGNKIRKLEYLLADAKNRKCDYVIT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GGIQSNH RATAV A    +   LIL+ S+V         GNL + +LVGA I + +++
Sbjct  71   CGGIQSNHARATAVLAAKYQMKSLLILKESEV-----NRTEGNLFLTKLVGATIKVATED  125

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            EY  + +  +A + KE L   G  PYVIP+G
Sbjct  126  EYQDL-TPMIAKLTKE-LTDTGHNPYVIPMG  154



>ref|WP_006006904.1| D-cysteine desulfhydrase [Glaciecola punicea]
 dbj|GAB56595.1| D-cysteine desulfhydrase [Glaciecola punicea DSM 14233 = ACAM 
611]
Length=337

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 91/152 (60%), Gaps = 13/152 (9%)
 Frame = +3

Query  219  LGNFPTP-IHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG FPTP + +  L        +++KRDD +G+ + GNK RKLEF++ DA+A GA+ I+T
Sbjct  11   LGFFPTPLVELSKLSKKLNGPRIFMKRDDNTGLAMGGNKTRKLEFILGDALAHGANTIVT  70

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG-LTGNLLVERLVGAHIDLVSK  572
             G  QSNHCR TA AA  L L+C+L      VL  K+P  + GNLL++++ G HI    +
Sbjct  71   AGAAQSNHCRQTAAAAASLGLECHL------VLGGKEPAHVNGNLLLDKIFGCHIHWAGQ  124

Query  573  EEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                +     +  I+ E+L  +G+ PYV+P G
Sbjct  125  NRKGE----DIPTIV-EQLKRDGKTPYVVPYG  151



>gb|KGM89288.1| D-cysteine desulfhydrase [Roseovarius mucosus DSM 17069]
Length=366

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 94/164 (57%), Gaps = 7/164 (4%)
 Frame = +3

Query  180  ASSLSPVPSDVFSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLM  356
            AS+L+  P     LG+FPTP+  +  L         W+KRDD +G+   GNK RKLEFLM
Sbjct  28   ASALAAFPR--VRLGHFPTPLEPMDRLTEHLGGPRFWVKRDDCTGLSSGGNKTRKLEFLM  85

Query  357  ADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVE  536
            ADA+ +GAD IIT G  QSNH R TA AA  L + C+++L       D +  L GN+ ++
Sbjct  86   ADALGEGADTIITQGTTQSNHARQTAAAAARLGMACHILLEDPTGYADPEYTLNGNVFLD  145

Query  537  RLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            RL GA + +  +   A + S     +L  +L   GRKPYVIP G
Sbjct  146  RLHGATVAM--RRSGADMASE--MELLAVELRAAGRKPYVIPGG  185



>ref|WP_034850629.1| hypothetical protein [Inquilinus limosus]
Length=337

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 97/159 (61%), Gaps = 17/159 (11%)
 Frame = +3

Query  213  FSLGNFPTPIHIWNLPNLPT---NTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGAD  383
              L + PTP+    LP L       ++W+KRDD +G+ L GNK RKLEFL+ +A+AQGAD
Sbjct  10   IRLQHAPTPLE--PLPRLTEALGGPQLWVKRDDCTGLALGGNKARKLEFLLGEALAQGAD  67

Query  384  CIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGL--TGNLLVERLVGAHI  557
             I+T GG QSNH R TA AA  L L C L+L  +  +  +DP     GNLL++ L GA I
Sbjct  68   TIVTAGGPQSNHARQTAAAAARLGLHCILVL--TDAVPGRDPAYHANGNLLLDGLFGARI  125

Query  558  DLV--SKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +L+  + +  A++  VA      E+   EGR+PYV+P+G
Sbjct  126  ELLPGTADADAEMARVA------ERCRAEGRRPYVVPIG  158



>ref|WP_008033848.1| cytochrome C biogenesis protein CcmE [Rhodobacterales bacterium 
HTCC2255]
 gb|EAU52708.1| D-cysteine desulfhydrase [Rhodobacterales bacterium HTCC2255]
Length=364

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 88/151 (58%), Gaps = 5/151 (3%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG+ PTP+  +  L  +     +W+KRDD +G+   GNK RKLEFLMADA ++GAD IIT
Sbjct  38   LGHLPTPLEPMDRLSEILGGPRLWVKRDDCTGLSSGGNKTRKLEFLMADAQSKGADTIIT  97

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNH R T  AA  L ++C+++L       D    L GN+L++RL GA    VSK 
Sbjct  98   QGATQSNHARQTTAAAAKLGMECHILLEDRTGSNDHSYILNGNVLLDRLHGAS---VSKR  154

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                  +  + +   E L+ +G+ PY+IP G
Sbjct  155  SGGTDMNAEMQD-FAESLIEKGKNPYIIPGG  184



>ref|WP_040537582.1| cysteine desulfhydrase [Lactobacillus parafarraginis]
Length=349

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 92/156 (59%), Gaps = 7/156 (4%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQL-SGNKVRKLEFLMADAVAQGADCII  392
            SLG FPTP+H  N  +      ++LKRDD +G  L  GNK+RKLE+L+ DA+ QGAD +I
Sbjct  18   SLGFFPTPVHRLNRLSDQLGINLYLKRDDFTGPNLFGGNKIRKLEYLLGDAMNQGADTVI  77

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS-  569
            T G  QSNH   TAVAA+ L L   L L T      +D    GN+L+++++GA I  VS 
Sbjct  78   TFGATQSNHAMETAVAARKLGLATILYLETITPNDQQDD--RGNILIDKILGATIHYVSM  135

Query  570  -KEEYAKVGSVALANILKEK--LLHEGRKPYVIPVG  668
                 ++   VA+   LKEK  L  +G   Y+IPVG
Sbjct  136  VDRTESEADEVAMQAALKEKARLEADGHTVYIIPVG  171



>ref|WP_014123061.1| 1-aminocyclopropane-1-carboxylate deaminase [Thermococcus sp. 
AM4]
 ref|YP_002582067.2| pyridoxal phosphate-dependent deaminase [Thermococcus sp. AM4]
 gb|EEB73618.2| pyridoxal phosphate-dependent deaminase [Thermococcus sp. AM4]
Length=332

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 96/166 (58%), Gaps = 11/166 (7%)
 Frame = +3

Query  171  PTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEF  350
            P   S L+  P     L  + TPI      +     +V++KRDDL+G  + GNKVRKLEF
Sbjct  3    PKIGSLLARFPR--VELIKWETPIQYLPKVSERLGVDVYVKRDDLTGFGIGGNKVRKLEF  60

Query  351  LMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLL  530
            L+ DA+A+G D +IT G + SNH   TA+AAK L LD  L+LR  K        L GN L
Sbjct  61   LLGDAIAKGCDTVITTGAVHSNHAFVTALAAKSLGLDAVLVLRGKKE-------LKGNYL  113

Query  531  VERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +++L+G    + S E+ +++  +  A  + E+L  EG+KPY+IP G
Sbjct  114  LDKLMGIETRVYSVEKTSELWPI--AKEVAEELKKEGKKPYLIPAG  157



>ref|WP_004739369.1| cytochrome C biogenesis protein CcmE [Vibrio splendidus]
 gb|EGU43079.1| D-cysteine desulfhydrase [Vibrio splendidus ATCC 33789]
Length=336

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 87/153 (57%), Gaps = 5/153 (3%)
 Frame = +3

Query  213  FSLGNFPTPIHIW-NLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             +  +  TP+ +  NL        +W+KRDD +G+   GNK RKLEFLMADAV QGAD I
Sbjct  9    LNFAHLNTPLELMENLSKELDGPNIWIKRDDCTGLAGGGNKTRKLEFLMADAVEQGADTI  68

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT G  QSNH R TA  A  LN+DCY++L       D D    GN++++++  A +   S
Sbjct  69   ITQGATQSNHARQTAAIATKLNMDCYVLLEDRTSSEDPDYKFNGNVMLDQMFNAKL---S  125

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            K       + A+ ++    L  EG+KPY++P G
Sbjct  126  KYPGGTDMNAAMEDV-AATLRAEGKKPYIVPGG  157



>ref|WP_012238709.1| D-cysteine desulfhydrase [Sorangium cellulosum]
 emb|CAN96244.1| yedO [Sorangium cellulosum So ce56]
Length=329

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 90/156 (58%), Gaps = 12/156 (8%)
 Frame = +3

Query  213  FSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
             +L + PTPI            ++++KRDD++    +GNK+RKLE+L+A A  +GA C+I
Sbjct  5    LALSHLPTPIQRPQRLAEALGVDLYVKRDDMTAGAEAGNKIRKLEYLLAAAREEGAGCVI  64

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG----LTGNLLVERLVGAHID  560
            T GG+QSNH RATA+ +  L L   L LRTS      DP     L GN+L++RL GA I 
Sbjct  65   TCGGLQSNHARATALVSASLGLRSVLFLRTS------DPSAAAPLEGNVLLDRLAGAEIR  118

Query  561  LVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            L+S E Y   G  AL      ++   G +PYVIP G
Sbjct  119  LISPEAYRDRG--ALMAEAAAEIRAAGGRPYVIPEG  152



>ref|WP_042691531.1| 1-aminocyclopropane-1-carboxylate deaminase [Thermococcus nautili]
 gb|AHL23159.1| 1-aminocyclopropane-1-carboxylate deaminase [Thermococcus nautili]
Length=332

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 95/166 (57%), Gaps = 11/166 (7%)
 Frame = +3

Query  171  PTWASSLSPVPSDVFSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEF  350
            P   S L+  P     L  + TPI      +     +V++KRDDL+G  + GNKVRKLEF
Sbjct  3    PKIGSLLARFPR--VELIKWETPIQYLPKVSERLGVDVYVKRDDLTGFGIGGNKVRKLEF  60

Query  351  LMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLL  530
            L+ DA+A+G D +IT G + SNH   TA+AAK L LD  L+LR  +        L GN L
Sbjct  61   LLGDAIARGCDTVITTGAVHSNHAFVTALAAKSLGLDAVLVLRGKEE-------LKGNYL  113

Query  531  VERLVGAHIDLVSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            ++ L+G    + S E+ +++  +  A  + E+L  EGRKPY+IP G
Sbjct  114  LDELMGIETRVYSVEKTSELWPI--AQKVAEELKKEGRKPYLIPAG  157



>ref|WP_035924902.1| 1-aminocyclopropane-1-carboxylate deaminase [Burkholderia glathei]
 gb|KDR40878.1| 1-aminocyclopropane-1-carboxylate deaminase [Burkholderia glathei]
 emb|CDY73517.1| 1-aminocyclopropane-1-carboxylate deaminase [Burkholderia glathei]
Length=337

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 85/153 (56%), Gaps = 3/153 (2%)
 Frame = +3

Query  213  FSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLS-GMQLSGNKVRKLEFLMADAVAQGADCI  389
             SLG FP+P+H  N  +      VW KRDD+S G+   GNK+RKLE+L ADAV QGAD +
Sbjct  12   ISLGFFPSPVHRLNRLSDALGVSVWAKRDDVSSGLAFGGNKIRKLEWLAADAVKQGADTL  71

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            +++G IQSNH R  A  A  L + C L+        D      GN+L+ RL+GA   L+ 
Sbjct  72   VSIGNIQSNHTRQVAAVAAVLGMRCRLVQEEWTHWDDPVYDKVGNILLSRLMGAET-LLE  130

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             E Y+          L E++  EG KPY IP G
Sbjct  131  GEGYSTEVKQTWERAL-EQVRREGGKPYAIPAG  162



>gb|EDQ35075.2| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Hoeflea phototrophica DFL-43]
Length=364

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 89/151 (59%), Gaps = 5/151 (3%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG+FPTP+  +  L  +     +W+KRDD +G+   GNK RKLE+LMADA+ QGAD IIT
Sbjct  38   LGHFPTPLEPMDRLSEMLGGPRLWVKRDDCTGLSSGGNKTRKLEYLMADALDQGADTIIT  97

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNH R TA AA  L + C+++L       + +  L GN+L++RL GA    VSK 
Sbjct  98   QGATQSNHARQTAAAAAKLGMACHILLEDRTGSSESNYTLNGNVLLDRLHGAS---VSKR  154

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                    A    L EKLL +G  PY+IP G
Sbjct  155  P-GGADMNAEMEALAEKLLAQGMNPYIIPGG  184



>ref|WP_028828759.1| cysteine desulfhydrase [Proteocatella sphenisci]
Length=343

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 93/153 (61%), Gaps = 10/153 (7%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTE--VWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
            SL N PT    + L  L    E  +++KRDD +G++LSGNKVRKLEF+ A+A +QGA  +
Sbjct  9    SLANLPT--RTYKLQKLSEKLEKNIYIKRDDETGVELSGNKVRKLEFVTAEAKSQGATVL  66

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GGIQSNH RATAVAA  L +   L+LR S     +     GN L++ +VGA I  +S
Sbjct  67   ITCGGIQSNHARATAVAAIKLGMKSVLVLRES-----EKGHAEGNHLLDLVVGADIRFIS  121

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
             +EYA+     + +I KE L  +    Y+IP G
Sbjct  122  AKEYAEKRFEIMEDIKKE-LESQCETGYIIPEG  153



>ref|WP_045652067.1| cysteine desulfhydrase [Gammaproteobacteria bacterium BRH_c0]
 gb|KJS08178.1| cysteine desulfhydrase [Gammaproteobacteria bacterium BRH_c0]
Length=338

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 88/153 (58%), Gaps = 5/153 (3%)
 Frame = +3

Query  213  FSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             +L   PTP + +  L        +W+KRDDL+     GNK+RKLEF++A+A A G D +
Sbjct  9    LNLAQIPTPFYCLEKLSAQLGGPRIWVKRDDLTESAAGGNKIRKLEFVLAEARAAGCDTL  68

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVS  569
            IT GG+QSNHCRATA+    L    +L+LR      +      GNLL++ L GA + +  
Sbjct  69   ITSGGLQSNHCRATALLGARLGFAVHLLLRDEGEFTEVP---DGNLLLDYLAGAAVSIYP  125

Query  570  KEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +  Y K    +L +  +E  L EG+KP+VIPVG
Sbjct  126  RSRYLKE-HASLVSQWREHYLAEGKKPWVIPVG  157



>ref|WP_040449732.1| cytochrome C biogenesis protein CcmE [Hoeflea phototrophica]
Length=358

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 89/151 (59%), Gaps = 5/151 (3%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG+FPTP+  +  L  +     +W+KRDD +G+   GNK RKLE+LMADA+ QGAD IIT
Sbjct  32   LGHFPTPLEPMDRLSEMLGGPRLWVKRDDCTGLSSGGNKTRKLEYLMADALDQGADTIIT  91

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNH R TA AA  L + C+++L       + +  L GN+L++RL GA    VSK 
Sbjct  92   QGATQSNHARQTAAAAAKLGMACHILLEDRTGSSESNYTLNGNVLLDRLHGAS---VSKR  148

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                    A    L EKLL +G  PY+IP G
Sbjct  149  P-GGADMNAEMEALAEKLLAQGMNPYIIPGG  178



>gb|EEF94357.1| D-cysteine desulfhydrase [Catenibacterium mitsuokai DSM 15897]
Length=175

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 90/155 (58%), Gaps = 11/155 (7%)
 Frame = +3

Query  213  FSLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCII  392
              L   PTPI   +  +      +++KRDDL+    SGNK+RKLE+ +A+A++ G D +I
Sbjct  4    LHLAQLPTPIEKIDYLSNKYKPNIFVKRDDLTDSVASGNKIRKLEYSVAEALSLGCDTLI  63

Query  393  TLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPG---LTGNLLVERLVGAHIDL  563
            T GG QSNHCR+TA  A  L L C LILR       K+PG    T N L++ ++GA I +
Sbjct  64   TNGGFQSNHCRSTAAVAAKLGLKCILILR-------KEPGENIETANFLLDHMLGADIRV  116

Query  564  VSKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
               +++       +  + +E +L +G KPY+IP+G
Sbjct  117  KEHDDFQAHKDEMMQEVYQE-VLDQGGKPYIIPMG  150



>ref|WP_005950565.1| D-cysteine desulfhydrase [Fusobacterium varium]
 gb|EES63871.1| putative D-cysteine desulfhydrase [Fusobacterium varium ATCC 
27725]
Length=326

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 91/151 (60%), Gaps = 6/151 (4%)
 Frame = +3

Query  216  SLGNFPTPIHIWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            SL NFPT I      +  +   +++KRDD +G ++SGNK+RKLE+ + +A+  G D +IT
Sbjct  6    SLANFPTKIEKLEKISNESGVNIYIKRDDQTGSEISGNKIRKLEYSIYEALENGCDTLIT  65

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             GGIQSNH RATA A   L +   L+LR+     D+ P + GN  +++++GA + ++S +
Sbjct  66   CGGIQSNHARATAAAGIKLGMRAILVLRS-----DETPEMEGNYFLDKVIGADVRIISSD  120

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
            +Y +   + +   +K +    G K Y+IP G
Sbjct  121  DYRER-RMEIMQKIKAESDAGGHKAYIIPEG  150



>ref|WP_043955455.1| cytochrome C biogenesis protein CcmE [Enterobacter sp. YD4]
 gb|KIS44682.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family protein [Enterobacter sp. YD4]
Length=338

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 90/162 (56%), Gaps = 22/162 (14%)
 Frame = +3

Query  213  FSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             SLG+FPTP+  + NL  L    ++W+KRDD +G+   GNK RKLEFL+ADA+A+ AD I
Sbjct  9    LSLGHFPTPLEPLENLSALLGGPKIWIKRDDATGLATGGNKTRKLEFLLADALAKNADVI  68

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHI----  557
            IT G  QSNH R T   A  L L   ++L        +D   +GN+L++ L+G  I    
Sbjct  69   ITQGATQSNHVRQTIAGAAKLGLASKVLLEKRVTDFGEDYQRSGNILLDELLGGEIVAHL  128

Query  558  ----DLV-SKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                D+  + EEYA            E+L  +G +PYVIP G
Sbjct  129  PGGTDMQKAMEEYA------------EQLREQGHRPYVIPGG  158



>ref|WP_012870613.1| 1-aminocyclopropane-1-carboxylate deaminase [Sphaerobacter thermophilus]
 gb|ACZ37565.1| 1-aminocyclopropane-1-carboxylate deaminase [Sphaerobacter thermophilus 
DSM 20745]
Length=340

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 94/170 (55%), Gaps = 15/170 (9%)
 Frame = +3

Query  186  SLSPVPSDVFSLGNFPTPIHIWN-----LPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEF  350
            S+  +P   F L   PTP+H  +     L        + +KRDDL+G+ L GNK RKLEF
Sbjct  2    SIGTIPR--FPLATLPTPLHEAHRLREALGGPERCPRILIKRDDLTGLALGGNKARKLEF  59

Query  351  LMADAVAQGADCIITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLL  530
            L+ADA+ QGA  +IT G +QSNH R TA AA+   L C L+L T      +DP + GNLL
Sbjct  60   LIADALRQGATALITTGAVQSNHARMTAAAARLAGLHCSLVLTTGV----EDPPIQGNLL  115

Query  531  VERLVGAHIDLVSK--EEYAKVGSVALANILK--EKLLHEGRKPYVIPVG  668
            ++ L+ A + LV    ++   V +     I +    L   G +PYVIPVG
Sbjct  116  LDHLLQAEVHLVPAPPDKALAVDAAVDETIARVAADLESRGERPYVIPVG  165



>ref|WP_007372747.1| cytochrome C biogenesis protein CcmE [Kosakonia radicincitans]
 gb|EJI89685.1| D-cysteine desulfhydrase family protein [Kosakonia radicincitans 
DSM 16656]
 gb|KDE36340.1| cytochrome C biogenesis protein CcmE [Kosakonia radicincitans 
UMEnt01/12]
Length=338

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 90/162 (56%), Gaps = 22/162 (14%)
 Frame = +3

Query  213  FSLGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCI  389
             SLG+FPTP+  + NL  L    ++W+KRDD +G+   GNK RKLEFL+ADA+A+ AD I
Sbjct  9    LSLGHFPTPLEPLENLSALLGGPKIWIKRDDATGLATGGNKTRKLEFLLADALAKNADVI  68

Query  390  ITLGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHI----  557
            IT G  QSNH R T   A  L L   ++L        +D   +GN+L++ L+G  I    
Sbjct  69   ITQGATQSNHVRQTIAGAAKLGLASKVLLEKRVTDFGEDYQRSGNILLDELLGGEIVAHL  128

Query  558  ----DLV-SKEEYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                D+  + EEYA            E+L  +G +PYVIP G
Sbjct  129  PGGTDMQKAMEEYA------------EQLREQGHRPYVIPGG  158



>ref|WP_020056652.1| cytochrome C biogenesis protein CcmE [alpha proteobacterium SCGC 
AAA076-C03]
Length=364

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 88/151 (58%), Gaps = 5/151 (3%)
 Frame = +3

Query  219  LGNFPTPIH-IWNLPNLPTNTEVWLKRDDLSGMQLSGNKVRKLEFLMADAVAQGADCIIT  395
            LG+ PTP+  +  L  +     +W+KRDD +G+   GNK RKLEFLMADA ++GAD IIT
Sbjct  38   LGHLPTPLEPMDRLSEILGGPRLWVKRDDCTGLSSGGNKTRKLEFLMADAQSKGADTIIT  97

Query  396  LGGIQSNHCRATAVAAKYLNLDCYLILRTSKVLVDKDPGLTGNLLVERLVGAHIDLVSKE  575
             G  QSNH R T  AA  L ++C+++L       D    L GN+L++RL GA    VSK 
Sbjct  98   QGATQSNHARQTTAAAAKLGMECHILLEDRTGSNDHSYILNGNVLLDRLHGAS---VSKR  154

Query  576  EYAKVGSVALANILKEKLLHEGRKPYVIPVG  668
                  +  + +   + L+ +G+ PY+IP G
Sbjct  155  SGGTDMNAEMQD-FADSLIEKGKNPYIIPGG  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1105426564043