BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5095

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344882.1|  PREDICTED: heterogeneous nuclear ribonucleop...    321   5e-104   Solanum tuberosum [potatoes]
ref|XP_004251912.1|  PREDICTED: heterogeneous nuclear ribonucleop...    319   3e-103   Solanum lycopersicum
ref|XP_009765857.1|  PREDICTED: heterogeneous nuclear ribonucleop...    317   2e-102   Nicotiana sylvestris
ref|XP_009594583.1|  PREDICTED: heterogeneous nuclear ribonucleop...    314   3e-101   
ref|XP_009594584.1|  PREDICTED: heterogeneous nuclear ribonucleop...    314   4e-101   
ref|XP_009790873.1|  PREDICTED: heterogeneous nuclear ribonucleop...    312   9e-101   Nicotiana sylvestris
ref|XP_009790872.1|  PREDICTED: heterogeneous nuclear ribonucleop...    312   9e-101   Nicotiana sylvestris
ref|XP_006352533.1|  PREDICTED: heterogeneous nuclear ribonucleop...    312   1e-100   Solanum tuberosum [potatoes]
ref|XP_010327197.1|  PREDICTED: heterogeneous nuclear ribonucleop...    313   1e-100   
ref|XP_004248330.1|  PREDICTED: heterogeneous nuclear ribonucleop...    312   1e-100   Solanum lycopersicum
ref|XP_011097787.1|  PREDICTED: heterogeneous nuclear ribonucleop...    312   1e-100   Sesamum indicum [beniseed]
emb|CBI26733.3|  unnamed protein product                                306   1e-100   Vitis vinifera
ref|XP_009606206.1|  PREDICTED: RNA-binding protein Musashi homol...    311   2e-100   Nicotiana tomentosiformis
ref|XP_002274589.1|  PREDICTED: heterogeneous nuclear ribonucleop...    309   3e-99    Vitis vinifera
ref|XP_010097281.1|  RNA-binding protein Musashi-2-like protein         309   5e-99    
ref|XP_006452507.1|  hypothetical protein CICLE_v10008158mg             308   5e-99    Citrus clementina [clementine]
emb|CAN75218.1|  hypothetical protein VITISV_003519                     308   5e-99    Vitis vinifera
ref|XP_006474951.1|  PREDICTED: heterogeneous nuclear ribonucleop...    308   5e-99    Citrus sinensis [apfelsine]
ref|XP_011095499.1|  PREDICTED: heterogeneous nuclear ribonucleop...    308   5e-99    Sesamum indicum [beniseed]
emb|CDP13750.1|  unnamed protein product                                308   7e-99    Coffea canephora [robusta coffee]
ref|XP_002529044.1|  Heterogeneous nuclear ribonucleoprotein 27C,...    306   4e-98    
gb|KDO62196.1|  hypothetical protein CISIN_1g009920mg                   307   4e-98    Citrus sinensis [apfelsine]
gb|KHG28808.1|  RNA-binding Musashi                                     306   6e-98    Gossypium arboreum [tree cotton]
ref|XP_007020625.1|  RNA-binding family protein isoform 1               305   9e-98    
ref|XP_007020630.1|  RNA-binding family protein isoform 6               305   1e-97    
ref|XP_007020626.1|  RNA-binding family protein isoform 2               305   1e-97    
ref|XP_012070961.1|  PREDICTED: heterogeneous nuclear ribonucleop...    304   3e-97    Jatropha curcas
gb|KJB13815.1|  hypothetical protein B456_002G095900                    303   8e-97    Gossypium raimondii
gb|KJB13816.1|  hypothetical protein B456_002G095900                    303   9e-97    Gossypium raimondii
ref|XP_009380127.1|  PREDICTED: heterogeneous nuclear ribonucleop...    302   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012070962.1|  PREDICTED: heterogeneous nuclear ribonucleop...    302   2e-96    
ref|XP_003600251.1|  Heterogeneous nuclear ribonucleoprotein A1         301   2e-96    Medicago truncatula
ref|XP_012070963.1|  PREDICTED: heterogeneous nuclear ribonucleop...    301   3e-96    Jatropha curcas
gb|KEH33977.1|  heterogeneous nuclear ribonucleoprotein 27C, puta...    301   3e-96    Medicago truncatula
ref|XP_010675870.1|  PREDICTED: heterogeneous nuclear ribonucleop...    300   1e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010252687.1|  PREDICTED: heterogeneous nuclear ribonucleop...    299   2e-95    Nelumbo nucifera [Indian lotus]
ref|XP_006575702.1|  PREDICTED: heterogeneous nuclear ribonucleop...    299   3e-95    Glycine max [soybeans]
ref|XP_010270160.1|  PREDICTED: heterogeneous nuclear ribonucleop...    298   6e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010270159.1|  PREDICTED: heterogeneous nuclear ribonucleop...    298   6e-95    Nelumbo nucifera [Indian lotus]
ref|XP_007142373.1|  hypothetical protein PHAVU_008G274900g             298   7e-95    Phaseolus vulgaris [French bean]
ref|XP_002320502.2|  hypothetical protein POPTR_0014s15970g             298   7e-95    
ref|XP_007142374.1|  hypothetical protein PHAVU_008G274900g             298   8e-95    Phaseolus vulgaris [French bean]
ref|XP_003519614.1|  PREDICTED: heterogeneous nuclear ribonucleop...    297   2e-94    Glycine max [soybeans]
ref|XP_008449079.1|  PREDICTED: heterogeneous nuclear ribonucleop...    296   2e-94    
ref|XP_009404108.1|  PREDICTED: heterogeneous nuclear ribonucleop...    296   2e-94    
ref|XP_002300356.2|  hypothetical protein POPTR_0001s37230g             296   3e-94    
gb|KHN23872.1|  RNA-binding protein Musashi like Rbp6                   296   4e-94    Glycine soja [wild soybean]
ref|XP_003544715.1|  PREDICTED: heterogeneous nuclear ribonucleop...    296   4e-94    Glycine max [soybeans]
ref|XP_011003504.1|  PREDICTED: heterogeneous nuclear ribonucleop...    295   6e-94    Populus euphratica
ref|XP_004294459.1|  PREDICTED: heterogeneous nuclear ribonucleop...    295   6e-94    Fragaria vesca subsp. vesca
gb|KHN43809.1|  RNA-binding protein Musashi like Rbp6                   296   7e-94    Glycine soja [wild soybean]
ref|XP_007142507.1|  hypothetical protein PHAVU_008G286500g             295   7e-94    Phaseolus vulgaris [French bean]
emb|CBI28407.3|  unnamed protein product                                292   9e-94    Vitis vinifera
ref|XP_008227101.1|  PREDICTED: heterogeneous nuclear ribonucleop...    294   2e-93    Prunus mume [ume]
ref|XP_008798476.1|  PREDICTED: heterogeneous nuclear ribonucleop...    294   2e-93    Phoenix dactylifera
ref|XP_007212015.1|  hypothetical protein PRUPE_ppa004834mg             294   2e-93    Prunus persica
ref|XP_011007622.1|  PREDICTED: heterogeneous nuclear ribonucleop...    294   2e-93    Populus euphratica
ref|XP_011007619.1|  PREDICTED: heterogeneous nuclear ribonucleop...    294   2e-93    Populus euphratica
ref|XP_003551514.1|  PREDICTED: heterogeneous nuclear ribonucleop...    294   2e-93    Glycine max [soybeans]
ref|XP_011007620.1|  PREDICTED: heterogeneous nuclear ribonucleop...    294   3e-93    Populus euphratica
ref|XP_007212016.1|  hypothetical protein PRUPE_ppa004834mg             294   3e-93    
ref|XP_004506674.1|  PREDICTED: heterogeneous nuclear ribonucleop...    293   7e-93    Cicer arietinum [garbanzo]
ref|XP_002272993.1|  PREDICTED: heterogeneous nuclear ribonucleop...    293   7e-93    Vitis vinifera
ref|XP_004149577.1|  PREDICTED: heterogeneous nuclear ribonucleop...    293   7e-93    Cucumis sativus [cucumbers]
ref|XP_002301585.1|  heterogeneous nuclear ribonucleoprotein            293   8e-93    
ref|XP_006447738.1|  hypothetical protein CICLE_v10015084mg             292   9e-93    Citrus clementina [clementine]
ref|XP_007026291.1|  RNA-binding family protein isoform 1               292   9e-93    
ref|XP_006595660.1|  PREDICTED: heterogeneous nuclear ribonucleop...    292   9e-93    Glycine max [soybeans]
gb|KHN43959.1|  DAZ-associated protein 1                                292   1e-92    Glycine soja [wild soybean]
ref|XP_006836782.1|  PREDICTED: heterogeneous nuclear ribonucleop...    292   1e-92    Amborella trichopoda
ref|XP_010557695.1|  PREDICTED: heterogeneous nuclear ribonucleop...    291   1e-92    Tarenaya hassleriana [spider flower]
ref|XP_007026295.1|  RNA-binding family protein isoform 5               292   1e-92    
ref|XP_006586118.1|  PREDICTED: heterogeneous nuclear ribonucleop...    292   1e-92    Glycine max [soybeans]
ref|XP_006363028.1|  PREDICTED: heterogeneous nuclear ribonucleop...    291   1e-92    Solanum tuberosum [potatoes]
ref|XP_004243541.1|  PREDICTED: heterogeneous nuclear ribonucleop...    291   2e-92    Solanum lycopersicum
ref|XP_003519672.1|  PREDICTED: heterogeneous nuclear ribonucleop...    291   2e-92    Glycine max [soybeans]
ref|XP_012074030.1|  PREDICTED: heterogeneous nuclear ribonucleop...    291   2e-92    Jatropha curcas
ref|XP_007026293.1|  RNA-binding family protein isoform 3               292   2e-92    
gb|KHN46912.1|  DAZ-associated protein 1                                291   3e-92    Glycine soja [wild soybean]
ref|XP_006449887.1|  hypothetical protein CICLE_v10015098mg             291   3e-92    Citrus clementina [clementine]
ref|XP_009625288.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   4e-92    Nicotiana tomentosiformis
ref|XP_009775500.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   4e-92    Nicotiana sylvestris
ref|XP_006467314.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   4e-92    Citrus sinensis [apfelsine]
ref|XP_002308799.1|  hypothetical protein POPTR_0006s01680g             290   4e-92    Populus trichocarpa [western balsam poplar]
gb|KHM99490.1|  RNA-binding protein Musashi like Rbp6                   291   5e-92    Glycine soja [wild soybean]
ref|XP_006352343.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   5e-92    Solanum tuberosum [potatoes]
gb|KDO78485.1|  hypothetical protein CISIN_1g011518mg                   290   6e-92    Citrus sinensis [apfelsine]
ref|XP_011007099.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   7e-92    Populus euphratica
ref|XP_010688996.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   7e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011007096.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   7e-92    Populus euphratica
ref|XP_011007097.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   7e-92    Populus euphratica
ref|XP_012081416.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   8e-92    Jatropha curcas
ref|XP_007146588.1|  hypothetical protein PHAVU_006G053000g             290   8e-92    Phaseolus vulgaris [French bean]
ref|XP_007146589.1|  hypothetical protein PHAVU_006G053000g             290   8e-92    Phaseolus vulgaris [French bean]
gb|EYU27413.1|  hypothetical protein MIMGU_mgv1a005325mg                290   9e-92    Erythranthe guttata [common monkey flower]
gb|EPS59033.1|  hypothetical protein M569_15778                         285   1e-91    Genlisea aurea
ref|XP_011039340.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   1e-91    Populus euphratica
ref|XP_010908650.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   1e-91    
ref|XP_010908651.1|  PREDICTED: heterogeneous nuclear ribonucleop...    290   1e-91    
dbj|BAK01877.1|  predicted protein                                      289   1e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010060245.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   1e-91    Eucalyptus grandis [rose gum]
ref|XP_010060242.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   1e-91    Eucalyptus grandis [rose gum]
ref|XP_009380131.1|  PREDICTED: heterogeneous nuclear ribonucleop...    289   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW66864.1|  hypothetical protein EUGRSUZ_F00624                     288   1e-91    Eucalyptus grandis [rose gum]
ref|XP_009380128.1|  PREDICTED: heterogeneous nuclear ribonucleop...    289   2e-91    
gb|EMS61711.1|  RNA-binding protein Musashi-like protein 2              288   2e-91    Triticum urartu
gb|EMT31848.1|  RNA-binding Musashi-2-like protein                      288   2e-91    
ref|XP_011004496.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   3e-91    Populus euphratica
ref|XP_009364617.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   3e-91    Pyrus x bretschneideri [bai li]
ref|XP_010936617.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   3e-91    Elaeis guineensis
ref|XP_009364612.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   3e-91    
ref|XP_008379969.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   3e-91    
ref|XP_010908648.1|  PREDICTED: heterogeneous nuclear ribonucleop...    289   3e-91    Elaeis guineensis
ref|XP_002316761.1|  hypothetical protein POPTR_0011s09050g             288   3e-91    
ref|XP_004250279.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   3e-91    Solanum lycopersicum
ref|XP_007215319.1|  hypothetical protein PRUPE_ppa005119mg             288   4e-91    Prunus persica
gb|KDO58444.1|  hypothetical protein CISIN_1g012289mg                   288   4e-91    Citrus sinensis [apfelsine]
gb|KDP36443.1|  hypothetical protein JCGZ_09513                         288   4e-91    Jatropha curcas
ref|XP_008342216.1|  PREDICTED: heterogeneous nuclear ribonucleop...    288   4e-91    
ref|NP_001068335.1|  Os11g0637700                                       287   6e-91    
ref|XP_009364669.1|  PREDICTED: heterogeneous nuclear ribonucleop...    287   7e-91    Pyrus x bretschneideri [bai li]
ref|XP_006663067.1|  PREDICTED: heterogeneous nuclear ribonucleop...    287   7e-91    Oryza brachyantha
ref|XP_007215320.1|  hypothetical protein PRUPE_ppa005132mg             287   9e-91    Prunus persica
ref|XP_008229871.1|  PREDICTED: heterogeneous nuclear ribonucleop...    287   1e-90    Prunus mume [ume]
gb|EYU33694.1|  hypothetical protein MIMGU_mgv1a005066mg                287   1e-90    Erythranthe guttata [common monkey flower]
ref|XP_011460104.1|  PREDICTED: heterogeneous nuclear ribonucleop...    286   1e-90    Fragaria vesca subsp. vesca
gb|KJB67389.1|  hypothetical protein B456_010G188300                    286   2e-90    Gossypium raimondii
ref|XP_004979810.1|  PREDICTED: heterogeneous nuclear ribonucleop...    286   2e-90    Setaria italica
ref|XP_004491591.1|  PREDICTED: heterogeneous nuclear ribonucleop...    286   2e-90    Cicer arietinum [garbanzo]
ref|XP_011460103.1|  PREDICTED: heterogeneous nuclear ribonucleop...    286   2e-90    Fragaria vesca subsp. vesca
ref|XP_008342177.1|  PREDICTED: heterogeneous nuclear ribonucleop...    286   2e-90    Malus domestica [apple tree]
gb|KHG05056.1|  RNA-binding Musashi                                     286   2e-90    Gossypium arboreum [tree cotton]
gb|KJB67390.1|  hypothetical protein B456_010G188300                    286   2e-90    Gossypium raimondii
ref|XP_006373597.1|  hypothetical protein POPTR_0016s01150g             286   2e-90    
gb|KHG02324.1|  RNA-binding Musashi                                     286   2e-90    Gossypium arboreum [tree cotton]
ref|XP_008342172.1|  PREDICTED: heterogeneous nuclear ribonucleop...    286   3e-90    
ref|XP_010094687.1|  RNA-binding protein Musashi-2-like protein         286   4e-90    
ref|XP_003577309.1|  PREDICTED: heterogeneous nuclear ribonucleop...    285   4e-90    Brachypodium distachyon [annual false brome]
ref|XP_009365193.1|  PREDICTED: heterogeneous nuclear ribonucleop...    286   4e-90    Pyrus x bretschneideri [bai li]
gb|KJB57868.1|  hypothetical protein B456_009G183800                    285   4e-90    Gossypium raimondii
ref|XP_008379973.1|  PREDICTED: heterogeneous nuclear ribonucleop...    285   5e-90    
ref|XP_009795233.1|  PREDICTED: heterogeneous nuclear ribonucleop...    285   7e-90    Nicotiana sylvestris
ref|XP_003617976.1|  Heterogeneous nuclear ribonucleoprotein A1, ...    285   9e-90    Medicago truncatula
ref|XP_009631808.1|  PREDICTED: heterogeneous nuclear ribonucleop...    285   9e-90    Nicotiana tomentosiformis
gb|KEH28480.1|  RNA-binding (RRM/RBD/RNP motif) family protein          285   1e-89    Medicago truncatula
ref|XP_010532987.1|  PREDICTED: heterogeneous nuclear ribonucleop...    284   1e-89    Tarenaya hassleriana [spider flower]
ref|XP_010112801.1|  DAZ-associated protein 1                           287   2e-89    
gb|KJB62964.1|  hypothetical protein B456_009G446000                    283   3e-89    Gossypium raimondii
gb|KJB62966.1|  hypothetical protein B456_009G446000                    283   3e-89    Gossypium raimondii
ref|XP_009606898.1|  PREDICTED: RNA-binding protein Musashi homol...    282   4e-89    
ref|XP_011040202.1|  PREDICTED: heterogeneous nuclear ribonucleop...    283   5e-89    Populus euphratica
gb|KHG26657.1|  RNA-binding Musashi Rbp6                                282   5e-89    Gossypium arboreum [tree cotton]
ref|XP_008463611.1|  PREDICTED: heterogeneous nuclear ribonucleop...    282   6e-89    Cucumis melo [Oriental melon]
ref|XP_004139532.1|  PREDICTED: heterogeneous nuclear ribonucleop...    282   7e-89    Cucumis sativus [cucumbers]
ref|XP_002532010.1|  Heterogeneous nuclear ribonucleoprotein 27C,...    282   7e-89    
ref|XP_010057821.1|  PREDICTED: heterogeneous nuclear ribonucleop...    282   8e-89    Eucalyptus grandis [rose gum]
ref|XP_010524610.1|  PREDICTED: heterogeneous nuclear ribonucleop...    282   9e-89    Tarenaya hassleriana [spider flower]
ref|XP_010909449.1|  PREDICTED: heterogeneous nuclear ribonucleop...    282   1e-88    Elaeis guineensis
gb|KJB62968.1|  hypothetical protein B456_009G446000                    283   1e-88    Gossypium raimondii
ref|XP_004293449.1|  PREDICTED: heterogeneous nuclear ribonucleop...    281   1e-88    Fragaria vesca subsp. vesca
ref|XP_007049271.1|  HnRNP isoform 1                                    281   1e-88    
ref|XP_006346780.1|  PREDICTED: heterogeneous nuclear ribonucleop...    281   2e-88    Solanum tuberosum [potatoes]
ref|XP_009361093.1|  PREDICTED: heterogeneous nuclear ribonucleop...    281   3e-88    Pyrus x bretschneideri [bai li]
ref|XP_008776925.1|  PREDICTED: heterogeneous nuclear ribonucleop...    281   3e-88    Phoenix dactylifera
ref|XP_008776924.1|  PREDICTED: heterogeneous nuclear ribonucleop...    281   4e-88    Phoenix dactylifera
ref|XP_009365188.1|  PREDICTED: heterogeneous nuclear ribonucleop...    280   7e-88    Pyrus x bretschneideri [bai li]
emb|CDP04502.1|  unnamed protein product                                280   8e-88    Coffea canephora [robusta coffee]
ref|XP_010035445.1|  PREDICTED: heterogeneous nuclear ribonucleop...    278   2e-87    Eucalyptus grandis [rose gum]
ref|XP_009390837.1|  PREDICTED: heterogeneous nuclear ribonucleop...    278   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907705.1|  PREDICTED: heterogeneous nuclear ribonucleop...    278   4e-87    Elaeis guineensis
ref|XP_009397214.1|  PREDICTED: heterogeneous nuclear ribonucleop...    278   6e-87    Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ19017.1|  hypothetical protein OsJ_34549                          277   6e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009802735.1|  PREDICTED: RNA-binding protein Musashi homol...    276   7e-87    Nicotiana sylvestris
ref|XP_010686663.1|  PREDICTED: heterogeneous nuclear ribonucleop...    276   7e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004251544.1|  PREDICTED: heterogeneous nuclear ribonucleop...    277   8e-87    Solanum lycopersicum
ref|XP_008813343.1|  PREDICTED: heterogeneous nuclear ribonucleop...    277   8e-87    Phoenix dactylifera
ref|XP_003594254.1|  RNA-binding protein, putative                      278   9e-87    
ref|XP_006352009.1|  PREDICTED: heterogeneous nuclear ribonucleop...    276   1e-86    Solanum tuberosum [potatoes]
ref|XP_009397215.1|  PREDICTED: heterogeneous nuclear ribonucleop...    276   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|AES64505.2|  RNA-binding (RRM/RBD/RNP motif) family protein          276   1e-86    Medicago truncatula
ref|XP_006657892.1|  PREDICTED: heterogeneous nuclear ribonucleop...    276   2e-86    Oryza brachyantha
ref|XP_004140014.1|  PREDICTED: heterogeneous nuclear ribonucleop...    276   2e-86    Cucumis sativus [cucumbers]
gb|ABF70162.1|  RNA-binding protein, putative                           276   2e-86    Musa acuminata [banana]
ref|XP_008464191.1|  PREDICTED: heterogeneous nuclear ribonucleop...    276   2e-86    Cucumis melo [Oriental melon]
ref|XP_004958148.1|  PREDICTED: heterogeneous nuclear ribonucleop...    276   2e-86    Setaria italica
ref|XP_010557774.1|  PREDICTED: heterogeneous nuclear ribonucleop...    276   2e-86    Tarenaya hassleriana [spider flower]
gb|AAK92717.1|  putative RNA-binding protein                            276   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566321.1|  RNA recognition motif-containing protein              276   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882552.1|  hypothetical protein ARALYDRAFT_478119             276   3e-86    
gb|AAF21191.1|AC013483_15  putative RNA-binding protein                 276   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850539.1|  RNA recognition motif-containing protein              276   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464424.1|  PREDICTED: heterogeneous nuclear ribonucleop...    275   5e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010464421.1|  PREDICTED: heterogeneous nuclear ribonucleop...    275   6e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010457881.1|  PREDICTED: heterogeneous nuclear ribonucleop...    275   6e-86    Camelina sativa [gold-of-pleasure]
ref|XP_004486327.1|  PREDICTED: heterogeneous nuclear ribonucleop...    275   6e-86    Cicer arietinum [garbanzo]
ref|XP_004486326.1|  PREDICTED: heterogeneous nuclear ribonucleop...    275   7e-86    
ref|XP_010458039.1|  PREDICTED: heterogeneous nuclear ribonucleop...    275   7e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006297510.1|  hypothetical protein CARUB_v10013535mg             275   8e-86    Capsella rubella
ref|XP_010486352.1|  PREDICTED: heterogeneous nuclear ribonucleop...    275   8e-86    Camelina sativa [gold-of-pleasure]
ref|XP_004236665.1|  PREDICTED: heterogeneous nuclear ribonucleop...    274   9e-86    Solanum lycopersicum
gb|KHG03317.1|  RNA-binding Musashi                                     274   1e-85    Gossypium arboreum [tree cotton]
ref|XP_006407794.1|  hypothetical protein EUTSA_v10020586mg             275   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_006407795.1|  hypothetical protein EUTSA_v10020586mg             275   1e-85    Eutrema salsugineum [saltwater cress]
gb|KJB42766.1|  hypothetical protein B456_007G167500                    274   1e-85    Gossypium raimondii
gb|KJB42767.1|  hypothetical protein B456_007G167500                    274   1e-85    Gossypium raimondii
ref|XP_006395215.1|  hypothetical protein EUTSA_v10004139mg             274   1e-85    Eutrema salsugineum [saltwater cress]
gb|KJB42772.1|  hypothetical protein B456_007G167500                    273   2e-85    Gossypium raimondii
gb|EYU33847.1|  hypothetical protein MIMGU_mgv1a008238mg                270   2e-85    Erythranthe guttata [common monkey flower]
ref|XP_002460931.1|  hypothetical protein SORBIDRAFT_02g037690          273   2e-85    Sorghum bicolor [broomcorn]
gb|KHG15677.1|  DAZ-associated 1                                        273   2e-85    Gossypium arboreum [tree cotton]
ref|XP_010545264.1|  PREDICTED: heterogeneous nuclear ribonucleop...    272   3e-85    Tarenaya hassleriana [spider flower]
gb|KJB42771.1|  hypothetical protein B456_007G167500                    273   3e-85    Gossypium raimondii
ref|NP_001060120.1|  Os07g0584500                                       273   4e-85    
ref|XP_010545265.1|  PREDICTED: heterogeneous nuclear ribonucleop...    271   4e-85    Tarenaya hassleriana [spider flower]
gb|KJB10272.1|  hypothetical protein B456_001G193100                    273   4e-85    Gossypium raimondii
ref|XP_003562808.1|  PREDICTED: heterogeneous nuclear ribonucleop...    272   6e-85    Brachypodium distachyon [annual false brome]
gb|KHG02993.1|  DAZ-associated 1                                        272   7e-85    Gossypium arboreum [tree cotton]
gb|EEC82342.1|  hypothetical protein OsI_26646                          272   7e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_009147022.1|  PREDICTED: heterogeneous nuclear ribonucleop...    273   8e-85    Brassica rapa
emb|CDY35966.1|  BnaA05g29840D                                          272   8e-85    Brassica napus [oilseed rape]
gb|EYU27681.1|  hypothetical protein MIMGU_mgv1a005511mg                272   9e-85    Erythranthe guttata [common monkey flower]
ref|XP_009147023.1|  PREDICTED: heterogeneous nuclear ribonucleop...    272   9e-85    Brassica rapa
ref|XP_002528240.1|  Heterogeneous nuclear ribonucleoprotein 27C,...    271   1e-84    
emb|CDY66272.1|  BnaC05g52200D                                          271   1e-84    Brassica napus [oilseed rape]
gb|KJB22704.1|  hypothetical protein B456_004G061400                    271   2e-84    Gossypium raimondii
gb|KJB08697.1|  hypothetical protein B456_001G098300                    270   3e-84    Gossypium raimondii
ref|XP_010536715.1|  PREDICTED: heterogeneous nuclear ribonucleop...    270   3e-84    Tarenaya hassleriana [spider flower]
ref|XP_008670520.1|  PREDICTED: heterogeneous nuclear ribonucleop...    270   4e-84    Zea mays [maize]
ref|XP_002866102.1|  hypothetical protein ARALYDRAFT_495641             269   4e-84    
emb|CDY07975.1|  BnaC03g35480D                                          270   4e-84    Brassica napus [oilseed rape]
ref|XP_010536716.1|  PREDICTED: heterogeneous nuclear ribonucleop...    269   4e-84    Tarenaya hassleriana [spider flower]
tpg|DAA63349.1|  TPA: hypothetical protein ZEAMMB73_769138              265   5e-84    
ref|XP_011095943.1|  PREDICTED: heterogeneous nuclear ribonucleop...    269   6e-84    Sesamum indicum [beniseed]
ref|XP_010539320.1|  PREDICTED: heterogeneous nuclear ribonucleop...    269   7e-84    
gb|ADK92872.1|  hnRNP                                                   269   8e-84    Hypericum perforatum
ref|XP_010539319.1|  PREDICTED: heterogeneous nuclear ribonucleop...    268   2e-83    Tarenaya hassleriana [spider flower]
emb|CDY22136.1|  BnaC01g39650D                                          268   2e-83    Brassica napus [oilseed rape]
gb|KJB10738.1|  hypothetical protein B456_001G220100                    268   2e-83    Gossypium raimondii
ref|XP_009124131.1|  PREDICTED: heterogeneous nuclear ribonucleop...    268   2e-83    Brassica rapa
ref|XP_010530068.1|  PREDICTED: heterogeneous nuclear ribonucleop...    266   2e-83    Tarenaya hassleriana [spider flower]
ref|XP_009124116.1|  PREDICTED: heterogeneous nuclear ribonucleop...    268   3e-83    Brassica rapa
ref|NP_001146396.1|  uncharacterized protein LOC100279976               267   4e-83    Zea mays [maize]
tpg|DAA63348.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...    267   4e-83    
ref|NP_851195.1|  RNA recognition motif-containing protein              266   5e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AAM97088.1|  RNA-binding protein-like                                266   5e-83    Arabidopsis thaliana [mouse-ear cress]
emb|CDX74030.1|  BnaA03g30170D                                          267   5e-83    
emb|CDY11989.1|  BnaC03g14150D                                          266   5e-83    Brassica napus [oilseed rape]
ref|XP_008652160.1|  PREDICTED: heterogeneous nuclear ribonucleop...    266   7e-83    Zea mays [maize]
ref|NP_568826.1|  RNA recognition motif-containing protein              266   7e-83    Arabidopsis thaliana [mouse-ear cress]
gb|KHG03345.1|  RNA-binding Musashi Rbp6                                266   9e-83    Gossypium arboreum [tree cotton]
tpg|DAA42481.1|  TPA: hypothetical protein ZEAMMB73_522608              266   9e-83    
dbj|BAB08572.1|  RNA-binding protein-like                               266   9e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002461626.1|  hypothetical protein SORBIDRAFT_02g005670          266   1e-82    Sorghum bicolor [broomcorn]
dbj|BAJ88758.1|  predicted protein                                      266   1e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006280461.1|  hypothetical protein CARUB_v10026394mg             265   1e-82    Capsella rubella
ref|XP_002459499.1|  hypothetical protein SORBIDRAFT_02g005620          265   2e-82    Sorghum bicolor [broomcorn]
ref|XP_009792734.1|  PREDICTED: heterogeneous nuclear ribonucleop...    265   3e-82    Nicotiana sylvestris
dbj|BAJ94498.1|  predicted protein                                      265   4e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006413156.1|  hypothetical protein EUTSA_v10025172mg             264   6e-82    Eutrema salsugineum [saltwater cress]
ref|XP_009134994.1|  PREDICTED: heterogeneous nuclear ribonucleop...    264   7e-82    Brassica rapa
gb|ACG34206.1|  RNA-binding protein                                     263   2e-81    Zea mays [maize]
ref|NP_001136724.1|  uncharacterized protein LOC100216861               263   2e-81    Zea mays [maize]
ref|XP_006398459.1|  hypothetical protein EUTSA_v10000891mg             261   3e-81    Eutrema salsugineum [saltwater cress]
ref|XP_004955731.1|  PREDICTED: heterogeneous nuclear ribonucleop...    262   4e-81    Setaria italica
ref|XP_009132374.1|  PREDICTED: heterogeneous nuclear ribonucleop...    260   6e-81    Brassica rapa
ref|XP_004955730.1|  PREDICTED: heterogeneous nuclear ribonucleop...    261   7e-81    
ref|XP_002863329.1|  predicted protein                                  260   8e-81    Arabidopsis lyrata subsp. lyrata
ref|XP_010438716.1|  PREDICTED: heterogeneous nuclear ribonucleop...    260   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010433462.1|  PREDICTED: heterogeneous nuclear ribonucleop...    260   2e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010448232.1|  PREDICTED: heterogeneous nuclear ribonucleop...    260   2e-80    Camelina sativa [gold-of-pleasure]
emb|CDY36753.1|  BnaA03g11330D                                          259   2e-80    Brassica napus [oilseed rape]
emb|CDY46690.1|  BnaA03g48180D                                          259   2e-80    Brassica napus [oilseed rape]
gb|KHG00059.1|  RNA-binding Musashi                                     259   2e-80    Gossypium arboreum [tree cotton]
ref|XP_006414255.1|  hypothetical protein EUTSA_v10027322mg             258   2e-80    
ref|XP_006283675.1|  hypothetical protein CARUB_v10004740mg             259   3e-80    Capsella rubella
emb|CDY46689.1|  BnaA03g48190D                                          259   3e-80    Brassica napus [oilseed rape]
ref|XP_009137608.1|  PREDICTED: heterogeneous nuclear ribonucleop...    259   4e-80    Brassica rapa
ref|XP_010483006.1|  PREDICTED: heterogeneous nuclear ribonucleop...    259   4e-80    Camelina sativa [gold-of-pleasure]
emb|CDX92807.1|  BnaC07g40650D                                          259   4e-80    
ref|XP_006283676.1|  hypothetical protein CARUB_v10004740mg             259   4e-80    
ref|XP_006283677.1|  hypothetical protein CARUB_v10004740mg             259   4e-80    
ref|XP_010443192.1|  PREDICTED: heterogeneous nuclear ribonucleop...    259   5e-80    
ref|XP_010441434.1|  PREDICTED: heterogeneous nuclear ribonucleop...    258   7e-80    
ref|XP_002869600.1|  RNA recognition motif-containing protein           258   7e-80    
ref|NP_001031725.1|  RNA recognition motif-containing protein           258   8e-80    
dbj|BAH19875.1|  AT4G26650                                              258   9e-80    
ref|NP_567753.1|  RNA recognition motif-containing protein              258   1e-79    
gb|KJB10735.1|  hypothetical protein B456_001G219900                    258   1e-79    
ref|XP_010481301.1|  PREDICTED: heterogeneous nuclear ribonucleop...    256   2e-79    
gb|ACN39853.1|  unknown                                                 258   2e-79    
emb|CAB43861.1|  hnRNP-like protein                                     258   3e-79    
ref|XP_010494999.1|  PREDICTED: heterogeneous nuclear ribonucleop...    256   3e-79    
dbj|BAB09088.1|  RNA-binding protein-like                               255   4e-79    
emb|CDX89316.1|  BnaA01g15770D                                          256   7e-79    
ref|XP_009114263.1|  PREDICTED: heterogeneous nuclear ribonucleop...    255   7e-79    
ref|XP_006280514.1|  hypothetical protein CARUB_v10026451mg             255   7e-79    
gb|AAM63044.1|  RNA-binding protein-like                                255   8e-79    
ref|NP_568685.1|  RNA recognition motif-containing protein              255   8e-79    
ref|XP_006401444.1|  hypothetical protein EUTSA_v10013607mg             253   4e-78    
emb|CDY41059.1|  BnaA09g18380D                                          253   4e-78    
gb|ABD64922.1|  RNA recognition motif. (a.k.a. RRM, RBD, or RNP d...    253   6e-78    
ref|XP_010449765.1|  PREDICTED: heterogeneous nuclear ribonucleop...    252   1e-77    
emb|CDX94301.1|  BnaC01g18830D                                          251   2e-77    
emb|CDY28918.1|  BnaA02g25580D                                          252   5e-77    
ref|XP_003631031.1|  Heterogeneous nuclear ribonucleoprotein A1         251   8e-77    
ref|XP_009101401.1|  PREDICTED: heterogeneous nuclear ribonucleop...    248   2e-76    
emb|CDY25957.1|  BnaC09g20300D                                          252   3e-76    
ref|XP_009142599.1|  PREDICTED: LOW QUALITY PROTEIN: heterogeneou...    248   6e-76    
emb|CDY17719.1|  BnaA06g35380D                                          246   1e-75    
ref|XP_009108304.1|  PREDICTED: heterogeneous nuclear ribonucleop...    246   1e-75    
emb|CDY58169.1|  BnaA08g30250D                                          246   1e-75    
emb|CDY40554.1|  BnaC02g33380D                                          251   2e-75    
emb|CDY50131.1|  BnaCnng18800D                                          244   5e-75    
ref|XP_009108305.1|  PREDICTED: heterogeneous nuclear ribonucleop...    243   5e-75    
ref|XP_009128984.1|  PREDICTED: heterogeneous nuclear ribonucleop...    244   7e-75    
gb|ABD64996.1|  RNA recognition motif. (a.k.a. RRM, RBD, or RNP d...    247   3e-74    
ref|NP_001190485.1|  RNA recognition motif-containing protein           243   7e-74    
gb|ABD64965.1|  hypothetical protein 25.t00002                          241   2e-73    
gb|ADE75708.1|  unknown                                                 239   3e-73    
ref|XP_002963878.1|  hypothetical protein SELMODRAFT_4662               232   5e-73    
emb|CDX77783.1|  BnaC07g20370D                                          239   8e-73    
ref|XP_010538458.1|  PREDICTED: heterogeneous nuclear ribonucleop...    238   2e-72    
ref|XP_002974297.1|  hypothetical protein SELMODRAFT_101375             229   4e-72    
ref|XP_007026294.1|  RNA-binding family protein isoform 4               235   5e-71    
ref|XP_002449904.1|  hypothetical protein SORBIDRAFT_05g025410          235   6e-71    
emb|CBI37165.3|  unnamed protein product                                221   2e-68    
ref|XP_002972014.1|  hypothetical protein SELMODRAFT_172407             219   3e-68    
emb|CBI23698.3|  unnamed protein product                                226   6e-68    
gb|ABR16827.1|  unknown                                                 227   7e-68    
ref|XP_003594255.1|  RNA-binding protein, putative                      226   2e-67    
emb|CAN68016.1|  hypothetical protein VITISV_025150                     226   3e-67    
gb|ABK24693.1|  unknown                                                 226   4e-67    
ref|XP_002285419.1|  PREDICTED: heterogeneous nuclear ribonucleop...    226   4e-67    
ref|XP_010264924.1|  PREDICTED: heterogeneous nuclear ribonucleop...    224   2e-66    
ref|XP_010262417.1|  PREDICTED: heterogeneous nuclear ribonucleop...    224   2e-66    
ref|XP_010934253.1|  PREDICTED: heterogeneous nuclear ribonucleop...    222   9e-66    
ref|XP_012069892.1|  PREDICTED: heterogeneous nuclear ribonucleop...    222   9e-66    
ref|XP_010069110.1|  PREDICTED: heterogeneous nuclear ribonucleop...    221   1e-65    
ref|XP_002274734.1|  PREDICTED: heterogeneous nuclear ribonucleop...    221   1e-65    
ref|XP_008785173.1|  PREDICTED: heterogeneous nuclear ribonucleop...    221   2e-65    
ref|XP_008235616.1|  PREDICTED: heterogeneous nuclear ribonucleop...    219   9e-65    
ref|XP_007199867.1|  hypothetical protein PRUPE_ppa005979mg             218   1e-64    
ref|XP_004289979.1|  PREDICTED: heterogeneous nuclear ribonucleop...    217   3e-64    
gb|KJB28518.1|  hypothetical protein B456_005G053000                    218   4e-64    
ref|XP_002528377.1|  Heterogeneous nuclear ribonucleoprotein 27C,...    218   4e-64    
gb|KHG09558.1|  DAZ-associated protein 1                                217   5e-64    
gb|KJB28507.1|  hypothetical protein B456_005G052700                    217   6e-64    
ref|XP_004151998.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   7e-64    
ref|XP_008447387.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   8e-64    
ref|XP_004495305.1|  PREDICTED: heterogeneous nuclear ribonucleop...    217   8e-64    
ref|XP_003536257.1|  PREDICTED: heterogeneous nuclear ribonucleop...    217   1e-63    
ref|XP_004982907.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   2e-63    
ref|XP_010920312.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   2e-63    
ref|XP_009420757.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   2e-63    
ref|XP_006857465.1|  PREDICTED: heterogeneous nuclear ribonucleop...    216   3e-63    
ref|XP_007035223.1|  RNA-binding family protein isoform 2               216   3e-63    
ref|XP_009369427.1|  PREDICTED: heterogeneous nuclear ribonucleop...    214   3e-63    
ref|XP_004296398.1|  PREDICTED: heterogeneous nuclear ribonucleop...    215   4e-63    
ref|XP_007144122.1|  hypothetical protein PHAVU_007G130600g             215   5e-63    
ref|XP_008802392.1|  PREDICTED: heterogeneous nuclear ribonucleop...    214   7e-63    
ref|XP_010093086.1|  DAZ-associated protein 1                           213   8e-63    
ref|XP_007035222.1|  RNA-binding family protein isoform 1               216   9e-63    
ref|XP_008340642.1|  PREDICTED: heterogeneous nuclear ribonucleop...    214   9e-63    
gb|KHG10024.1|  DAZ-associated 1                                        215   1e-62    
ref|XP_011091262.1|  PREDICTED: heterogeneous nuclear ribonucleop...    212   2e-62    
gb|KEH42685.1|  RNA-binding (RRM/RBD/RNP motif) family protein          214   2e-62    
gb|KDO54113.1|  hypothetical protein CISIN_1g035855mg                   213   2e-62    
ref|XP_006420325.1|  hypothetical protein CICLE_v10004941mg             213   2e-62    
ref|XP_006489648.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   2e-62    
ref|NP_001168878.1|  uncharacterized protein LOC100382683               212   3e-62    
ref|XP_010109739.1|  Uncharacterized RNA-binding protein                212   3e-62    
ref|XP_009358003.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   3e-62    
ref|XP_011091261.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   5e-62    
ref|XP_007222942.1|  hypothetical protein PRUPE_ppa005309mg             212   6e-62    
ref|XP_011029769.1|  PREDICTED: heterogeneous nuclear ribonucleop...    212   6e-62    
ref|XP_009763753.1|  PREDICTED: heterogeneous nuclear ribonucleop...    212   6e-62    
ref|XP_009401201.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   8e-62    
ref|XP_009334212.1|  PREDICTED: heterogeneous nuclear ribonucleop...    212   9e-62    
ref|XP_008224160.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   1e-61    
ref|XP_006356068.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   1e-61    
ref|NP_001146692.1|  uncharacterized protein LOC100280293               211   1e-61    
ref|XP_009336098.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   1e-61    
ref|XP_008351334.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   1e-61    
ref|XP_004247759.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   2e-61    
ref|XP_006354447.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   2e-61    
ref|XP_011041422.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   2e-61    
ref|XP_009625541.1|  PREDICTED: heterogeneous nuclear ribonucleop...    211   2e-61    
gb|KHN48470.1|  RNA-binding protein Musashi like 2                      211   3e-61    
ref|XP_003556346.1|  PREDICTED: heterogeneous nuclear ribonucleop...    210   5e-61    
ref|XP_009405917.1|  PREDICTED: heterogeneous nuclear ribonucleop...    209   8e-61    
ref|XP_008346177.1|  PREDICTED: heterogeneous nuclear ribonucleop...    208   8e-61    
ref|XP_004234048.1|  PREDICTED: heterogeneous nuclear ribonucleop...    208   9e-61    
ref|XP_008372374.1|  PREDICTED: heterogeneous nuclear ribonucleop...    208   1e-60    
ref|XP_011024451.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   1e-60    
ref|XP_012085257.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   1e-60    
gb|KDO60385.1|  hypothetical protein CISIN_1g015040mg                   207   2e-60    
ref|XP_006443770.1|  hypothetical protein CICLE_v10020365mg             207   2e-60    
ref|XP_006378320.1|  hypothetical protein POPTR_0010s07790g             208   2e-60    
ref|XP_006857074.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   6e-60    
ref|XP_008460677.1|  PREDICTED: heterogeneous nuclear ribonucleop...    207   6e-60    
gb|EMS50814.1|  RNA-binding protein Musashi-like protein 1              206   7e-60    
ref|XP_010435156.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   1e-59    
emb|CDY12068.1|  BnaC03g59840D                                          203   1e-59    
tpg|DAA59918.1|  TPA: hypothetical protein ZEAMMB73_017923              204   2e-59    
ref|XP_004147161.1|  PREDICTED: heterogeneous nuclear ribonucleop...    205   3e-59    
ref|XP_010522464.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   3e-59    
ref|XP_010234806.1|  PREDICTED: heterogeneous nuclear ribonucleop...    204   4e-59    
ref|XP_010450068.1|  PREDICTED: heterogeneous nuclear ribonucleop...    203   4e-59    
gb|KGN61572.1|  hypothetical protein Csa_2G171930                       206   8e-59    
dbj|BAK08137.1|  predicted protein                                      203   1e-58    
ref|XP_006414743.1|  hypothetical protein EUTSA_v10025365mg             202   1e-58    
ref|NP_193166.2|  heterogeneous nuclear ribonucleoprotein 1             202   2e-58    
gb|EMT18277.1|  RNA-binding Musashi-2-like protein                      202   2e-58    
ref|XP_002312594.2|  hypothetical protein POPTR_0008s17030g             202   3e-58    
ref|XP_002870323.1|  hypothetical protein ARALYDRAFT_493480             201   3e-58    
ref|XP_009109571.1|  PREDICTED: heterogeneous nuclear ribonucleop...    200   3e-58    
emb|CDX90262.1|  BnaA08g17220D                                          200   4e-58    
ref|XP_006410483.1|  hypothetical protein EUTSA_v10016750mg             200   6e-58    
ref|XP_010473857.1|  PREDICTED: heterogeneous nuclear ribonucleop...    195   9e-58    
emb|CDY67299.1|  BnaCnng54370D                                          199   1e-57    
ref|XP_011083052.1|  PREDICTED: heterogeneous nuclear ribonucleop...    199   1e-57    
emb|CDP03780.1|  unnamed protein product                                199   2e-57    
gb|KFK22119.1|  hypothetical protein AALP_AAs39140U000900               198   3e-57    
ref|XP_006283695.1|  hypothetical protein CARUB_v10004759mg             200   3e-57    
ref|XP_009132928.1|  PREDICTED: heterogeneous nuclear ribonucleop...    198   4e-57    
emb|CDX79527.1|  BnaC03g18630D                                          197   5e-57    
emb|CDX84689.1|  BnaA03g15410D                                          197   5e-57    
emb|CDY17173.1|  BnaA05g10150D                                          197   5e-57    
ref|XP_010273569.1|  PREDICTED: heterogeneous nuclear ribonucleop...    197   6e-57    
ref|XP_009143861.1|  PREDICTED: heterogeneous nuclear ribonucleop...    197   7e-57    
ref|XP_009141312.1|  PREDICTED: heterogeneous nuclear ribonucleop...    195   2e-56    
ref|XP_004247503.1|  PREDICTED: heterogeneous nuclear ribonucleop...    196   2e-56    
ref|XP_010670958.1|  PREDICTED: heterogeneous nuclear ribonucleop...    196   2e-56    
emb|CDO99280.1|  unnamed protein product                                197   3e-56    
ref|XP_010532688.1|  PREDICTED: heterogeneous nuclear ribonucleop...    196   3e-56    
ref|XP_010670957.1|  PREDICTED: heterogeneous nuclear ribonucleop...    195   5e-56    
ref|XP_006358414.1|  PREDICTED: heterogeneous nuclear ribonucleop...    195   5e-56    
ref|XP_010413869.1|  PREDICTED: heterogeneous nuclear ribonucleop...    194   1e-55    
emb|CDY23739.1|  BnaC04g43830D                                          194   1e-55    
ref|NP_180899.1|  RNA recognition motif-containing protein              194   1e-55    
ref|XP_002879449.1|  hypothetical protein ARALYDRAFT_482284             194   2e-55    
ref|XP_006294340.1|  hypothetical protein CARUB_v10023347mg             193   3e-55    
ref|XP_005648241.1|  hypothetical protein COCSUDRAFT_8654               186   3e-55    
ref|XP_010469479.1|  PREDICTED: heterogeneous nuclear ribonucleop...    192   3e-55    
ref|NP_001064824.1|  Os10g0470900                                       194   4e-55    
ref|XP_010509893.1|  PREDICTED: heterogeneous nuclear ribonucleop...    191   1e-54    
ref|XP_008796977.1|  PREDICTED: heterogeneous nuclear ribonucleop...    190   2e-54    
gb|EMT11718.1|  RNA-binding Musashi-Rbp6-like protein                   192   2e-54    
ref|XP_010943641.1|  PREDICTED: heterogeneous nuclear ribonucleop...    189   6e-54    
ref|XP_001773137.1|  predicted protein                                  183   7e-54    
gb|KFK31048.1|  hypothetical protein AALP_AA6G061600                    188   2e-53    
ref|XP_009627212.1|  PREDICTED: heterogeneous nuclear ribonucleop...    188   2e-53    
ref|XP_010941956.1|  PREDICTED: heterogeneous nuclear ribonucleop...    187   2e-53    
ref|XP_008798913.1|  PREDICTED: heterogeneous nuclear ribonucleop...    187   4e-53    
ref|XP_001754422.1|  predicted protein                                  179   1e-52    
gb|KHG26721.1|  RNA-binding Musashi Rbp6                                186   1e-52    
ref|XP_002301858.2|  hypothetical protein POPTR_0002s26030g             186   1e-52    
gb|KJB63984.1|  hypothetical protein B456_010G027900                    186   1e-52    
ref|XP_009788450.1|  PREDICTED: heterogeneous nuclear ribonucleop...    185   2e-52    
ref|XP_001752764.1|  predicted protein                                  179   2e-52    
ref|XP_001690440.1|  hypothetical protein CHLREDRAFT_99772              176   2e-51    
ref|XP_006661850.1|  PREDICTED: heterogeneous nuclear ribonucleop...    183   5e-51    
gb|EAZ40455.1|  hypothetical protein OsJ_24907                          182   6e-51    
ref|XP_002956921.1|  hypothetical protein VOLCADRAFT_107445             182   8e-51    
ref|XP_002968957.1|  hypothetical protein SELMODRAFT_68338              174   8e-51    
ref|XP_002320621.2|  hypothetical protein POPTR_0014s18470g             181   9e-51    
ref|XP_010110137.1|  RNA-binding protein Musashi-Rbp6-like protein      177   2e-50    
ref|XP_005850918.1|  hypothetical protein CHLNCDRAFT_56910              186   3e-50    
ref|XP_008367641.1|  PREDICTED: RNA-binding protein 1-like              177   5e-50    
ref|XP_006369249.1|  hypothetical protein POPTR_0001s20310g             179   6e-50    
ref|XP_006356840.1|  PREDICTED: RNA-binding protein 1-like              177   6e-50    
ref|XP_006385422.1|  hypothetical protein POPTR_0003s04340g             179   6e-50    
ref|XP_011015319.1|  PREDICTED: heterogeneous nuclear ribonucleop...    179   7e-50    
ref|XP_007222501.1|  hypothetical protein PRUPE_ppa008274mg             176   1e-49    
ref|XP_011098412.1|  PREDICTED: heterogeneous nuclear ribonucleop...    177   1e-49    
ref|XP_007018431.1|  RNA-binding family protein, putative               177   2e-49    
ref|XP_009536203.1|  hypothetical protein PHYSODRAFT_526739             170   2e-49    
ref|XP_008393693.1|  PREDICTED: RNA-binding protein 1                   175   3e-49    
ref|XP_009361103.1|  PREDICTED: RNA-binding protein 1                   175   5e-49    
ref|XP_010654539.1|  PREDICTED: heterogeneous nuclear ribonucleop...    175   6e-49    
emb|CDO97901.1|  unnamed protein product                                177   6e-49    
ref|XP_011013661.1|  PREDICTED: heterogeneous nuclear ribonucleop...    176   6e-49    
gb|KIY97025.1|  DAZ-associated protein 1                                175   3e-48    
ref|XP_011072532.1|  PREDICTED: heterogeneous nuclear ribonucleop...    174   4e-48    
ref|XP_006343133.1|  PREDICTED: heterogeneous nuclear ribonucleop...    174   4e-48    
emb|CCA20211.1|  conserved unknown protein putative                     176   4e-48    
ref|XP_004238077.1|  PREDICTED: RNA-binding protein 1                   172   6e-48    
ref|XP_004235586.1|  PREDICTED: heterogeneous nuclear ribonucleop...    173   7e-48    
gb|EYU34189.1|  hypothetical protein MIMGU_mgv1a009771mg                171   9e-48    
gb|EPS58223.1|  hypothetical protein M569_16592                         171   1e-47    
gb|EPS59086.1|  hypothetical protein M569_15724                         167   1e-47    
gb|ESA13276.1|  hypothetical protein GLOINDRAFT_178919                  165   2e-47    
gb|KEQ58883.1|  hypothetical protein M437DRAFT_13410                    166   2e-47    
ref|XP_008220403.1|  PREDICTED: RNA-binding protein Musashi homol...    171   2e-47    
emb|CDP01010.1|  unnamed protein product                                169   2e-47    
ref|XP_005852438.1|  RNA-binding protein Musashi                        167   3e-47    
ref|XP_010537557.1|  PREDICTED: heterogeneous nuclear ribonucleop...    171   4e-47    
ref|XP_012068958.1|  PREDICTED: heterogeneous nuclear ribonucleop...    171   5e-47    
ref|XP_002510051.1|  DAZ-associated protein, putative                   170   6e-47    
ref|XP_004290995.1|  PREDICTED: RNA-binding protein 1-like              169   6e-47    



>ref|XP_006344882.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=475

 Score =   321 bits (823),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MME+DLGK+FIGGISWDTDEE LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+FA+PAV
Sbjct  1    MMETDLGKLFIGGISWDTDEERLKEYFTSYGEVVEAVIMRDRNTGRARGFGFVVFANPAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            AERVV EKH+IDGRTVEAKKAVPRDDQ +INRNN  IQGSPGPGRTKKIFVGGLASTVTE
Sbjct  61   AERVVNEKHIIDGRTVEAKKAVPRDDQQIINRNNSSIQGSPGPGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT
Sbjct  121  SDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  168


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 16/123 (13%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K YF  +G + + V+M D NT R RGFGF+ + ++ AV   + K
Sbjct  108  KIFVGGLASTVTESDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  167

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
              H ++G+ +E K+AVP+D              SPGP R+   F G        N+F N 
Sbjct  168  TFHDLNGKMIEVKRAVPKDL-------------SPGPNRSP--FTGFNYGLGRVNNFLNN  212

Query  574  FDQ  582
            + Q
Sbjct  213  YAQ  215



>ref|XP_004251912.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
Length=475

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MME+DLGK+FIGGISWDTDEE LKEYF SYGEV+EAVIMRDRNTGRARGFGFV+FA+PAV
Sbjct  1    MMETDLGKLFIGGISWDTDEERLKEYFTSYGEVIEAVIMRDRNTGRARGFGFVVFANPAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            AERVV EKH+IDGRTVEAKKAVPRDDQ +INRNN  I GSPGPGRTKKIFVGGLASTVTE
Sbjct  61   AERVVNEKHIIDGRTVEAKKAVPRDDQQIINRNNSSIHGSPGPGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT
Sbjct  121  SDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  168


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 14/100 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K YF  +G + + V+M D NT R RGFGF+ + ++ AV   + K
Sbjct  108  KIFVGGLASTVTESDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  167

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRT  513
              H ++G+ +E K+AVP++              SPGP R+
Sbjct  168  TYHDLNGKMIEVKRAVPKEL-------------SPGPNRS  194



>ref|XP_009765857.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
 ref|XP_009765858.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
 ref|XP_009765859.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
 ref|XP_009765860.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=477

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MMESDLGK+FIGGISWDTDE+ LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+F+DPAV
Sbjct  1    MMESDLGKLFIGGISWDTDEDRLKEYFGSYGEVVEAVIMRDRNTGRARGFGFVVFSDPAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQN-MINRNNGGIQGSPGPGRTKKIFVGGLASTVT  552
            AERVVKEKHMIDGRTVEAKKAVPRDDQ  +INRNN  IQGSPGPGRTKKIFVGGLASTVT
Sbjct  61   AERVVKEKHMIDGRTVEAKKAVPRDDQQIIINRNNSSIQGSPGPGRTKKIFVGGLASTVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            E+DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR LYK
Sbjct  121  ESDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRTLYK  168



>ref|XP_009594583.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Nicotiana tomentosiformis]
Length=481

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +1

Query  190  SRMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADP  369
            + MMESDLGK+FIGGISWDTDE+ LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+F+DP
Sbjct  3    AEMMESDLGKLFIGGISWDTDEDRLKEYFGSYGEVVEAVIMRDRNTGRARGFGFVVFSDP  62

Query  370  AVAERVVKEKHMIDGRTVEAKKAVPRDDQN-MINRNNGGIQGSPGPGRTKKIFVGGLAST  546
            AVAERVV EKHMIDGRTVEAKKAVPRDDQ  +INRNN  IQGSPGPGRTKKIFVGGLAST
Sbjct  63   AVAERVVMEKHMIDGRTVEAKKAVPRDDQQIIINRNNSSIQGSPGPGRTKKIFVGGLAST  122

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            VTE+DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR LYK
Sbjct  123  VTESDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRTLYK  172



>ref|XP_009594584.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009594585.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=477

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MMESDLGK+FIGGISWDTDE+ LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+F+DPAV
Sbjct  1    MMESDLGKLFIGGISWDTDEDRLKEYFGSYGEVVEAVIMRDRNTGRARGFGFVVFSDPAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQN-MINRNNGGIQGSPGPGRTKKIFVGGLASTVT  552
            AERVV EKHMIDGRTVEAKKAVPRDDQ  +INRNN  IQGSPGPGRTKKIFVGGLASTVT
Sbjct  61   AERVVMEKHMIDGRTVEAKKAVPRDDQQIIINRNNSSIQGSPGPGRTKKIFVGGLASTVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            E+DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR LYK
Sbjct  121  ESDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRTLYK  168



>ref|XP_009790873.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Nicotiana sylvestris]
Length=459

 Score =   312 bits (800),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MME+DLGK+FIGGISWDTDEE LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+FA+ AV
Sbjct  1    MMETDLGKLFIGGISWDTDEERLKEYFSSYGEVVEAVIMRDRNTGRARGFGFVVFANHAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            A RVV+EKH+IDGRTVEAKKAVPRDDQ  +NRNN  IQGSPG GRTKKIFVGGLASTVTE
Sbjct  61   AHRVVQEKHIIDGRTVEAKKAVPRDDQQTVNRNNSSIQGSPGSGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT
Sbjct  121  SDFKQYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  168


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 14/100 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ + ++ AV   + K
Sbjct  108  KIFVGGLASTVTESDFKQYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  167

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRT  513
              H ++G+ +E K+AVP++              SPGP R+
Sbjct  168  TFHDLNGKMIEVKRAVPKEM-------------SPGPNRS  194



>ref|XP_009790872.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Nicotiana sylvestris]
Length=464

 Score =   312 bits (800),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MME+DLGK+FIGGISWDTDEE LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+FA+ AV
Sbjct  6    MMETDLGKLFIGGISWDTDEERLKEYFSSYGEVVEAVIMRDRNTGRARGFGFVVFANHAV  65

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            A RVV+EKH+IDGRTVEAKKAVPRDDQ  +NRNN  IQGSPG GRTKKIFVGGLASTVTE
Sbjct  66   AHRVVQEKHIIDGRTVEAKKAVPRDDQQTVNRNNSSIQGSPGSGRTKKIFVGGLASTVTE  125

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT
Sbjct  126  SDFKQYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  173


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 14/100 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ + ++ AV   + K
Sbjct  113  KIFVGGLASTVTESDFKQYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  172

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRT  513
              H ++G+ +E K+AVP++              SPGP R+
Sbjct  173  TFHDLNGKMIEVKRAVPKEM-------------SPGPNRS  199



>ref|XP_006352533.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=471

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MMESDLGK+FIGGISWDTDE+ LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+F DP V
Sbjct  1    MMESDLGKLFIGGISWDTDEDRLKEYFSSYGEVVEAVIMRDRNTGRARGFGFVVFVDPVV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            AERVVKEKHMIDGRTVEAKKAVPRDDQ ++NRNN  IQGSPG GRTKKIFVGGLASTVTE
Sbjct  61   AERVVKEKHMIDGRTVEAKKAVPRDDQQIVNRNNSSIQGSPGGGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+K+
Sbjct  121  SDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRTLFKS  168



>ref|XP_010327197.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Solanum lycopersicum]
Length=485

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +1

Query  190  SRMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADP  369
            + MMESDLGK+F+GGISWDTDE+ LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+FADP
Sbjct  13   AEMMESDLGKLFVGGISWDTDEDRLKEYFSSYGEVVEAVIMRDRNTGRARGFGFVVFADP  72

Query  370  AVAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTV  549
             VAERVVKEKHMIDGRTVEAKKAVPRDDQ +INRNN  IQGSPG GRTKKIFVGGLASTV
Sbjct  73   VVAERVVKEKHMIDGRTVEAKKAVPRDDQQIINRNNSSIQGSPGGGRTKKIFVGGLASTV  132

Query  550  TENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            TE+DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+K
Sbjct  133  TESDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRTLFK  181



>ref|XP_004248330.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Solanum lycopersicum]
Length=471

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MMESDLGK+F+GGISWDTDE+ LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+FADP V
Sbjct  1    MMESDLGKLFVGGISWDTDEDRLKEYFSSYGEVVEAVIMRDRNTGRARGFGFVVFADPVV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            AERVVKEKHMIDGRTVEAKKAVPRDDQ +INRNN  IQGSPG GRTKKIFVGGLASTVTE
Sbjct  61   AERVVKEKHMIDGRTVEAKKAVPRDDQQIINRNNSSIQGSPGGGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+K
Sbjct  121  SDFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRTLFK  167



>ref|XP_011097787.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Sesamum 
indicum]
Length=475

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+EE LKEYF +YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    METDQGKLFIGGISWDTNEERLKEYFGAYGEVVEAVIMRDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKHMIDGRTVEAKKAVPRDDQ++INRN+G IQGSPGPGRTKKIFVGGLASTVTE 
Sbjct  61   ERVVKEKHMIDGRTVEAKKAVPRDDQHLINRNSGSIQGSPGPGRTKKIFVGGLASTVTET  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK+YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKDYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>emb|CBI26733.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   306 bits (785),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDE+ LKEYFR+YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEDRLKEYFRTYGEVVEAVIMRDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMIDGRTVEAKKAVPRDDQ+++NRN G I GSPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDGRTVEAKKAVPRDDQHLLNRNTGSIHGSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTI DVVVMYDHNTQRPRGFGFITYDSE+AV+R L+KT
Sbjct  121  DFKKYFDQFGTINDVVVMYDHNTQRPRGFGFITYDSEEAVERVLHKT  167



>ref|XP_009606206.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606208.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
Length=459

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MME+D+GK+FIGGISWDTDEE LKEYF SYGEVVEAVIMRDRNTGRARGFGFV+FA+ AV
Sbjct  1    MMETDMGKLFIGGISWDTDEERLKEYFSSYGEVVEAVIMRDRNTGRARGFGFVVFANHAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            A RVV+EKH+IDGRTVEAKKAVPRDDQ  INRN+  IQGSPGPGRTKKIFVGGLASTVTE
Sbjct  61   AHRVVQEKHIIDGRTVEAKKAVPRDDQQTINRNSSSIQGSPGPGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT
Sbjct  121  SDFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  168


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 65/123 (53%), Gaps = 16/123 (13%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ + ++ AV   + K
Sbjct  108  KIFVGGLASTVTESDFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  167

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
              H ++G+ +E K+AVP++              SPGP R+   F G        N+F N 
Sbjct  168  TFHDLNGKMIEVKRAVPKEM-------------SPGPNRSP--FNGYNYGLGRANNFLNN  212

Query  574  FDQ  582
            + Q
Sbjct  213  YAQ  215



>ref|XP_002274589.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
Length=478

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDE+ LKEYFR+YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEDRLKEYFRTYGEVVEAVIMRDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMIDGRTVEAKKAVPRDDQ+++NRN G I GSPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDGRTVEAKKAVPRDDQHLLNRNTGSIHGSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTI DVVVMYDHNTQRPRGFGFITYDSE+AV+R L+KT
Sbjct  121  DFKKYFDQFGTINDVVVMYDHNTQRPRGFGFITYDSEEAVERVLHKT  167



>ref|XP_010097281.1| RNA-binding protein Musashi-2-like protein [Morus notabilis]
 gb|EXB67433.1| RNA-binding protein Musashi-2-like protein [Morus notabilis]
Length=487

 Score =   309 bits (791),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V+ +KHMIDGRTVEAKKAVP+DDQ+++NRN GG QGSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   EGVIMDKHMIDGRTVEAKKAVPKDDQHILNRNAGGTQGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>ref|XP_006452507.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 ref|XP_006452508.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 ref|XP_006452509.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 ref|XP_006452510.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 gb|ESR65747.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 gb|ESR65748.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 gb|ESR65749.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
 gb|ESR65750.1| hypothetical protein CICLE_v10008158mg [Citrus clementina]
Length=477

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSRYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQNM+NRN   I  SPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVIMDKHMIDGRTVEAKKAVPRDDQNMLNRNTSSIHSSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>emb|CAN75218.1| hypothetical protein VITISV_003519 [Vitis vinifera]
Length=482

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDE+ LKEYFR+YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEDRLKEYFRTYGEVVEAVIMRDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMIDGRTVEAKKAVPRDDQ+++NRN G I GSPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDGRTVEAKKAVPRDDQHLLNRNTGSIHGSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTI DVVVMYDHNTQRPRGFGFITYDSE+AV+R L+KT
Sbjct  121  DFKKYFDQFGTINDVVVMYDHNTQRPRGFGFITYDSEEAVERVLHKT  167



>ref|XP_006474951.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006474952.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Citrus sinensis]
 ref|XP_006474953.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Citrus sinensis]
 gb|KDO62194.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
 gb|KDO62195.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
Length=477

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSRYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQNM+NRN   I  SPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVIMDKHMIDGRTVEAKKAVPRDDQNMLNRNTSSIHSSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>ref|XP_011095499.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Sesamum 
indicum]
Length=476

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+FIGGISWDT+E+ LKEYF +YG+VVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEVDQGKLFIGGISWDTNEDRLKEYFGAYGKVVEAVIMRDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKHMIDGRTVEAKKAVPRDDQ++INRN+G IQGSPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVKEKHMIDGRTVEAKKAVPRDDQHLINRNSGSIQGSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTI DVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKNYFDQFGTIMDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>emb|CDP13750.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDE+ LKEYFR++GEVVEAVIMRDRNTGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEDRLKEYFRAFGEVVEAVIMRDRNTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGRTVEAKKAVPRDD+++INRN+  IQGSPGPGRTKKIFVGGLASTV E+
Sbjct  61   ERVVMEKHVIDGRTVEAKKAVPRDDKHIINRNSSSIQGSPGPGRTKKIFVGGLASTVNES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKKYFEQFGNITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>ref|XP_002529044.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
 gb|EEF33355.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
Length=478

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQ+++NRN   I GSPGPGRTKKIFVGGLASTVT+N
Sbjct  61   ERVIVDKHMIDGRTVEAKKAVPRDDQHILNRNTSSIHGSPGPGRTKKIFVGGLASTVTDN  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKKYFEQFGNITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>gb|KDO62196.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
 gb|KDO62197.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
 gb|KDO62198.1| hypothetical protein CISIN_1g009920mg [Citrus sinensis]
Length=522

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSRYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQNM+NRN   I  SPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVIMDKHMIDGRTVEAKKAVPRDDQNMLNRNTSSIHSSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>gb|KHG28808.1| RNA-binding Musashi [Gossypium arboreum]
Length=513

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYFR YGEVVEA+IMRDR TGRARGFGF++FADPAVA
Sbjct  38   MESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDRFTGRARGFGFIVFADPAVA  97

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQN++NRN   I  SPGPGRTKKIFVGGLAS+VTE 
Sbjct  98   ERVIMDKHMIDGRTVEAKKAVPRDDQNILNRNMSSITASPGPGRTKKIFVGGLASSVTET  157

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  158  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  204



>ref|XP_007020625.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007020627.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007020628.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY12150.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY12152.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY12153.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=474

 Score =   305 bits (781),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYFR YGEVVEA+IMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDRVTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQ+++NRN   I GSPGPGRTKKIFVGGLASTVTE 
Sbjct  61   ERVIMDKHMIDGRTVEAKKAVPRDDQHILNRNVSSITGSPGPGRTKKIFVGGLASTVTEG  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG+ITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKKYFDQFGSITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>ref|XP_007020630.1| RNA-binding family protein isoform 6 [Theobroma cacao]
 gb|EOY12155.1| RNA-binding family protein isoform 6 [Theobroma cacao]
Length=481

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYFR YGEVVEA+IMRDR TGRARGFGFV+FADPAVA
Sbjct  8    MESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDRVTGRARGFGFVVFADPAVA  67

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQ+++NRN   I GSPGPGRTKKIFVGGLASTVTE 
Sbjct  68   ERVIMDKHMIDGRTVEAKKAVPRDDQHILNRNVSSITGSPGPGRTKKIFVGGLASTVTEG  127

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG+ITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  128  DFKKYFDQFGSITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  174



>ref|XP_007020626.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 ref|XP_007020629.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY12151.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY12154.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=472

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYFR YGEVVEA+IMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDRVTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQ+++NRN   I GSPGPGRTKKIFVGGLASTVTE 
Sbjct  61   ERVIMDKHMIDGRTVEAKKAVPRDDQHILNRNVSSITGSPGPGRTKKIFVGGLASTVTEG  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG+ITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKKYFDQFGSITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>ref|XP_012070961.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Jatropha curcas]
Length=486

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  178  LPDFSRMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVI  357
            + D  + MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+
Sbjct  1    MGDLQKKMESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDRTTGRARGFGFVV  60

Query  358  FADPAVAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGL  537
            FADPAVAERV+ +KHMIDGRTVEAKKAVPRDDQ+++NRN   I GSPGPGRTKKIFVGGL
Sbjct  61   FADPAVAERVIMDKHMIDGRTVEAKKAVPRDDQHILNRNTSNIHGSPGPGRTKKIFVGGL  120

Query  538  ASTVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            ASTVT++DFK YF+QFG I DVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  ASTVTDSDFKKYFEQFGNINDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  174


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 18/124 (15%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    +   K+YF  +G + + V+M D NT R RGFGF+ +      +RV+ K
Sbjct  114  KIFVGGLASTVTDSDFKKYFEQFGNINDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHK  173

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKI-FVGGLASTVTENDFKN  570
              H ++G+ VE K+AVP++              SPGP R+  I +  GL+ T   N+F N
Sbjct  174  TFHELNGKMVEVKRAVPKEL-------------SPGPNRSPLIGYNYGLSRT---NNFLN  217

Query  571  YFDQ  582
             + Q
Sbjct  218  AYAQ  221



>gb|KJB13815.1| hypothetical protein B456_002G095900 [Gossypium raimondii]
Length=476

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYFR YGEVVEA+IMRDR TGRARGFGF++FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDRFTGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQN++NRN   I  SP PGRTKKIFVGGLAS+VTE 
Sbjct  61   ERVIMDKHMIDGRTVEAKKAVPRDDQNILNRNMSSITASPVPGRTKKIFVGGLASSVTET  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>gb|KJB13816.1| hypothetical protein B456_002G095900 [Gossypium raimondii]
 gb|KJB13817.1| hypothetical protein B456_002G095900 [Gossypium raimondii]
Length=480

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYFR YGEVVEA+IMRDR TGRARGFGF++FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAMIMRDRFTGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQN++NRN   I  SP PGRTKKIFVGGLAS+VTE 
Sbjct  61   ERVIMDKHMIDGRTVEAKKAVPRDDQNILNRNMSSITASPVPGRTKKIFVGGLASSVTET  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167



>ref|XP_009380127.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+E+ L+EYF +YGEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEDRLREYFSNYGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGR VEAKKAVPRDDQ ++NRNN  I GSPGPGRTKKIFVGGL ST+TE+
Sbjct  61   ERVVMEKHLIDGRMVEAKKAVPRDDQQILNRNNSSIHGSPGPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L+K+
Sbjct  121  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLFKS  167



>ref|XP_012070962.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Jatropha curcas]
Length=482

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  193  RMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPA  372
            + MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FADPA
Sbjct  2    KKMESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDRTTGRARGFGFVVFADPA  61

Query  373  VAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVT  552
            VAERV+ +KHMIDGRTVEAKKAVPRDDQ+++NRN   I GSPGPGRTKKIFVGGLASTVT
Sbjct  62   VAERVIMDKHMIDGRTVEAKKAVPRDDQHILNRNTSNIHGSPGPGRTKKIFVGGLASTVT  121

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            ++DFK YF+QFG I DVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  122  DSDFKKYFEQFGNINDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  170


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 18/124 (15%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    +   K+YF  +G + + V+M D NT R RGFGF+ +      +RV+ K
Sbjct  110  KIFVGGLASTVTDSDFKKYFEQFGNINDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHK  169

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKI-FVGGLASTVTENDFKN  570
              H ++G+ VE K+AVP++              SPGP R+  I +  GL+ T   N+F N
Sbjct  170  TFHELNGKMVEVKRAVPKEL-------------SPGPNRSPLIGYNYGLSRT---NNFLN  213

Query  571  YFDQ  582
             + Q
Sbjct  214  AYAQ  217



>ref|XP_003600251.1| Heterogeneous nuclear ribonucleoprotein A1 [Medicago truncatula]
 gb|AES70502.1| heterogeneous nuclear ribonucleoprotein 27C, putative [Medicago 
truncatula]
Length=481

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF +YGEV+EAVIMRDR TGRARGFGFV+F+DPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFATYGEVIEAVIMRDRATGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR  G +QGSPGPGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIIDKHIIDGRTVEAKKAVPRDDQQNINRQTGSVQGSPGPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKMYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_012070963.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X3 [Jatropha curcas]
 gb|KDP39233.1| hypothetical protein JCGZ_00990 [Jatropha curcas]
Length=479

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGRTVEAKKAVPRDDQ+++NRN   I GSPGPGRTKKIFVGGLASTVT++
Sbjct  61   ERVIMDKHMIDGRTVEAKKAVPRDDQHILNRNTSNIHGSPGPGRTKKIFVGGLASTVTDS  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFG I DVVVMYDHNTQRPRGFGFITYDSEDAVDR L+KT
Sbjct  121  DFKKYFEQFGNINDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHKT  167


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 18/124 (15%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    +   K+YF  +G + + V+M D NT R RGFGF+ +      +RV+ K
Sbjct  107  KIFVGGLASTVTDSDFKKYFEQFGNINDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHK  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKI-FVGGLASTVTENDFKN  570
              H ++G+ VE K+AVP++              SPGP R+  I +  GL+ T   N+F N
Sbjct  167  TFHELNGKMVEVKRAVPKEL-------------SPGPNRSPLIGYNYGLSRT---NNFLN  210

Query  571  YFDQ  582
             + Q
Sbjct  211  AYAQ  214



>gb|KEH33977.1| heterogeneous nuclear ribonucleoprotein 27C, putative [Medicago 
truncatula]
Length=478

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF +YGEV+EAVIMRDR TGRARGFGFV+F+DPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFATYGEVIEAVIMRDRATGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR  G +QGSPGPGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIIDKHIIDGRTVEAKKAVPRDDQQNINRQTGSVQGSPGPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKMYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_010675870.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Beta vulgaris 
subsp. vulgaris]
Length=473

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDE  LKEYF  YGEVVEAVIMRDR TGRARGFGF++FADP VA
Sbjct  1    MESDLGKLFIGGISWDTDESRLKEYFGQYGEVVEAVIMRDRITGRARGFGFIVFADPVVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMIDGRTVEAKKAVPRDDQ +++RNN  IQGSPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDGRTVEAKKAVPRDDQQILSRNNNIIQGSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L++T
Sbjct  121  DFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHRT  167



>ref|XP_010252687.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Nelumbo 
nucifera]
Length=477

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDT+E+ LKEYF+SYGEVVEAVIM+DR TGRARGFGFV+FADP VA
Sbjct  1    MESDLGKLFIGGISWDTNEDRLKEYFKSYGEVVEAVIMKDRTTGRARGFGFVVFADPTVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH IDGRTVEAKKAVPRDDQ+++NRNN  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHTIDGRTVEAKKAVPRDDQHILNRNNASIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAV++ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVEKVLVKT  167



>ref|XP_006575702.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Glycine max]
Length=481

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +1

Query  187  FSRMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFAD  366
             + +MESDLGK+FIGGISWDTD+E LKEYF  YGEV+EAVIMRDR TGRARGFGFV+FAD
Sbjct  1    MTELMESDLGKLFIGGISWDTDDERLKEYFGKYGEVIEAVIMRDRTTGRARGFGFVVFAD  60

Query  367  PAVAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLAST  546
            P+ AERV+ +KH+IDGRTVEAKKAVPRDDQ  INR  G I GSP PGRTKKIFVGGL ST
Sbjct  61   PSAAERVIMDKHIIDGRTVEAKKAVPRDDQQTINRQTGSIHGSPSPGRTKKIFVGGLPST  120

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +TE+DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  ITESDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  171



>ref|XP_010270160.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Nelumbo nucifera]
Length=480

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDT+E+ LKEYF+SYGEVVEAVIM+DR TGRARGFGFV+FADP VA
Sbjct  1    MESDLGKLFIGGISWDTNEDRLKEYFKSYGEVVEAVIMKDRTTGRARGFGFVVFADPTVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH IDGRTVEAKKAVPRDDQ+++NRNN  + GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHTIDGRTVEAKKAVPRDDQHILNRNNSSVHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  167



>ref|XP_010270159.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Nelumbo nucifera]
Length=484

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDT+E+ LKEYF+SYGEVVEAVIM+DR TGRARGFGFV+FADP VA
Sbjct  5    MESDLGKLFIGGISWDTNEDRLKEYFKSYGEVVEAVIMKDRTTGRARGFGFVVFADPTVA  64

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH IDGRTVEAKKAVPRDDQ+++NRNN  + GSPGP RTKKIFVGGLASTVTE+
Sbjct  65   ERVVMEKHTIDGRTVEAKKAVPRDDQHILNRNNSSVHGSPGPARTKKIFVGGLASTVTES  124

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  125  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  171



>ref|XP_007142373.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
 gb|ESW14367.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
Length=490

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = +1

Query  190  SRMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADP  369
            +  MESDLGK+FIGGISWDTDEE L+EYF  YGEV+EAVIMRDR TGRARGFGFV+F+DP
Sbjct  9    AEQMESDLGKLFIGGISWDTDEERLREYFGKYGEVIEAVIMRDRTTGRARGFGFVVFSDP  68

Query  370  AVAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNN-GGIQGSPGPGRTKKIFVGGLAST  546
             VAERV+ +KH+IDGRTVEAKKAVPRDDQ  +NR   GGIQGSPGPGRTKKIFVGGL ST
Sbjct  69   VVAERVIMDKHIIDGRTVEAKKAVPRDDQITVNRQQTGGIQGSPGPGRTKKIFVGGLPST  128

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +TE+DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  129  ITESDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  179



>ref|XP_002320502.2| hypothetical protein POPTR_0014s15970g [Populus trichocarpa]
 gb|EEE98817.2| hypothetical protein POPTR_0014s15970g [Populus trichocarpa]
Length=479

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDTDEE LK YFRS+GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTDEERLKGYFRSFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGG-IQGSPGPGRTKKIFVGGLASTVTE  555
            ERV+KEKH IDGR VEAKKAVPRDDQN++NRN+GG I  SPGPGRTKKIFVGGLASTVTE
Sbjct  61   ERVIKEKHSIDGRMVEAKKAVPRDDQNILNRNSGGSIHSSPGPGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            NDFKNYFDQFGTI DVVVMYDHNTQRPRGFGFIT+DSE+AVD+ L +T
Sbjct  121  NDFKNYFDQFGTIIDVVVMYDHNTQRPRGFGFITFDSEEAVDKVLMRT  168



>ref|XP_007142374.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
 ref|XP_007142375.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
 gb|ESW14368.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
 gb|ESW14369.1| hypothetical protein PHAVU_008G274900g [Phaseolus vulgaris]
Length=479

 Score =   298 bits (762),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L+EYF  YGEV+EAVIMRDR TGRARGFGFV+F+DP VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLREYFGKYGEVIEAVIMRDRTTGRARGFGFVVFSDPVVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNN-GGIQGSPGPGRTKKIFVGGLASTVTE  555
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  +NR   GGIQGSPGPGRTKKIFVGGL ST+TE
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQITVNRQQTGGIQGSPGPGRTKKIFVGGLPSTITE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  SDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  168



>ref|XP_003519614.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
 gb|KHN43866.1| RNA-binding protein Musashi like Rbp6 [Glycine soja]
Length=477

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTD+E LKEYF  YGEV+EAVIMRDR TGRARGFGFV+FADP+ A
Sbjct  1    MESDLGKLFIGGISWDTDDERLKEYFGKYGEVIEAVIMRDRTTGRARGFGFVVFADPSAA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR  G I GSP PGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQTINRQTGSIHGSPSPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_008449079.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
 ref|XP_008449080.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
 ref|XP_008449082.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
 ref|XP_008449083.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
Length=480

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L+EYF  YGEVVEAVIMRDR TGRARGFGFV+FADP VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLREYFGQYGEVVEAVIMRDRTTGRARGFGFVVFADPGVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVP+DDQNM+NRN+G I GSPG GRTKKIFVGGLASTVTE 
Sbjct  61   ERVILDKHVIDGRTVEAKKAVPKDDQNMLNRNSGSIHGSPGSGRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YFDQFGTITDVVVMYDH+TQRPRGFGFITYDSE+ VDR L+KT
Sbjct  121  DFQKYFDQFGTITDVVVMYDHSTQRPRGFGFITYDSEECVDRVLHKT  167


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 14/103 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    E   ++YF  +G + + V+M D +T R RGFGF+ +      +RV+ K
Sbjct  107  KIFVGGLASTVTEADFQKYFDQFGTITDVVVMYDHSTQRPRGFGFITYDSEECVDRVLHK  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKI  522
              H ++G+ VE K+A+P++              +PGP R+  +
Sbjct  167  TFHELNGKMVEVKRAIPKEL-------------TPGPNRSPLV  196



>ref|XP_009404108.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404109.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=477

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+E+ L+EYFR+YGEVVEAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEDRLREYFRNYGEVVEAVIMKDRTTGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGP-GRTKKIFVGGLASTVTE  555
            ERVV EKH+IDGR VEAKKAVPRDDQ ++NRNN  + GSPGP GRTKKIFVGGL ST+TE
Sbjct  61   ERVVMEKHLIDGRMVEAKKAVPRDDQQILNRNNSSVHGSPGPGGRTKKIFVGGLPSTLTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+K+
Sbjct  121  SDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLFKS  168



>ref|XP_002300356.2| hypothetical protein POPTR_0001s37230g [Populus trichocarpa]
 gb|EEE85161.2| hypothetical protein POPTR_0001s37230g [Populus trichocarpa]
Length=484

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FADP VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDRVTGRARGFGFVVFADPIVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH++DGRTVEAKKAVPRDDQ++++RN   I GSPGPGRTKKIFVGGLASTVTEN
Sbjct  61   ERVIMEKHVVDGRTVEAKKAVPRDDQHILSRNTSSIHGSPGPGRTKKIFVGGLASTVTEN  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFG ITDVVVMYDHNT RPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFKKYFEQFGIITDVVVMYDHNTLRPRGFGFITYDSEEAVDRVLHKT  167



>gb|KHN23872.1| RNA-binding protein Musashi like Rbp6 [Glycine soja]
Length=478

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTD+E LKEYF  YGEV+EAVIMRDR TGRARGFGFV+FADP+ A
Sbjct  1    MESDLGKLFIGGISWDTDDERLKEYFGKYGEVIEAVIMRDRTTGRARGFGFVVFADPSAA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR +G I GSP PGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQTINRQSGSIHGSPSPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTI DVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKKYFDQFGTIADVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_003544715.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
 ref|XP_006595704.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Glycine max]
Length=478

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTD+E LKEYF  YGEV+EAVIMRDR TGRARGFGFV+FADP+ A
Sbjct  1    MESDLGKLFIGGISWDTDDERLKEYFGKYGEVIEAVIMRDRTTGRARGFGFVVFADPSAA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR +G I GSP PGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQTINRQSGSIHGSPSPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTI DVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKKYFDQFGTIADVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_011003504.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011003505.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011003506.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011003507.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=482

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDTDEE LK YF+S+GEVVEAVIM+DR TGRARGFGFV+FADPA+A
Sbjct  1    MQSDNGKLFIGGISWDTDEERLKGYFQSFGEVVEAVIMKDRTTGRARGFGFVVFADPAIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGG-IQGSPGPGRTKKIFVGGLASTVTE  555
            ERV+KEKH IDGR VEAKKAVPRDDQN++NRN+ G I  SPGPGRTKKIFVGGLASTVTE
Sbjct  61   ERVIKEKHSIDGRMVEAKKAVPRDDQNILNRNSAGSIHSSPGPGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            NDFKNYFDQFGTI DVVVMYDHNTQRPRGFGFITYDSE+AVD+ L +T
Sbjct  121  NDFKNYFDQFGTIIDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLMRT  168



>ref|XP_004294459.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Fragaria 
vesca subsp. vesca]
Length=472

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME DLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDLGKIFIGGISWDTDEEQLKEYFNKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RVVK+KHMID RTVEAKKAVP++DQ+++NR  G    SPGPGRT+KIFVGGLASTVTEN
Sbjct  61   DRVVKDKHMIDSRTVEAKKAVPKEDQHILNR-TGSAHSSPGPGRTRKIFVGGLASTVTEN  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  120  DFKTYFDQFGTVTDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  166



>gb|KHN43809.1| RNA-binding protein Musashi like Rbp6 [Glycine soja]
Length=502

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEV+EAVIMRDR TGRARGFGFV+FADP+VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGEVIEAVIMRDRVTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR +G    SPGPGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQNINRQSGSAHASPGPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_007142507.1| hypothetical protein PHAVU_008G286500g [Phaseolus vulgaris]
 gb|ESW14501.1| hypothetical protein PHAVU_008G286500g [Phaseolus vulgaris]
Length=479

 Score =   295 bits (755),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE L+EYF +YGEVVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLREYFSTYGEVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V+KEKH IDGR VEAKKAVPRDDQN++NRN+G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   EIVIKEKHNIDGRMVEAKKAVPRDDQNILNRNSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>emb|CBI28407.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   292 bits (748),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+E+ LK+YF +YGEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEDRLKDYFSNYGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+KEKH IDGR VEAKKAVP+DDQ++++RN+G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   ERVIKEKHNIDGRMVEAKKAVPKDDQSILSRNSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG ITDVVVMYDHNTQRPRGFGFITY+SE+AVD+ L KT
Sbjct  121  DFKKYFDQFGAITDVVVMYDHNTQRPRGFGFITYESEEAVDKVLLKT  167



>ref|XP_008227101.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
 ref|XP_008227102.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
Length=473

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME DLGK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMID RTVEAKKAVP++DQN++NR  G   GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   ERVIMDKHMIDCRTVEAKKAVPKEDQNILNR-TGVAHGSPGPGRTRKIFVGGLASTVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  120  DFKKYFDQFGTVTDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  166



>ref|XP_008798476.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Phoenix 
dactylifera]
 ref|XP_008798477.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Phoenix 
dactylifera]
Length=478

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDT+E+ L+EYF S+G+VVEAVIM+DRNTGRARGFGFV+FADP VA
Sbjct  1    MESDLGKLFIGGISWDTNEDRLREYFESFGDVVEAVIMKDRNTGRARGFGFVVFADPGVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKHMIDGR VEAKKAVPRDDQ+++ RN+    GSP PGRTKKIFVGGLAS+VTE 
Sbjct  61   ERVVKEKHMIDGRMVEAKKAVPRDDQHILKRNSTNAHGSPAPGRTKKIFVGGLASSVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFIT+DSEDAVD+ L KT
Sbjct  121  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITFDSEDAVDKVLVKT  167


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K YF  +G + + V+M D NT R RGFGF+ F ++ AV + +VK
Sbjct  107  KIFVGGLASSVTEADFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITFDSEDAVDKVLVK  166

Query  394  EKHMIDGRTVEAKKAVPRD  450
              H ++G+ VE KKAVP++
Sbjct  167  TFHELNGKMVEVKKAVPKE  185



>ref|XP_007212015.1| hypothetical protein PRUPE_ppa004834mg [Prunus persica]
 gb|EMJ13214.1| hypothetical protein PRUPE_ppa004834mg [Prunus persica]
Length=476

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME DLGK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMID RTVEAKKAVP++DQN++NR  G   GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   ERVIMDKHMIDCRTVEAKKAVPKEDQNILNR-TGVAHGSPGPGRTRKIFVGGLASTVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  120  DFKKYFDQFGTVTDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  166



>ref|XP_011007622.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Populus euphratica]
Length=481

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF +YGEVVEAVIMRDR TGRARGFGFV+FADP VA
Sbjct  4    MESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDRVTGRARGFGFVVFADPIVA  63

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH++DGRTVEAKKAVPRDDQ++++RN   I GSPGPGRTKKIFVGGLASTVTEN
Sbjct  64   ERVIMEKHVVDGRTVEAKKAVPRDDQHILSRNISNIHGSPGPGRTKKIFVGGLASTVTEN  123

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+Q+G ITDVVVMYDHNT RPRGFGFITYDSE+AVDR L+KT
Sbjct  124  DFKKYFEQYGIITDVVVMYDHNTLRPRGFGFITYDSEEAVDRVLHKT  170



>ref|XP_011007619.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Populus euphratica]
Length=485

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF +YGEVVEAVIMRDR TGRARGFGFV+FADP VA
Sbjct  4    MESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDRVTGRARGFGFVVFADPIVA  63

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH++DGRTVEAKKAVPRDDQ++++RN   I GSPGPGRTKKIFVGGLASTVTEN
Sbjct  64   ERVIMEKHVVDGRTVEAKKAVPRDDQHILSRNISNIHGSPGPGRTKKIFVGGLASTVTEN  123

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+Q+G ITDVVVMYDHNT RPRGFGFITYDSE+AVDR L+KT
Sbjct  124  DFKKYFEQYGIITDVVVMYDHNTLRPRGFGFITYDSEEAVDRVLHKT  170



>ref|XP_003551514.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
Length=479

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LK+YF  YGEV+EAVIMRDR TGRARGFGFV+FADP+VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKDYFGKYGEVIEAVIMRDRVTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR +G    SPGPGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQNINRQSGSAHASPGPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKMYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_011007620.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Populus euphratica]
 ref|XP_011007621.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Populus euphratica]
Length=482

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF +YGEVVEAVIMRDR TGRARGFGFV+FADP VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDRVTGRARGFGFVVFADPIVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH++DGRTVEAKKAVPRDDQ++++RN   I GSPGPGRTKKIFVGGLASTVTEN
Sbjct  61   ERVIMEKHVVDGRTVEAKKAVPRDDQHILSRNISNIHGSPGPGRTKKIFVGGLASTVTEN  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+Q+G ITDVVVMYDHNT RPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFKKYFEQYGIITDVVVMYDHNTLRPRGFGFITYDSEEAVDRVLHKT  167



>ref|XP_007212016.1| hypothetical protein PRUPE_ppa004834mg [Prunus persica]
 gb|EMJ13215.1| hypothetical protein PRUPE_ppa004834mg [Prunus persica]
Length=489

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME DLGK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDLGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMID RTVEAKKAVP++DQN++NR  G   GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   ERVIMDKHMIDCRTVEAKKAVPKEDQNILNR-TGVAHGSPGPGRTRKIFVGGLASTVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  120  DFKKYFDQFGTVTDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  166



>ref|XP_004506674.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cicer 
arietinum]
Length=481

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEV+EAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFVKYGEVIEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  +NR  G    SPG GRTKKIFVGGL ST+TE+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQNVNRQTGSAHASPGAGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKMYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_002272993.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
 ref|XP_010657420.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Vitis vinifera]
Length=478

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+E+ LK+YF +YGEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEDRLKDYFSNYGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+KEKH IDGR VEAKKAVP+DDQ++++RN+G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   ERVIKEKHNIDGRMVEAKKAVPKDDQSILSRNSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG ITDVVVMYDHNTQRPRGFGFITY+SE+AVD+ L KT
Sbjct  121  DFKKYFDQFGAITDVVVMYDHNTQRPRGFGFITYESEEAVDKVLLKT  167



>ref|XP_004149577.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Cucumis 
sativus]
 gb|KGN56055.1| hypothetical protein Csa_3G062570 [Cucumis sativus]
Length=480

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L+EYF  YGEVVEAVIMRDR TGRARGFGFV+FADP VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLREYFGHYGEVVEAVIMRDRTTGRARGFGFVVFADPGVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVP+DDQNM+NR++G I GSP  GRTKKIFVGGLASTVTE 
Sbjct  61   ERVILDKHVIDGRTVEAKKAVPKDDQNMLNRSSGSIHGSPSSGRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YFDQFGTITDVVVMYDH+TQRPRGFGFITYDSE+ VDR L+KT
Sbjct  121  DFQKYFDQFGTITDVVVMYDHSTQRPRGFGFITYDSEECVDRVLHKT  167


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 14/103 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    E   ++YF  +G + + V+M D +T R RGFGF+ +      +RV+ K
Sbjct  107  KIFVGGLASTVTEADFQKYFDQFGTITDVVVMYDHSTQRPRGFGFITYDSEECVDRVLHK  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKI  522
              H ++G+ VE K+A+P++              +PGP R+  +
Sbjct  167  TFHELNGKMVEVKRAIPKEL-------------TPGPNRSPLV  196



>ref|XP_002301585.1| heterogeneous nuclear ribonucleoprotein [Populus trichocarpa]
 gb|EEE80858.1| heterogeneous nuclear ribonucleoprotein [Populus trichocarpa]
Length=479

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LK+YF+S+GEVVEAVIM+DR TGRARGFGFV+F+DP++A
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKDYFQSFGEVVEAVIMKDRTTGRARGFGFVVFSDPSIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGG-IQGSPGPGRTKKIFVGGLASTVTE  555
            ERV+KEKH IDGR VEAKKAVPRDDQNM++RN+GG I GSPGPGRTKKIFVGGLASTVTE
Sbjct  61   ERVIKEKHSIDGRMVEAKKAVPRDDQNMLSRNSGGSIHGSPGPGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DF+ YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  SDFRKYFDQFGLITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLMKT  168



>ref|XP_006447738.1| hypothetical protein CICLE_v10015084mg [Citrus clementina]
 ref|XP_006469525.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR60978.1| hypothetical protein CICLE_v10015084mg [Citrus clementina]
Length=481

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF +YGEVVEAVIM+DRNTGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSTYGEVVEAVIMKDRNTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V++EKH IDGR VEAKKAVPRDDQ ++NR++G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   EIVIQEKHNIDGRMVEAKKAVPRDDQIVLNRSSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>ref|XP_007026291.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 ref|XP_007026292.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY28913.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY28914.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=476

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L+EYF+++G+VVEAVIMRDR TGRARGFGFV+FADPA+A
Sbjct  1    MEMELGKLFIGGISWDTNEDRLREYFQAFGDVVEAVIMRDRATGRARGFGFVVFADPAIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKHMIDGRTVEAKKAVPRDDQN++N++N  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHMIDGRTVEAKKAVPRDDQNILNKSNVSIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L +T
Sbjct  121  DFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLQRT  167


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 72/147 (49%), Gaps = 29/147 (20%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVKE  396
            K+F+GG++    E   K YF  +G + + V+M D NT R RGFGF+ +      ++V++ 
Sbjct  107  KIFVGGLASTVTESDFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLQR  166

Query  397  K-HMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE-NDFKN  570
              H ++G+ VE K+AVP++              SPGP R +   +GG    ++  N F N
Sbjct  167  TFHELNGKMVEVKRAVPKES-------------SPGPSRNQ---LGGYNFGLSRVNSFLN  210

Query  571  YFDQFGTITDVVVMYDHNTQRPRGFGF  651
             +           M  +NT    G+GF
Sbjct  211  GY-----------MQGYNTSSVGGYGF  226



>ref|XP_006595660.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Glycine 
max]
Length=479

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE L+EYF +YGEVVEAVIM+DR TGRARGFGFV+F+DPA+A
Sbjct  1    MQSDNGKLFIGGISWDTNEERLREYFSTYGEVVEAVIMKDRTTGRARGFGFVVFSDPAIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V+KEKH IDGR VEAKKAVPRDDQN+++RN+G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   EIVIKEKHNIDGRMVEAKKAVPRDDQNILSRNSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>gb|KHN43959.1| DAZ-associated protein 1 [Glycine soja]
Length=479

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE L+EYF +YGEVVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLREYFCTYGEVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V+KEKH IDGR VEAKKAVPRDDQN+++RN+G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   EIVIKEKHNIDGRMVEAKKAVPRDDQNILSRNSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>ref|XP_006836782.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Amborella 
trichopoda]
 gb|ERM99635.1| hypothetical protein AMTR_s00088p00174110 [Amborella trichopoda]
Length=472

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESD+GK+FIGGISW+T+E+ LKEYF++YGE+VEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MESDMGKLFIGGISWETNEDRLKEYFKTYGEIVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RVV EKH IDGRTVEAKKAVPRDDQ ++NRN+  I GSP P RTKKIFVGGLASTVTEN
Sbjct  61   DRVVLEKHTIDGRTVEAKKAVPRDDQQILNRNSNSIHGSPSPARTKKIFVGGLASTVTEN  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L +T
Sbjct  121  DFRKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLET  167


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 59/99 (60%), Gaps = 14/99 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   ++YF  +G + + V+M D NT R RGFGF+ + ++ AV + +++
Sbjct  107  KIFVGGLASTVTENDFRKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLE  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGR  510
              H ++G+TVE K+AVP++              SPGP R
Sbjct  167  TYHKLNGKTVEVKRAVPKEL-------------SPGPSR  192



>ref|XP_010557695.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Tarenaya 
hassleriana]
Length=467

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 158/170 (93%), Gaps = 3/170 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EECLKEYF ++GEVVEAVIM+DRNTGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEECLKEYFSNFGEVVEAVIMKDRNTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRN-NGGIQGSPG--PGRTKKIFVGGLASTV  549
            ERV+KEKH I+GR VEAKKAVPRDDQN+INR+ N   QGSPG  PGRT+KIFVGGLAS+V
Sbjct  61   ERVIKEKHNINGRMVEAKKAVPRDDQNIINRSANSSSQGSPGPCPGRTRKIFVGGLASSV  120

Query  550  TENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            TE+DF+NYF+QFGTITDVVVMYD NTQRPRGFGFITYDSE+AVD+AL KT
Sbjct  121  TESDFRNYFEQFGTITDVVVMYDQNTQRPRGFGFITYDSEEAVDKALLKT  170



>ref|XP_007026295.1| RNA-binding family protein isoform 5 [Theobroma cacao]
 gb|EOY28917.1| RNA-binding family protein isoform 5 [Theobroma cacao]
Length=482

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L+EYF+++G+VVEAVIMRDR TGRARGFGFV+FADPA+A
Sbjct  1    MEMELGKLFIGGISWDTNEDRLREYFQAFGDVVEAVIMRDRATGRARGFGFVVFADPAIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKHMIDGRTVEAKKAVPRDDQN++N++N  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHMIDGRTVEAKKAVPRDDQNILNKSNVSIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L +T
Sbjct  121  DFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLQRT  167


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 72/147 (49%), Gaps = 29/147 (20%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVKE  396
            K+F+GG++    E   K YF  +G + + V+M D NT R RGFGF+ +      ++V++ 
Sbjct  107  KIFVGGLASTVTESDFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLQR  166

Query  397  K-HMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE-NDFKN  570
              H ++G+ VE K+AVP++              SPGP R +   +GG    ++  N F N
Sbjct  167  TFHELNGKMVEVKRAVPKES-------------SPGPSRNQ---LGGYNFGLSRVNSFLN  210

Query  571  YFDQFGTITDVVVMYDHNTQRPRGFGF  651
             +           M  +NT    G+GF
Sbjct  211  GY-----------MQGYNTSSVGGYGF  226



>ref|XP_006586118.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
Length=479

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEV+E VIMRDR TGRARGFGFV+F DP+VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGEVIETVIMRDRVTGRARGFGFVVFGDPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR +G    SPGPGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQNINRQSGSAHVSPGPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_006363028.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006363029.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006363030.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Solanum tuberosum]
Length=472

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+EE LKEYF +YGEV+EAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDRTTGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RV+KEKH IDGR VEAKKAVPRDDQ+ I+R++  IQGSPGPGRT+KIFVGGLASTVTE 
Sbjct  61   DRVIKEKHNIDGRMVEAKKAVPRDDQSTISRSSPSIQGSPGPGRTRKIFVGGLASTVTET  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L K
Sbjct  121  DFKEYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLK  166



>ref|XP_004243541.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
 ref|XP_010323871.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
 ref|XP_010323872.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
Length=472

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+EE LKEYF +YGEV+EAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDRTTGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RV+KEKH IDGR VEAKKAVPRDDQ+ I+R++  IQGSPGPGRT+KIFVGGLASTVTE 
Sbjct  61   DRVIKEKHNIDGRMVEAKKAVPRDDQSTISRSSPSIQGSPGPGRTRKIFVGGLASTVTET  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L K
Sbjct  121  DFKEYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLK  166



>ref|XP_003519672.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Glycine max]
 ref|XP_006575746.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Glycine max]
Length=475

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE L+EYF +YGEVVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLREYFCTYGEVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V+KEKH IDGR VEAKKAVPRDDQN+++RN+G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   EIVIKEKHNIDGRMVEAKKAVPRDDQNILSRNSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>ref|XP_012074030.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Jatropha 
curcas]
 ref|XP_012074031.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Jatropha 
curcas]
 ref|XP_012074032.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Jatropha 
curcas]
Length=475

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L+EYF++YGEV+EAVIM+DR TGRARGFGFV+FADP VA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLREYFQAYGEVMEAVIMKDRATGRARGFGFVVFADPVVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            ERVV EKH+IDGR VEAKKAVPR+DQN++NR N+  I GSPGP RTKKIFVGGLASTVTE
Sbjct  61   ERVVMEKHLIDGRNVEAKKAVPREDQNILNRSNSSSIHGSPGPARTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            NDFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  121  NDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLHKT  168



>ref|XP_007026293.1| RNA-binding family protein isoform 3 [Theobroma cacao]
 gb|EOY28915.1| RNA-binding family protein isoform 3 [Theobroma cacao]
Length=497

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L+EYF+++G+VVEAVIMRDR TGRARGFGFV+FADPA+A
Sbjct  1    MEMELGKLFIGGISWDTNEDRLREYFQAFGDVVEAVIMRDRATGRARGFGFVVFADPAIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKHMIDGRTVEAKKAVPRDDQN++N++N  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHMIDGRTVEAKKAVPRDDQNILNKSNVSIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L +T
Sbjct  121  DFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLQRT  167


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 72/147 (49%), Gaps = 29/147 (20%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVKE  396
            K+F+GG++    E   K YF  +G + + V+M D NT R RGFGF+ +      ++V++ 
Sbjct  107  KIFVGGLASTVTESDFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLQR  166

Query  397  K-HMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE-NDFKN  570
              H ++G+ VE K+AVP++              SPGP R +   +GG    ++  N F N
Sbjct  167  TFHELNGKMVEVKRAVPKES-------------SPGPSRNQ---LGGYNFGLSRVNSFLN  210

Query  571  YFDQFGTITDVVVMYDHNTQRPRGFGF  651
             +           M  +NT    G+GF
Sbjct  211  GY-----------MQGYNTSSVGGYGF  226



>gb|KHN46912.1| DAZ-associated protein 1 [Glycine soja]
Length=496

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE L+EYF +YGEVVEAVIM+DR TGRARGFGFV+F+DPA+A
Sbjct  1    MQSDNGKLFIGGISWDTNEERLREYFSTYGEVVEAVIMKDRTTGRARGFGFVVFSDPAIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V+KEKH IDGR VEAKKAVPRDDQN+++RN+G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   EIVIKEKHNIDGRMVEAKKAVPRDDQNILSRNSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>ref|XP_006449887.1| hypothetical protein CICLE_v10015098mg [Citrus clementina]
 ref|XP_006449888.1| hypothetical protein CICLE_v10015098mg [Citrus clementina]
 gb|ESR63127.1| hypothetical protein CICLE_v10015098mg [Citrus clementina]
 gb|ESR63128.1| hypothetical protein CICLE_v10015098mg [Citrus clementina]
Length=475

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L++YF+++GEV+EAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLRDYFQAFGEVLEAVIMKDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMIDGRTVEAKKAVPRDDQN+ NRNN  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMQKHMIDGRTVEAKKAVPRDDQNIQNRNNSSIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ + ++ AV + ++K
Sbjct  107  KIFVGGLASTVTESDFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLK  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQ  489
              H ++G+ VE K+AVP++     +RN  G  
Sbjct  167  TFHELNGKMVEVKRAVPKELSPGPSRNQLGTH  198



>ref|XP_009625288.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
Length=464

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME + GK+F+GGISWDT+E+ LKEYF+ +G+VVEAVIM+DR TGRARGFGFV+FADP+VA
Sbjct  1    MEMEPGKLFVGGISWDTNEDRLKEYFQVFGDVVEAVIMKDRITGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKH+IDGRTVEAKKAVPRDDQ+ I RNNG +QGSPGP RTKKIFVGGLAS+VTE+
Sbjct  61   ERVVKEKHIIDGRTVEAKKAVPRDDQH-ITRNNGSMQGSPGPARTKKIFVGGLASSVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ LYKT
Sbjct  120  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLYKT  166



>ref|XP_009775500.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=464

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME + GK+F+GGISWDT+E+ LKEYF+ +G+VVEAVIM+DR TGRARGFGFV+FADP+VA
Sbjct  1    MEMEPGKLFVGGISWDTNEDRLKEYFQVFGDVVEAVIMKDRITGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKH+IDGRTVEAKKAVPRDDQ+ I RNNG +QGSPGP RTKKIFVGGLAS+VTE+
Sbjct  61   ERVVKEKHIIDGRTVEAKKAVPRDDQH-ITRNNGSMQGSPGPARTKKIFVGGLASSVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ LYKT
Sbjct  120  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLYKT  166



>ref|XP_006467314.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467315.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Citrus sinensis]
 gb|KDO78482.1| hypothetical protein CISIN_1g011518mg [Citrus sinensis]
 gb|KDO78483.1| hypothetical protein CISIN_1g011518mg [Citrus sinensis]
 gb|KDO78484.1| hypothetical protein CISIN_1g011518mg [Citrus sinensis]
Length=475

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L++YF+++GEV+EAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLRDYFQAFGEVLEAVIMKDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMIDGRTVEAKKAVPRDDQN+ NRNN  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMQKHMIDGRTVEAKKAVPRDDQNIQNRNNSSIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ + ++ AV + ++K
Sbjct  107  KIFVGGLASTVTESDFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLK  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQ  489
              H ++G+ VE K+AVP++     +RN  G  
Sbjct  167  TFHELNGKMVEVKRAVPKELSPGPSRNQLGTH  198



>ref|XP_002308799.1| hypothetical protein POPTR_0006s01680g [Populus trichocarpa]
 gb|EEE92322.1| hypothetical protein POPTR_0006s01680g [Populus trichocarpa]
Length=476

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ LKEYFR++GEV+EAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLKEYFRAFGEVLEAVIMKDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGR VEAKKAVPR+DQN +N+N+  + GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHLIDGRNVEAKKAVPREDQNTLNKNSSSVNGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFRKYFDQFGVITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>gb|KHM99490.1| RNA-binding protein Musashi like Rbp6 [Glycine soja]
Length=512

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEV+E VIMRDR TGRARGFGFV+F DP+VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGEVIETVIMRDRVTGRARGFGFVVFGDPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR +G    SPGPGRTKKIFVGGL ST+TE+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQNINRQSGSAHVSPGPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  DFKTYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  167



>ref|XP_006352343.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=465

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME + GK+F+GGISWDT+E+ LKEYF+++G+V+EAVIM+DR TGRARGFGFV+FADP+VA
Sbjct  1    MEMEPGKLFVGGISWDTNEDRLKEYFQAFGDVIEAVIMKDRITGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKH+IDGRTVEAKKAVPRDDQ+ I RNNG +QGSPGP RTKKIFVGGLAS+VTE+
Sbjct  61   ERVVKEKHIIDGRTVEAKKAVPRDDQH-ITRNNGSMQGSPGPARTKKIFVGGLASSVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFIT+DSE+AVD+ LYKT
Sbjct  120  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITFDSEEAVDKVLYKT  166



>gb|KDO78485.1| hypothetical protein CISIN_1g011518mg [Citrus sinensis]
Length=484

 Score =   290 bits (743),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L++YF+++GEV+EAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLRDYFQAFGEVLEAVIMKDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMIDGRTVEAKKAVPRDDQN+ NRNN  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMQKHMIDGRTVEAKKAVPRDDQNIQNRNNSSIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ + ++ AV + ++K
Sbjct  107  KIFVGGLASTVTESDFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLK  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQ  489
              H ++G+ VE K+AVP++     +RN  G  
Sbjct  167  TFHELNGKMVEVKRAVPKELSPGPSRNQLGTH  198



>ref|XP_011007099.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Populus euphratica]
Length=481

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF +YGEVVEAVIMRDR TGRARGFGFV+FAD  VA
Sbjct  4    MESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDRVTGRARGFGFVVFADLTVA  63

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH+IDGRTVEAKKAVPRDDQ++++RN   I GSPGPGRTKKIFVGGLASTVTEN
Sbjct  64   ERVIMEKHVIDGRTVEAKKAVPRDDQHILSRNISNIHGSPGPGRTKKIFVGGLASTVTEN  123

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +FK YF+Q+G I DVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  124  EFKKYFEQYGIIIDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  170



>ref|XP_010688996.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISW+T+EE LKEYF ++GEV+EAVIM+DR TGRARGFGF++F+DPAVA
Sbjct  1    MQSDLGKLFIGGISWETNEERLKEYFSTFGEVIEAVIMKDRTTGRARGFGFIVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RV+KEKH IDGR VEAKKAVPRDDQN++ R +G + GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DRVIKEKHNIDGRMVEAKKAVPRDDQNILTRTSGSVHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L KT
Sbjct  121  DFKIYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLIKT  167



>ref|XP_011007096.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Populus euphratica]
Length=485

 Score =   290 bits (743),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF +YGEVVEAVIMRDR TGRARGFGFV+FAD  VA
Sbjct  4    MESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDRVTGRARGFGFVVFADLTVA  63

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH+IDGRTVEAKKAVPRDDQ++++RN   I GSPGPGRTKKIFVGGLASTVTEN
Sbjct  64   ERVIMEKHVIDGRTVEAKKAVPRDDQHILSRNISNIHGSPGPGRTKKIFVGGLASTVTEN  123

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +FK YF+Q+G I DVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  124  EFKKYFEQYGIIIDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  170



>ref|XP_011007097.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Populus euphratica]
Length=482

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF +YGEVVEAVIMRDR TGRARGFGFV+FAD  VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSNYGEVVEAVIMRDRVTGRARGFGFVVFADLTVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH+IDGRTVEAKKAVPRDDQ++++RN   I GSPGPGRTKKIFVGGLASTVTEN
Sbjct  61   ERVIMEKHVIDGRTVEAKKAVPRDDQHILSRNISNIHGSPGPGRTKKIFVGGLASTVTEN  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +FK YF+Q+G I DVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  EFKKYFEQYGIIIDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>ref|XP_012081416.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Jatropha 
curcas]
 ref|XP_012081417.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Jatropha 
curcas]
 gb|KDP29893.1| hypothetical protein JCGZ_18462 [Jatropha curcas]
Length=478

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFGSFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNG-GIQGSPGPGRTKKIFVGGLASTVTE  555
            ERV+KEKH IDGR VEAKKAVPRDDQN++NRN+G  I GSPGPGRT+KIFVGGLASTVTE
Sbjct  61   ERVIKEKHNIDGRMVEAKKAVPRDDQNILNRNSGNSIHGSPGPGRTRKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
             DF+ YF+Q+GTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  TDFRKYFEQYGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLMKT  168



>ref|XP_007146588.1| hypothetical protein PHAVU_006G053000g [Phaseolus vulgaris]
 gb|ESW18582.1| hypothetical protein PHAVU_006G053000g [Phaseolus vulgaris]
Length=481

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEV+EAVIMRDR TGRARGFGFV+FADP+VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGEVIEAVIMRDRVTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR--NNGGIQGSPGPGRTKKIFVGGLASTVT  552
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR   +G    SPGPGRTKKIFVGGL ST+T
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQLNINRQQQSGSAHASPGPGRTKKIFVGGLPSTIT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  ESDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  169


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 14/103 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG+     E   K+YF  +G + + V+M D NT R RGFGF+ +      +RV+ K
Sbjct  109  KIFVGGLPSTITESDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYK  168

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKI  522
              H ++G+ VE K+AVP++              SPGP R+  I
Sbjct  169  TFHELNGKMVEVKRAVPKEL-------------SPGPNRSPLI  198



>ref|XP_007146589.1| hypothetical protein PHAVU_006G053000g [Phaseolus vulgaris]
 gb|ESW18583.1| hypothetical protein PHAVU_006G053000g [Phaseolus vulgaris]
Length=479

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEV+EAVIMRDR TGRARGFGFV+FADP+VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGEVIEAVIMRDRVTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR--NNGGIQGSPGPGRTKKIFVGGLASTVT  552
            ERV+ +KH+IDGRTVEAKKAVPRDDQ  INR   +G    SPGPGRTKKIFVGGL ST+T
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQLNINRQQQSGSAHASPGPGRTKKIFVGGLPSTIT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVDR LYKT
Sbjct  121  ESDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYKT  169


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 14/103 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG+     E   K+YF  +G + + V+M D NT R RGFGF+ +      +RV+ K
Sbjct  109  KIFVGGLPSTITESDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLYK  168

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKI  522
              H ++G+ VE K+AVP++              SPGP R+  I
Sbjct  169  TFHELNGKMVEVKRAVPKEL-------------SPGPNRSPLI  198



>gb|EYU27413.1| hypothetical protein MIMGU_mgv1a005325mg [Erythranthe guttata]
Length=488

 Score =   290 bits (742),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+FIGGISWDT+E+ L+E+F +YG+VVEAVIMRDR TGRARGFGFV+FA+PAVA
Sbjct  1    MEMDQGKLFIGGISWDTNEDRLREHFGAYGQVVEAVIMRDRTTGRARGFGFVVFAEPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGI-QGSPGPGRTKKIFVGGLASTVTE  555
            ERVVKEKH+IDGRTVEAKKAVPRDDQ++INRN+GG  QGSP P RTKKIFVGGLASTV E
Sbjct  61   ERVVKEKHIIDGRTVEAKKAVPRDDQHLINRNSGGSNQGSPPPARTKKIFVGGLASTVNE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            NDFK YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  NDFKTYFDQFGAITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  168



>gb|EPS59033.1| hypothetical protein M569_15778, partial [Genlisea aurea]
Length=335

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 153/173 (88%), Gaps = 3/173 (2%)
 Frame = +1

Query  190  SRMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADP  369
            S  ME + GK+FIGGISWDT+E+ LKEYF +YGEV+EAVIMRDR TGRARGFGF++FA+P
Sbjct  4    SDKMEMEQGKLFIGGISWDTNEDRLKEYFGAYGEVIEAVIMRDRATGRARGFGFIVFANP  63

Query  370  AVAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNN---GGIQGSPGPGRTKKIFVGGLA  540
             VAERVVKEKH+IDGRTVEAKKAVPRDD +++NRN    G I GSP   RTKKIFVGGLA
Sbjct  64   LVAERVVKEKHIIDGRTVEAKKAVPRDDHHLMNRNTGSGGSIHGSPSQSRTKKIFVGGLA  123

Query  541  STVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            STVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+ T
Sbjct  124  STVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLHNT  176



>ref|XP_011039340.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
 ref|XP_011039341.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=479

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LK+YF+S+GEVVEAVIM+DR TGRARGFGFV+F+DP++A
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKDYFQSFGEVVEAVIMKDRTTGRARGFGFVVFSDPSIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGG-IQGSPGPGRTKKIFVGGLASTVTE  555
            +RV+KEKH IDGR VEAKKAVPRDDQN+++RN+GG I GSPGPGRTKKIFVGGLASTVTE
Sbjct  61   DRVIKEKHSIDGRMVEAKKAVPRDDQNILSRNSGGSIHGSPGPGRTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DF+ YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  SDFRKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLMKT  168



>ref|XP_010908650.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Elaeis guineensis]
Length=484

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MMESDLGK+FIGGISWDT+E+ L+EYF++YGEVVEAVIM+DR TGRARGFGFV+FADPAV
Sbjct  1    MMESDLGKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDRTTGRARGFGFVVFADPAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            AERV+ EKHMIDGR VEAKKAVPRDDQ++++R+N  I GS GPGRTKKIFVGGL ST+TE
Sbjct  61   AERVIMEKHMIDGRMVEAKKAVPRDDQHILSRSNTSIYGSSGPGRTKKIFVGGLPSTITE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSEDAVD+ L  T
Sbjct  121  SDFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLNT  168



>ref|XP_010908651.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Elaeis guineensis]
Length=478

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MMESDLGK+FIGGISWDT+E+ L+EYF++YGEVVEAVIM+DR TGRARGFGFV+FADPAV
Sbjct  1    MMESDLGKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDRTTGRARGFGFVVFADPAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            AERV+ EKHMIDGR VEAKKAVPRDDQ++++R+N  I GS GPGRTKKIFVGGL ST+TE
Sbjct  61   AERVIMEKHMIDGRMVEAKKAVPRDDQHILSRSNTSIYGSSGPGRTKKIFVGGLPSTITE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSEDAVD+ L  T
Sbjct  121  SDFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLNT  168



>dbj|BAK01877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF  YGEVVEAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MEADAGKLFIGGISWDTNEDRLREYFEKYGEVVEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKHMIDGR VEAKKAVPRDDQ  ++++ G   GSPGP RTKKIFVGGLASTVTE 
Sbjct  61   ERVIMEKHMIDGRMVEAKKAVPRDDQQALSKSGGSAHGSPGPSRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+KT
Sbjct  121  DFRTYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFKT  167



>ref|XP_010060245.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Eucalyptus grandis]
Length=449

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF SYGEVVEA+IMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGSYGEVVEAMIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV ++KH+IDGR+VEAKKAVPR+DQ ++NR++  + GSP PGRTKKIFVGGL ST+TE+
Sbjct  61   ERVTRDKHLIDGRSVEAKKAVPREDQQLLNRSSASMNGSPSPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSED+V+R LY+T
Sbjct  121  DFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDSVERVLYRT  167



>ref|XP_010060242.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010060243.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010060244.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW66863.1| hypothetical protein EUGRSUZ_F00624 [Eucalyptus grandis]
Length=452

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF SYGEVVEA+IMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGSYGEVVEAMIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV ++KH+IDGR+VEAKKAVPR+DQ ++NR++  + GSP PGRTKKIFVGGL ST+TE+
Sbjct  61   ERVTRDKHLIDGRSVEAKKAVPREDQQLLNRSSASMNGSPSPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSED+V+R LY+T
Sbjct  121  DFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDSVERVLYRT  167



>ref|XP_009380131.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=481

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+E+ L+EYF ++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEDRLREYFGNFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E+VV EKH+IDGR VEAKKAVPRDDQ ++NR N  I GSP PG TKKIFVGGL ST+TE+
Sbjct  61   EQVVMEKHLIDGRMVEAKKAVPRDDQQILNRINNSIHGSPSPGHTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+K+
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLFKS  167



>gb|KCW66864.1| hypothetical protein EUGRSUZ_F00624 [Eucalyptus grandis]
Length=454

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF SYGEVVEA+IMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGSYGEVVEAMIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV ++KH+IDGR+VEAKKAVPR+DQ ++NR++  + GSP PGRTKKIFVGGL ST+TE+
Sbjct  61   ERVTRDKHLIDGRSVEAKKAVPREDQQLLNRSSASMNGSPSPGRTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSED+V+R LY+T
Sbjct  121  DFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDSVERVLYRT  167



>ref|XP_009380128.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009380130.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=490

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+E+ L+EYF ++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEDRLREYFGNFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E+VV EKH+IDGR VEAKKAVPRDDQ ++NR N  I GSP PG TKKIFVGGL ST+TE+
Sbjct  61   EQVVMEKHLIDGRMVEAKKAVPRDDQQILNRINNSIHGSPSPGHTKKIFVGGLPSTITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR L+K+
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLFKS  167



>gb|EMS61711.1| RNA-binding protein Musashi-like protein 2 [Triticum urartu]
Length=463

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF  YGEVVEAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MEADAGKLFIGGISWDTNEDRLREYFEKYGEVVEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKHMIDGR VEAKKAVPRDDQ  ++++ G   GSPGP RTKKIFVGGLASTVTE 
Sbjct  61   ERVIMEKHMIDGRMVEAKKAVPRDDQQALSKSGGSAHGSPGPSRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+KT
Sbjct  121  DFRTYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFKT  167



>gb|EMT31848.1| RNA-binding Musashi-2-like protein [Aegilops tauschii]
Length=463

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF  YGEVVEAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MEADAGKLFIGGISWDTNEDRLREYFEKYGEVVEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKHMIDGR VEAKKAVPRDDQ  ++++ G   GSPGP RTKKIFVGGLASTVTE 
Sbjct  61   ERVIMEKHMIDGRMVEAKKAVPRDDQQALSKSGGSAHGSPGPSRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+KT
Sbjct  121  DFRTYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFKT  167



>ref|XP_011004496.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=476

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ LKEYFR++GEV+E VIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLKEYFRAFGEVLETVIMKDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGR VEAKKAVPR+DQN +N+N+  + GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHLIDGRNVEAKKAVPREDQNTLNKNSSSVNGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFRKYFDQFGMITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>ref|XP_009364617.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=476

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMID RTVEAKKAVP++DQ+++NR  G + GSPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDCRTVEAKKAVPKEDQHILNR-TGVVNGSPGPGRTKKIFVGGLASTVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDH TQRPRGFGFITYDSE+AVDR L+KT
Sbjct  120  DFKKYFDQFGTVTDVVVMYDHKTQRPRGFGFITYDSEEAVDRVLHKT  166



>ref|XP_010936617.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=478

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDT+E+ L+ YF S+GEVVEAVIM+DRNTGRARGFGFV+FADP VA
Sbjct  1    MESDLGKLFIGGISWDTNEDRLRGYFESFGEVVEAVIMKDRNTGRARGFGFVVFADPTVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKHMIDGR VEAKKAVPRDDQ+++ RN+    GSP P RTKKIFVGGLASTVTE 
Sbjct  61   ERVVKEKHMIDGRMVEAKKAVPRDDQHILKRNSSNAHGSPAPARTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +FK YFDQFGTITDVVVMYDHNTQRPRGFGFIT+DSEDAVD+ L KT
Sbjct  121  EFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITFDSEDAVDKVLVKT  167


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ F ++ AV + +VK
Sbjct  107  KIFVGGLASTVTEAEFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITFDSEDAVDKVLVK  166

Query  394  EKHMIDGRTVEAKKAVPRD  450
              H ++G+ VE KKAVP++
Sbjct  167  TFHELNGKMVEVKKAVPKE  185



>ref|XP_009364612.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364613.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364614.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364615.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364616.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=480

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMID RTVEAKKAVP++DQ+++NR  G + GSPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDCRTVEAKKAVPKEDQHILNR-TGVVNGSPGPGRTKKIFVGGLASTVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDH TQRPRGFGFITYDSE+AVDR L+KT
Sbjct  120  DFKKYFDQFGTVTDVVVMYDHKTQRPRGFGFITYDSEEAVDRVLHKT  166



>ref|XP_008379969.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=481

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN++ R++G IQGSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DSVIMEKHNIDGRMVEAKKAVPRDDQNILGRSSGSIQGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD  L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDXVLLKT  167



>ref|XP_010908648.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010908649.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Elaeis guineensis]
Length=501

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            MMESDLGK+FIGGISWDT+E+ L+EYF++YGEVVEAVIM+DR TGRARGFGFV+FADPAV
Sbjct  1    MMESDLGKLFIGGISWDTNEDHLREYFKTYGEVVEAVIMKDRTTGRARGFGFVVFADPAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            AERV+ EKHMIDGR VEAKKAVPRDDQ++++R+N  I GS GPGRTKKIFVGGL ST+TE
Sbjct  61   AERVIMEKHMIDGRMVEAKKAVPRDDQHILSRSNTSIYGSSGPGRTKKIFVGGLPSTITE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSEDAVD+ L  T
Sbjct  121  SDFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLNT  168



>ref|XP_002316761.1| hypothetical protein POPTR_0011s09050g [Populus trichocarpa]
 ref|XP_006377630.1| hypothetical protein POPTR_0011s09050g [Populus trichocarpa]
 gb|EEE97373.1| hypothetical protein POPTR_0011s09050g [Populus trichocarpa]
 gb|ERP55427.1| hypothetical protein POPTR_0011s09050g [Populus trichocarpa]
Length=478

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEAVIMRDR TGRARGFGFV+FAD  VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFSKYGEVVEAVIMRDRATGRARGFGFVVFADLTVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH+IDGRTVEAKKAVPRDDQ++++R+   I GSPGPGRTKKIFVGGLASTVTEN
Sbjct  61   ERVIMEKHVIDGRTVEAKKAVPRDDQHILSRSISNIHGSPGPGRTKKIFVGGLASTVTEN  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +FK YF+Q+G I DVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  EFKKYFEQYGIIIDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>ref|XP_004250279.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
Length=465

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME + GK+F+GGISWDT+E+ LKEYF+++G+V+EAVIM+DR TGRARGFGFV+FADP+VA
Sbjct  1    MEMEPGKLFVGGISWDTNEDRLKEYFQAFGDVIEAVIMKDRITGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKH+IDGRTVEAKKAVPRDDQ+ I RNNG +QGSPGP RTKKIFVGGLAS+VTE+
Sbjct  61   ERVVKEKHIIDGRTVEAKKAVPRDDQH-ITRNNGSMQGSPGPARTKKIFVGGLASSVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFIT+DSE+AVD+ LYK 
Sbjct  120  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITFDSEEAVDKVLYKA  166



>ref|XP_007215319.1| hypothetical protein PRUPE_ppa005119mg [Prunus persica]
 gb|EMJ16518.1| hypothetical protein PRUPE_ppa005119mg [Prunus persica]
Length=476

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN++ R +G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DSVIMEKHNIDGRMVEAKKAVPRDDQNILGRTSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>gb|KDO58444.1| hypothetical protein CISIN_1g012289mg [Citrus sinensis]
Length=466

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF +YGEVVEAVIM+DRNTGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSTYGEVVEAVIMKDRNTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V++EKH IDGR VEAKKAVPRDDQ ++NR++G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   EIVIQEKHNIDGRMVEAKKAVPRDDQIVLNRSSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDR  684
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDK  162


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 31/123 (25%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVKE  396
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ +      ++V   
Sbjct  107  KIFVGGLASTVTESDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKV---  163

Query  397  KHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE-NDFKNY  573
                       K+AVP++              SPGP R+    +GG    ++  N F N 
Sbjct  164  -----------KRAVPKEL-------------SPGPTRSP---LGGYHYGLSRVNSFLNG  196

Query  574  FDQ  582
            + Q
Sbjct  197  YTQ  199



>gb|KDP36443.1| hypothetical protein JCGZ_09513 [Jatropha curcas]
Length=473

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +1

Query  208  DLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERV  387
            +LGK+FIGGISWDT+E+ L+EYF++YGEV+EAVIM+DR TGRARGFGFV+FADP VAERV
Sbjct  2    ELGKLFIGGISWDTNEDRLREYFQAYGEVMEAVIMKDRATGRARGFGFVVFADPVVAERV  61

Query  388  VKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSPGPGRTKKIFVGGLASTVTENDF  564
            V EKH+IDGR VEAKKAVPR+DQN++NR N+  I GSPGP RTKKIFVGGLASTVTENDF
Sbjct  62   VMEKHLIDGRNVEAKKAVPREDQNILNRSNSSSIHGSPGPARTKKIFVGGLASTVTENDF  121

Query  565  KNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            K YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  122  KKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLHKT  166



>ref|XP_008342216.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
 ref|XP_008362304.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=475

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMID RTVEAKKAVP++DQ+++NR  G + GSP PGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDCRTVEAKKAVPKEDQHILNR-TGVVNGSPSPGRTKKIFVGGLASTVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDHNTQRPRGFGFITYDSE+AVDR L KT
Sbjct  120  DFKKYFDQFGTVTDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLXKT  166



>ref|NP_001068335.1| Os11g0637700 [Oryza sativa Japonica Group]
 gb|ABA94921.2| RNA-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28698.1| Os11g0637700 [Oryza sativa Japonica Group]
 dbj|BAG92021.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97349.1| unnamed protein product [Oryza sativa Japonica Group]
Length=467

 Score =   287 bits (735),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF  YGEVVEAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MEADAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKHMIDGR VEAKKAVPRDDQ+ ++++ G   GSPGP RTKKIFVGGLASTVTE 
Sbjct  61   ERVIMEKHMIDGRMVEAKKAVPRDDQHALSKSGGSAHGSPGPSRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+KT
Sbjct  121  DFRKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFKT  167



>ref|XP_009364669.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
 ref|XP_009364670.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
 ref|XP_009364671.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=476

 Score =   287 bits (735),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMID RTVEAKKAVP++DQ+++NR  G + GSPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDCRTVEAKKAVPKEDQHILNR-IGVVNGSPGPGRTKKIFVGGLASTVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDH TQRPRGFGFITYDSE+AVDR L+KT
Sbjct  120  DFKKYFDQFGTVTDVVVMYDHKTQRPRGFGFITYDSEEAVDRVLHKT  166



>ref|XP_006663067.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Oryza 
brachyantha]
Length=462

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF  YGEVVEAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MEADAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKHMIDGR VEAKKAVPRDDQ+ ++++ G   GSPGP RTKKIFVGGLASTVTE 
Sbjct  61   ERVIMEKHMIDGRMVEAKKAVPRDDQHALSKSGGSAHGSPGPSRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+KT
Sbjct  121  DFRKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFKT  167



>ref|XP_007215320.1| hypothetical protein PRUPE_ppa005132mg [Prunus persica]
 gb|EMJ16519.1| hypothetical protein PRUPE_ppa005132mg [Prunus persica]
Length=476

 Score =   287 bits (735),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN++ R++G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DSVIMEKHNIDGRMVEAKKAVPRDDQNILGRSSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>ref|XP_008229871.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
 ref|XP_008229872.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Prunus 
mume]
Length=476

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN++ R++G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DSVIMEKHNIDGRMVEAKKAVPRDDQNILGRSSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>gb|EYU33694.1| hypothetical protein MIMGU_mgv1a005066mg [Erythranthe guttata]
Length=498

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 156/171 (91%), Gaps = 4/171 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF +YGEVVEAVIMRDR TGRARGFGFV+FADP+ A
Sbjct  1    METDQGKLFIGGISWDTNEDRLREYFGAYGEVVEAVIMRDRTTGRARGFGFVVFADPSAA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNN----GGIQGSPGPGRTKKIFVGGLAST  546
            ERVVKEKHMIDGRTVEAKKAVPRDDQ++I+RN+    G IQGSPGP RTKKIFVGGLAST
Sbjct  61   ERVVKEKHMIDGRTVEAKKAVPRDDQHLISRNSGSHGGSIQGSPGPTRTKKIFVGGLAST  120

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            V+E++FK YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AV+  L+KT
Sbjct  121  VSESEFKTYFDQFGNITDVVVMYDHNTQRPRGFGFITYDSEEAVEMVLHKT  171



>ref|XP_011460104.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=473

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN ++R +G I GSPGPGRT+KIFVGGLASTVTE 
Sbjct  61   DTVIMEKHNIDGRMVEAKKAVPRDDQNTLSRTSGSIHGSPGPGRTRKIFVGGLASTVTEG  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>gb|KJB67389.1| hypothetical protein B456_010G188300 [Gossypium raimondii]
 gb|KJB67391.1| hypothetical protein B456_010G188300 [Gossypium raimondii]
 gb|KJB67392.1| hypothetical protein B456_010G188300 [Gossypium raimondii]
Length=475

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L+EYF+++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLREYFQTFGEVVEAVIMKDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKHMIDGRTVEAKKAVPRDD+N++N++N  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHMIDGRTVEAKKAVPRDDRNILNKSNVSIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+ VD+ L +T
Sbjct  121  DFKRYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEVVDKVLQRT  167



>ref|XP_004979810.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Setaria 
italica]
Length=461

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF  YGEVVEAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MEADAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E+V+ EKHMIDGR VEAKKAVPRDDQ+ ++++ G   GSPGP RTKKIFVGGLASTVTE 
Sbjct  61   EQVIMEKHMIDGRMVEAKKAVPRDDQHALSKSGGSAHGSPGPSRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+KT
Sbjct  121  DFRKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFKT  167



>ref|XP_004491591.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cicer 
arietinum]
Length=481

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE L+EYF +YGEV EAVIM+DR TGRARGFGFV+F DPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLREYFSTYGEVKEAVIMKDRTTGRARGFGFVVFIDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E V+KEKH IDGR VEAKKAVPRDDQN+++RN+G IQGS GPGRT+KIFVGGLASTVTE+
Sbjct  61   EIVIKEKHNIDGRMVEAKKAVPRDDQNVLSRNSGSIQGSRGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDQVLLKT  167



>ref|XP_011460103.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011460105.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=473

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN ++R +G I GSPGPGRT+KIFVGGLASTVTE 
Sbjct  61   DTVIMEKHNIDGRMVEAKKAVPRDDQNTLSRTSGSIHGSPGPGRTRKIFVGGLASTVTEG  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>ref|XP_008342177.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
 ref|XP_008342178.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=481

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAK+AVPRDDQN++ R++G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DSVIMEKHNIDGRMVEAKRAVPRDDQNILGRSSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>gb|KHG05056.1| RNA-binding Musashi [Gossypium arboreum]
Length=474

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISW T+E+ L+EYF+++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MEMELGKLFIGGISWGTNEDRLREYFQTFGEVVEAVIMKDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV ++HMIDGRTVEAKKAVPRDDQNM+++NN    GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMKEHMIDGRTVEAKKAVPRDDQNMLSKNNISTLGSPGPSRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L +T
Sbjct  121  DFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLQRT  167


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVKE  396
            K+F+GG++    E   K YF  +G + + V+M D NT R RGFGF+ +      ++V++ 
Sbjct  107  KIFVGGLASTVTESDFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLQR  166

Query  397  K-HMIDGRTVEAKKAVPRDDQNMINRN  474
              H ++G+ VE K+AVP++     NRN
Sbjct  167  TFHELNGKMVEVKRAVPKESSLGPNRN  193



>gb|KJB67390.1| hypothetical protein B456_010G188300 [Gossypium raimondii]
Length=486

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L+EYF+++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  12   MEMELGKLFIGGISWDTNEDRLREYFQTFGEVVEAVIMKDRATGRARGFGFVVFADPAVA  71

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKHMIDGRTVEAKKAVPRDD+N++N++N  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  72   ERVVMEKHMIDGRTVEAKKAVPRDDRNILNKSNVSIHGSPGPARTKKIFVGGLASTVTES  131

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+ VD+ L +T
Sbjct  132  DFKRYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEVVDKVLQRT  178



>ref|XP_006373597.1| hypothetical protein POPTR_0016s01150g [Populus trichocarpa]
 gb|ERP51394.1| hypothetical protein POPTR_0016s01150g [Populus trichocarpa]
Length=477

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ LKEYFR++G+V+EAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLKEYFRAFGDVLEAVIMKDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGR VEAKKAVPR+DQ+ +N+N+  I GSPGP RTKKIFVGGLASTVT++
Sbjct  61   ERVVMEKHLIDGRNVEAKKAVPREDQSTLNKNSSSINGSPGPARTKKIFVGGLASTVTDS  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFKKYFDQFGVIVDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>gb|KHG02324.1| RNA-binding Musashi [Gossypium arboreum]
Length=476

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L+EYF+++GEVVEAVIM+DR TGRARGFGFV+FADPA+A
Sbjct  1    MEMELGKLFIGGISWDTNEDRLREYFQTFGEVVEAVIMKDRATGRARGFGFVVFADPAIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKHMIDGRTVEAKKAVPRDD+N++N++N  I GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMEKHMIDGRTVEAKKAVPRDDRNILNKSNVSIHGSPGPARTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+ VD+ L +T
Sbjct  121  DFKRYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEVVDKVLQRT  167



>ref|XP_008342172.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
 ref|XP_008342173.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=484

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH I GR VEAKKAVPRDDQN++ R++G IQGSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DNVIMEKHNIGGRMVEAKKAVPRDDQNILGRSSGSIQGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEXAVDKVLLKT  167



>ref|XP_010094687.1| RNA-binding protein Musashi-2-like protein [Morus notabilis]
 gb|EXB56659.1| RNA-binding protein Musashi-2-like protein [Morus notabilis]
Length=494

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT E+ L+EYF+S+G+VVEAVIM+DR TGRARGFGF++FADP VAE+VV 
Sbjct  4    GKLFIGGISWDTTEDRLREYFQSFGDVVEAVIMKDRATGRARGFGFIVFADPTVAEKVVT  63

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            EKH+ID R VEAKKAVPRDDQN++NRNN  IQGSPGP RTKKIFVGGLASTVTE+DFK Y
Sbjct  64   EKHVIDSRFVEAKKAVPRDDQNILNRNNSSIQGSPGPARTKKIFVGGLASTVTESDFKKY  123

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ LYKT
Sbjct  124  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLYKT  165



>ref|XP_003577309.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brachypodium 
distachyon]
 ref|XP_010237506.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Brachypodium 
distachyon]
Length=463

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF  YGEVVEAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MEADAGKLFIGGISWDTNEDRLREYFEKYGEVVEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKHMIDGR VEAKKAVPRDDQ  ++++ G   GSPGP RTKKIFVGGLASTV E 
Sbjct  61   ERVIMEKHMIDGRMVEAKKAVPRDDQQALSKSGGSTHGSPGPSRTKKIFVGGLASTVNEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DF+ YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+AL+KT
Sbjct  121  DFRTYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKALFKT  167



>ref|XP_009365193.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009365194.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN++ R++G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DSVIMEKHNIDGRMVEAKKAVPRDDQNILGRSSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDH+TQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHSTQRPRGFGFITYDSEEAVDKVLLKT  167



>gb|KJB57868.1| hypothetical protein B456_009G183800 [Gossypium raimondii]
 gb|KJB57869.1| hypothetical protein B456_009G183800 [Gossypium raimondii]
 gb|KJB57870.1| hypothetical protein B456_009G183800 [Gossypium raimondii]
 gb|KJB57871.1| hypothetical protein B456_009G183800 [Gossypium raimondii]
 gb|KJB57872.1| hypothetical protein B456_009G183800 [Gossypium raimondii]
Length=474

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISW T+E+ L+EYF+++GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MEMELGKLFIGGISWGTNEDRLREYFQTFGEVVEAVIMKDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV ++HMIDGRTVEAKKAVPRDDQNM+N+NN    GSPGP RTKKIFVGGLASTVTE+
Sbjct  61   ERVVMKEHMIDGRTVEAKKAVPRDDQNMLNKNNISTLGSPGPSRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNT RPRGFGFITYDSE+AVD+ L +T
Sbjct  121  DFKRYFDQFGTITDVVVMYDHNTLRPRGFGFITYDSEEAVDKVLQRT  167


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVKE  396
            K+F+GG++    E   K YF  +G + + V+M D NT R RGFGF+ +      ++V++ 
Sbjct  107  KIFVGGLASTVTESDFKRYFDQFGTITDVVVMYDHNTLRPRGFGFITYDSEEAVDKVLQR  166

Query  397  K-HMIDGRTVEAKKAVPRDDQNMINRN  474
              H ++G+ VE K+AVP++     NRN
Sbjct  167  TFHELNGKMVEVKRAVPKESSLGPNRN  193



>ref|XP_008379973.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Malus 
domestica]
Length=483

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+G VVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSSFGXVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN++ R++G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DSVIMEKHNIDGRMVEAKKAVPRDDQNILGRSSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>ref|XP_009795233.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
 ref|XP_009795234.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
sylvestris]
Length=474

 Score =   285 bits (729),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+EE LKEYF +YGEV+EAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDRTTGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RV+KEKH IDGR VEAKKAVPRDDQ+ I+R++  IQGSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DRVIKEKHNIDGRMVEAKKAVPRDDQSTISRSSTSIQGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L KT
Sbjct  121  DFKTYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLKT  167



>ref|XP_003617976.1| Heterogeneous nuclear ribonucleoprotein A1, A2/B1-like protein 
[Medicago truncatula]
 gb|AET00935.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=479

 Score =   285 bits (728),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE L+EYF +YGEV EAVIM+DR TGRARGFGFV+F DPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLREYFSTYGEVKEAVIMKDRTTGRARGFGFVVFIDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + VV+EKH IDGR VEAKKAVPRDDQN+++R +G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DIVVQEKHNIDGRMVEAKKAVPRDDQNVLSRTSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDQVLLKT  167



>ref|XP_009631808.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009631809.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   285 bits (728),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SDLGK+FIGGISWDT+EE LKEYF +YGEV+EAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MQSDLGKLFIGGISWDTNEERLKEYFSTYGEVLEAVIMKDRTTGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RV+KEKH IDGR VEAKKAVPRDDQ+ I+R++  IQGSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DRVIKEKHNIDGRMVEAKKAVPRDDQSTISRSSTSIQGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L KT
Sbjct  121  DFKTYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLKT  167



>gb|KEH28480.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=493

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE L+EYF +YGEV EAVIM+DR TGRARGFGFV+F DPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLREYFSTYGEVKEAVIMKDRTTGRARGFGFVVFIDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + VV+EKH IDGR VEAKKAVPRDDQN+++R +G I GSPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DIVVQEKHNIDGRMVEAKKAVPRDDQNVLSRTSGSIHGSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDQVLLKT  167



>ref|XP_010532987.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Tarenaya 
hassleriana]
Length=485

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 157/170 (92%), Gaps = 3/170 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EECLKEYF ++GEVVEA+IM+DR+TGRARGFGFV+F+DP+VA
Sbjct  1    MQSDSGKLFIGGISWDTNEECLKEYFANFGEVVEALIMKDRSTGRARGFGFVVFSDPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR---NNGGIQGSPGPGRTKKIFVGGLASTV  549
            ERV+KEKH I+GRTVEAKKAVPRDDQN+INR   ++   QGSPG GRT+KIFVGGLAS+V
Sbjct  61   ERVIKEKHSINGRTVEAKKAVPRDDQNIINRSANSSNTPQGSPGGGRTRKIFVGGLASSV  120

Query  550  TENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            TE DF+ YF+QFGT+TDVVVMYDHNTQRPRGFGFITYDSE+AVD+AL KT
Sbjct  121  TETDFRKYFEQFGTMTDVVVMYDHNTQRPRGFGFITYDSEEAVDKALVKT  170



>ref|XP_010112801.1| DAZ-associated protein 1 [Morus notabilis]
 gb|EXC34916.1| DAZ-associated protein 1 [Morus notabilis]
Length=603

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT EE LKEYF +YGEVVEAVIM+DR TGRARGFGFV+FADP+VA
Sbjct  103  MQSDNGKLFIGGISWDTSEERLKEYFSAYGEVVEAVIMKDRTTGRARGFGFVVFADPSVA  162

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ EKH IDGR VEAKKAVPRD+Q++++R +  IQGSPGPGRT+KIFVGGLASTVTE+
Sbjct  163  ERVIMEKHNIDGRMVEAKKAVPRDEQSILSRTSSSIQGSPGPGRTRKIFVGGLASTVTES  222

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  223  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  269



>gb|KJB62964.1| hypothetical protein B456_009G446000 [Gossypium raimondii]
 gb|KJB62965.1| hypothetical protein B456_009G446000 [Gossypium raimondii]
 gb|KJB62967.1| hypothetical protein B456_009G446000 [Gossypium raimondii]
Length=471

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEA+IMRDR TGRARGFGFV+FAD AVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGEVVEAMIMRDRVTGRARGFGFVVFADSAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGR VEAKKAVPRDDQ ++NRN  G+ GS G G+TKKIFVGGLASTVTE 
Sbjct  61   ERVIMDKHMIDGRKVEAKKAVPRDDQIVLNRNVVGVTGSTGIGQTKKIFVGGLASTVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  121  DFKNYFDQFGKITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLHKT  167



>gb|KJB62966.1| hypothetical protein B456_009G446000 [Gossypium raimondii]
Length=484

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEA+IMRDR TGRARGFGFV+FAD AVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGEVVEAMIMRDRVTGRARGFGFVVFADSAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGR VEAKKAVPRDDQ ++NRN  G+ GS G G+TKKIFVGGLASTVTE 
Sbjct  61   ERVIMDKHMIDGRKVEAKKAVPRDDQIVLNRNVVGVTGSTGIGQTKKIFVGGLASTVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  121  DFKNYFDQFGKITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLHKT  167



>ref|XP_009606898.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606899.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606900.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
tomentosiformis]
Length=454

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+S+LGK+F+GGISWDTDEE LKEYF +YGEV+EAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSELGKLFVGGISWDTDEERLKEYFSTYGEVIEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQG--SPGPGRTKKIFVGGLASTVT  552
            ERVVKEKH IDGR VEAKKAVPRDDQ+  ++++  I G  SPGPGR++KIFVGGLASTVT
Sbjct  61   ERVVKEKHNIDGRMVEAKKAVPRDDQSTTSKSSNSIHGSPSPGPGRSRKIFVGGLASTVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E DFK YF+QFGTITD VVMYDHNTQRPRGFGFITYDSEDAVDR L KT
Sbjct  121  EIDFKKYFEQFGTITDAVVMYDHNTQRPRGFGFITYDSEDAVDRLLLKT  169



>ref|XP_011040202.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Populus 
euphratica]
Length=477

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ LKEYFR++G+V+EAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLKEYFRAFGDVLEAVIMKDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGR VEAKKAVPR+DQ+ + +N+  I GSPGP RTKKIFVGGLASTVT++
Sbjct  61   ERVVMEKHLIDGRNVEAKKAVPREDQSTLIKNSSSINGSPGPARTKKIFVGGLASTVTDS  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  DFKKYFDQFGVIIDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  167



>gb|KHG26657.1| RNA-binding Musashi Rbp6 [Gossypium arboreum]
Length=471

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YG VVEA+IMRDR TGRARGFGFV+FAD AVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGAVVEAMIMRDRVTGRARGFGFVVFADSAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGR VEAKKAVPRDDQ ++NRN  G+ GS G GRTKKIFVGGLASTVTE 
Sbjct  61   ERVIMDKHMIDGRKVEAKKAVPRDDQIVLNRNVVGVTGSTGIGRTKKIFVGGLASTVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  121  DFKNYFDQFGKITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLHKT  167



>ref|XP_008463611.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
 ref|XP_008463613.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Cucumis 
melo]
Length=476

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  208  DLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERV  387
            D GK+FIGGISWDTDE+ L+EYFR++GEVVE +IMRDR TGRARGFGFV+FADP  A RV
Sbjct  2    DPGKLFIGGISWDTDEDRLREYFRNFGEVVEVMIMRDRTTGRARGFGFVVFADPVAAARV  61

Query  388  VKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFK  567
            V EKH+IDGRTVEAKKAVPRDDQN+++RNN GI GSPGP RTKKIFVGGLASTVTE+DFK
Sbjct  62   VLEKHVIDGRTVEAKKAVPRDDQNILSRNNTGILGSPGPTRTKKIFVGGLASTVTESDFK  121

Query  568  NYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
             YFDQFGTI DVVVMYDHNTQRPRGFGFITY+SE++V++ LYKT
Sbjct  122  KYFDQFGTIVDVVVMYDHNTQRPRGFGFITYESEESVEKVLYKT  165


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    E   K+YF  +G +V+ V+M D NT R RGFGF+ +      E+V+ K
Sbjct  105  KIFVGGLASTVTESDFKKYFDQFGTIVDVVVMYDHNTQRPRGFGFITYESEESVEKVLYK  164

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRN  474
              H ++G+ VE K+AVP++   + NRN
Sbjct  165  TFHELNGKMVEVKRAVPKESSPVPNRN  191



>ref|XP_004139532.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Cucumis 
sativus]
 gb|KGN65038.1| hypothetical protein Csa_1G181500 [Cucumis sativus]
Length=477

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  208  DLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERV  387
            D GK+FIGGISWDTDE+ L+EYFR++GEVVE +IMRDR TGRARGFGFV+FADP  A RV
Sbjct  2    DPGKLFIGGISWDTDEDRLREYFRNFGEVVEVMIMRDRATGRARGFGFVVFADPVAAARV  61

Query  388  VKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFK  567
            V EKH+IDGRTVEAKKAVPRDDQN+++RNN GI GSPGP RTKKIFVGGLASTVTE+DFK
Sbjct  62   VLEKHVIDGRTVEAKKAVPRDDQNILSRNNTGILGSPGPTRTKKIFVGGLASTVTESDFK  121

Query  568  NYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
             YFDQFGTI DVVVMYDHNTQRPRGFGFITY+SE++V++ LYKT
Sbjct  122  KYFDQFGTIVDVVVMYDHNTQRPRGFGFITYESEESVEKVLYKT  165


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    E   K+YF  +G +V+ V+M D NT R RGFGF+ +      E+V+ K
Sbjct  105  KIFVGGLASTVTESDFKKYFDQFGTIVDVVVMYDHNTQRPRGFGFITYESEESVEKVLYK  164

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRN  474
              H ++G+ VE K+AVP++   + NRN
Sbjct  165  TFHELNGKMVEVKRAVPKESSPVPNRN  191



>ref|XP_002532010.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
 gb|EEF30383.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
Length=484

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGFV+FAD AVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFGSFGEVVEAVIMKDRTTGRARGFGFVVFADAAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNG-GIQGSPGPGRTKKIFVGGLASTVTE  555
            ERV+ EKH IDGR VEAKKAVPRDDQN++NR+ G  I GSPGPGRT+KIFVGGLASTVTE
Sbjct  61   ERVIMEKHNIDGRMVEAKKAVPRDDQNILNRSTGSSIHGSPGPGRTRKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
             DF+ YF+Q+GTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  TDFRKYFEQYGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLMKT  168



>ref|XP_010057821.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Eucalyptus 
grandis]
 gb|KCW75151.1| hypothetical protein EUGRSUZ_E03898 [Eucalyptus grandis]
Length=467

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+F+GGISWDT+E+ L++YF+++GEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEMDHGKLFVGGISWDTNEDRLRDYFQNFGEVVEAVIMRDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGRTVEAKKAVPRDD N++ RNN  I  SPGP RTKKIFVGGL ST+TE+
Sbjct  61   ERVVMEKHVIDGRTVEAKKAVPRDDHNILIRNNRSIS-SPGPTRTKKIFVGGLPSTITES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVDR LYKT
Sbjct  120  DFKKYFDQFGIITDVVVMYDHNTQRPRGFGFITYDSEDAVDRVLYKT  166



>ref|XP_010524610.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Tarenaya 
hassleriana]
 ref|XP_010524611.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Tarenaya 
hassleriana]
Length=473

 Score =   282 bits (721),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 153/169 (91%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVIM+DR TGRARGFGF++FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVIMKDRTTGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNN--GGIQGSPGPGRTKKIFVGGLASTVT  552
            ERV+KEKH IDGR VEAK+AVPRDDQN+I+R+N    IQGSPGPGRT+KIFVGGL S+VT
Sbjct  61   ERVIKEKHNIDGRMVEAKRAVPRDDQNIISRSNQSSSIQGSPGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKKYFQQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_010909449.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
 ref|XP_010909450.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
 ref|XP_010909451.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Elaeis 
guineensis]
Length=476

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESD GK+FIGGISWDT+E+ L+EYF+S+GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MESDNGKLFIGGISWDTNEDRLREYFKSFGEVVEAVIMKDRITGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGR VEAKKAVPR+DQ+M++RN+    GSP PGRTKKIFVGGLASTVTE 
Sbjct  61   ERVVLEKHLIDGRMVEAKKAVPREDQHMLHRNSSSAHGSPVPGRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNTQRPRGFGFIT+ SED+ D+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITFASEDSADKVLLKT  167


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ FA    A++V+ K
Sbjct  107  KIFVGGLASTVTEADFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITFASEDSADKVLLK  166

Query  394  EKHMIDGRTVEAKKAVPRD  450
              H ++G+ VE KKAVP++
Sbjct  167  TFHELNGKMVEVKKAVPKE  185



>gb|KJB62968.1| hypothetical protein B456_009G446000 [Gossypium raimondii]
Length=503

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE LKEYF  YGEVVEA+IMRDR TGRARGFGFV+FAD AVA
Sbjct  1    MESDLGKLFIGGISWDTDEERLKEYFGKYGEVVEAMIMRDRVTGRARGFGFVVFADSAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ +KHMIDGR VEAKKAVPRDDQ ++NRN  G+ GS G G+TKKIFVGGLASTVTE 
Sbjct  61   ERVIMDKHMIDGRKVEAKKAVPRDDQIVLNRNVVGVTGSTGIGQTKKIFVGGLASTVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFKNYFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  121  DFKNYFDQFGKITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLHKT  167



>ref|XP_004293449.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011460101.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=471

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+E+ LKEYF ++GEVVEAVIM+DR TGRARGFGFV+FADP +A
Sbjct  1    MQSDSGKLFIGGISWDTNEDRLKEYFSTFGEVVEAVIMKDRTTGRARGFGFVVFADPTIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            + V+ EKH IDGR VEAKKAVPRDDQN+++R+   IQGSPGPGRT+KIFVGGLASTVTE 
Sbjct  61   DTVIMEKHNIDGRMVEAKKAVPRDDQNILSRSTVSIQGSPGPGRTRKIFVGGLASTVTEG  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK+YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  DFKSYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKT  167



>ref|XP_007049271.1| HnRNP isoform 1 [Theobroma cacao]
 gb|EOX93428.1| HnRNP isoform 1 [Theobroma cacao]
Length=477

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  SDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAER  384
            S+ GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGFV+F+DPAVAER
Sbjct  2    SENGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVAER  61

Query  385  VVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDF  564
            V+KEKH IDGR VEAKKAVPRDDQN++ R+   I  SPGPGRT+KIFVGGLASTVTE+DF
Sbjct  62   VIKEKHNIDGRMVEAKKAVPRDDQNIMGRSTSSIHASPGPGRTRKIFVGGLASTVTESDF  121

Query  565  KNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            K YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVDR L K
Sbjct  122  KKYFDQFGNITDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLLK  165



>ref|XP_006346780.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=470

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 156/167 (93%), Gaps = 3/167 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MES  GKVF+GGISWDT+++ L+EYF+++G+VVEAVIM+DR TGRARGFGFV+FADP++A
Sbjct  1    MES--GKVFVGGISWDTNDDRLREYFQAFGDVVEAVIMKDRITGRARGFGFVVFADPSIA  58

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E+VVKEKH+IDGRTVEAKKAVPRDDQ+ +NR NG IQGSPGP RT+KIFVGGLAS+VTE+
Sbjct  59   EKVVKEKHIIDGRTVEAKKAVPRDDQH-VNRTNGSIQGSPGPARTRKIFVGGLASSVTES  117

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD  L+KT
Sbjct  118  DFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDNVLFKT  164



>ref|XP_009361093.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=476

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+FIGGISWDTDEE LKEYFR YGEVVEAVIMRDR TGRARGFGFV+FADPAVA
Sbjct  1    MEPDHGKLFIGGISWDTDEERLKEYFRKYGEVVEAVIMRDRVTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMID RTVEAKKAVP++DQ+++NR  G + GS  PG  KKIFVGGLASTVTE+
Sbjct  61   ERVVMDKHMIDCRTVEAKKAVPKEDQHILNR-TGVVNGSSSPGSKKKIFVGGLASTVTES  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  120  DFKKYFDQFGTVTDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  166



>ref|XP_008776925.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Phoenix dactylifera]
Length=489

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDT+E+ L+EYF++YGEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTNEDRLREYFKTYGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ E H+IDGR VE KKAVPR DQ+++NRNN  I GSPGPGRTKKIFVGGL   +TE+
Sbjct  61   ERVLMEMHVIDGRKVEVKKAVPRVDQHILNRNNTSIHGSPGPGRTKKIFVGGLPPNITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFG ITDVVVMYDHNTQRPRGFGF+TYD EDAVD+ L KT
Sbjct  121  DFKKYFEQFGNITDVVVMYDHNTQRPRGFGFVTYDLEDAVDQVLLKT  167



>ref|XP_008776924.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Phoenix dactylifera]
Length=496

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDT+E+ L+EYF++YGEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MESDLGKLFIGGISWDTNEDRLREYFKTYGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ E H+IDGR VE KKAVPR DQ+++NRNN  I GSPGPGRTKKIFVGGL   +TE+
Sbjct  61   ERVLMEMHVIDGRKVEVKKAVPRVDQHILNRNNTSIHGSPGPGRTKKIFVGGLPPNITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFG ITDVVVMYDHNTQRPRGFGF+TYD EDAVD+ L KT
Sbjct  121  DFKKYFEQFGNITDVVVMYDHNTQRPRGFGFVTYDLEDAVDQVLLKT  167



>ref|XP_009365188.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
 ref|XP_009365189.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Pyrus 
x bretschneideri]
Length=483

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 153/169 (91%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF  +GEVVEAVIM+DR TGRARGFGFV+F+DPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSGFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGS--PGPGRTKKIFVGGLASTVT  552
            + V+ EKH IDGR VEAKKAVPRDDQN++ R++G IQGS  PGPGRT+KIFVGGLASTVT
Sbjct  61   DGVIMEKHNIDGRMVEAKKAVPRDDQNILGRSSGSIQGSPGPGPGRTRKIFVGGLASTVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGTITDVVVMYDH+TQRPRGFGFITYDSE+AVD+ L KT
Sbjct  121  ESDFKKYFEQFGTITDVVVMYDHSTQRPRGFGFITYDSEEAVDKVLLKT  169



>emb|CDP04502.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   280 bits (715),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME + GK+FIGGISWDTDE+ L+EYF ++G+VVEAVIM+DRNTGRARGFGFV+FA+  VA
Sbjct  1    MEMESGKLFIGGISWDTDEKRLREYFEAFGDVVEAVIMKDRNTGRARGFGFVVFANAYVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVVKEKH+IDGRTVEAKKAVPRDDQ  ++R+NG IQGSP P RTKKIFVGGL STV E+
Sbjct  61   ERVVKEKHVIDGRTVEAKKAVPRDDQQNLSRSNGSIQGSPSPARTKKIFVGGLPSTVNES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNT+RPRGFGFITY+SE+AVDR L+KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTKRPRGFGFITYNSEEAVDRVLHKT  167


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 16/123 (13%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG+    +E   K+YF  +G + + V+M D NT R RGFGF+ +      +RV+ K
Sbjct  107  KIFVGGLPSTVNESDFKKYFEQFGTITDVVVMYDHNTKRPRGFGFITYNSEEAVDRVLHK  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
              H ++G+ VE K+AVP++              SPGP R+     G   + V  N+F N 
Sbjct  167  TFHELNGKMVEVKRAVPKEL-------------SPGPIRSNLSGYGHGLNRV--NNFPNA  211

Query  574  FDQ  582
            + Q
Sbjct  212  YPQ  214



>ref|XP_010035445.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Eucalyptus 
grandis]
 ref|XP_010035446.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Eucalyptus 
grandis]
 gb|KCW46850.1| hypothetical protein EUGRSUZ_K00657 [Eucalyptus grandis]
 gb|KCW46851.1| hypothetical protein EUGRSUZ_K00657 [Eucalyptus grandis]
 gb|KCW46852.1| hypothetical protein EUGRSUZ_K00657 [Eucalyptus grandis]
Length=467

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF +YGEVVEA+IM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFGAYGEVVEAIIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+K+KH IDGR VEAKKAVPRDDQN+++RN+  +  SPGPGRTKKIFVGGLASTVTE+
Sbjct  61   ERVIKDKHSIDGRMVEAKKAVPRDDQNILSRNSSSVHSSPGPGRTKKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGT+TDVVVMYDHNTQRPRGFGFITYD+EDAVD+AL  T
Sbjct  121  DFKKYFEQFGTVTDVVVMYDHNTQRPRGFGFITYDTEDAVDKALLGT  167



>ref|XP_009390837.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390838.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Musa 
acuminata subsp. malaccensis]
Length=477

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M SDLGK+F+GGISWDTDEE L+EYFR+YGEVVEAVIM+DR TGRARGFGFV+F+DP VA
Sbjct  1    MRSDLGKLFVGGISWDTDEERLREYFRNYGEVVEAVIMKDRTTGRARGFGFVVFSDPTVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E+VV EKH+IDGR VEAKKAVP+DDQ ++ RNN  +  SP  GRTKKIFVGGL ST+TE 
Sbjct  61   EQVVMEKHVIDGRMVEAKKAVPKDDQQILYRNNSNVHASPVNGRTKKIFVGGLPSTITEG  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGT+TDVVVMYDHNT+RPRGFGFITYDSEDAVD+ L+K+
Sbjct  121  DFKKYFDQFGTVTDVVVMYDHNTRRPRGFGFITYDSEDAVDKVLFKS  167



>ref|XP_010907705.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Elaeis guineensis]
Length=487

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+DLGK+FIGG+SWDTD++ L+EYFR+YGEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    METDLGKLFIGGVSWDTDDDHLREYFRTYGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+ E H+IDGR VE KKAVPR DQ+++NRNN  I GSPGP RTKKIFVGGL S +TE+
Sbjct  61   ERVLMENHIIDGRKVEVKKAVPRVDQHILNRNNTSIPGSPGPDRTKKIFVGGLPSNITES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFG ITDVVVMYDHNTQRPRGFGF+TYD EDAVD+ L KT
Sbjct  121  DFKMYFEQFGNITDVVVMYDHNTQRPRGFGFVTYDLEDAVDKVLLKT  167



>ref|XP_009397214.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=498

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = +1

Query  193  RMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPA  372
            R ME DLGK+FIGGISWDT+E+ L++YF ++GEVVEAVIM+DR TGRARGFGFV+FADPA
Sbjct  34   RRMEVDLGKLFIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPA  93

Query  373  VAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRN-NGGIQGSPGPGRTKKIFVGGLASTV  549
            V ERVV EKH IDGR VEAKKAVPRDD   +N+N +  I GSP PG TKKIFVGGL+ST+
Sbjct  94   VTERVVTEKHTIDGRMVEAKKAVPRDDHQFVNKNSSSSIHGSPVPGHTKKIFVGGLSSTI  153

Query  550  TENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRAL  690
            TE DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L
Sbjct  154  TEGDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVL  200



>gb|EAZ19017.1| hypothetical protein OsJ_34549 [Oryza sativa Japonica Group]
Length=481

 Score =   277 bits (709),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 152/181 (84%), Gaps = 14/181 (8%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+FIGGISWDT+E+ L+EYF  YGEVVEAVIMRDR TGRARGFGF++FADPAVA
Sbjct  1    MEADAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDRATGRARGFGFIVFADPAVA  60

Query  379  ERVVKEKHMIDGR--------------TVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTK  516
            ERV+ EKHMIDGR               VEAKKAVPRDDQ+ ++++ G   GSPGP RTK
Sbjct  61   ERVIMEKHMIDGRMIHDDDDGVLDPSMVVEAKKAVPRDDQHALSKSGGSAHGSPGPSRTK  120

Query  517  KIFVGGLASTVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            KIFVGGLASTVTE DF+ YF+QFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K
Sbjct  121  KIFVGGLASTVTEADFRKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFK  180

Query  697  T  699
            T
Sbjct  181  T  181



>ref|XP_009802735.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
sylvestris]
 ref|XP_009802736.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Nicotiana 
sylvestris]
Length=453

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+S+LGK+F+GGISWDTDEE LKEYF +YGEV+EAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSELGKLFVGGISWDTDEERLKEYFSTYGEVIEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGP--GRTKKIFVGGLASTVT  552
            ERVVKE+H IDGR VEAKKAVPRDDQ+  +R++  I GSP P  GRT+K+FVGGLASTVT
Sbjct  61   ERVVKERHNIDGRMVEAKKAVPRDDQSTTSRSSTSIHGSPSPGLGRTRKLFVGGLASTVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGTITD VVMYDHNTQRPRGFGFITYDSEDAVDR L KT
Sbjct  121  ESDFKKYFEQFGTITDAVVMYDHNTQRPRGFGFITYDSEDAVDRVLLKT  169



>ref|XP_010686663.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Beta 
vulgaris subsp. vulgaris]
Length=456

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT+E+ L+EYF+++GEVVEAVIM+DR TGRARGFGFVI+ADPAVAERVV+
Sbjct  4    GKLFIGGISWDTNEDRLREYFQTFGEVVEAVIMKDRATGRARGFGFVIYADPAVAERVVR  63

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            +KHMIDGRTVEAKKAVPRDDQ+++ RN+     SP P RTKKIFVGGLASTVTE DFK Y
Sbjct  64   QKHMIDGRTVEAKKAVPRDDQHILTRNHSSPSASPVPARTKKIFVGGLASTVTEGDFKRY  123

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            FDQFGTITDVVVMYDHNTQRPRGFGFIT+DSE+AV+RAL KT
Sbjct  124  FDQFGTITDVVVMYDHNTQRPRGFGFITFDSEEAVERALMKT  165



>ref|XP_004251544.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
 ref|XP_010313682.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
lycopersicum]
Length=475

 Score =   277 bits (708),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+ DLGK+F+GGISWDTD+E LKEYF +YGEVVEAVIM+DR TGRARGFGFV+FADPA A
Sbjct  1    MQVDLGKLFVGGISWDTDDERLKEYFSTYGEVVEAVIMKDRTTGRARGFGFVVFADPAAA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQG--SPGPGRTKKIFVGGLASTVT  552
            ERVVKEKH IDGR VEAK+AVPRDDQ+  +R++  I G  SPGPGRT+KIFVGGLASTVT
Sbjct  61   ERVVKEKHNIDGRMVEAKRAVPRDDQSTTSRSSPSIHGSPSPGPGRTRKIFVGGLASTVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E  FK YF+QFGTITD VVMYDHNTQRPRGFGFITYDSEDAVD+ L K+
Sbjct  121  ETAFKQYFEQFGTITDAVVMYDHNTQRPRGFGFITYDSEDAVDKVLLKS  169


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + +AV+M D NT R RGFGF+ + ++ AV + ++K
Sbjct  109  KIFVGGLASTVTETAFKQYFEQFGTITDAVVMYDHNTQRPRGFGFITYDSEDAVDKVLLK  168

Query  394  EKHMIDGRTVEAKKAVPRD  450
              H ++ + VE K+AVP++
Sbjct  169  SYHELNDKMVEVKRAVPKE  187



>ref|XP_008813343.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Phoenix 
dactylifera]
 ref|XP_008813344.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Phoenix 
dactylifera]
Length=478

 Score =   277 bits (708),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D GK+FIGGISWDT+E+ L+EYF+ +GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MELDHGKLFIGGISWDTNEDRLREYFKGFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV EKH+IDGR VEAKKAVPRDDQ +++RN+    GSP PGRTKKIFVGGLASTVTE 
Sbjct  61   ERVVTEKHLIDGRMVEAKKAVPRDDQQILHRNSSSSHGSPVPGRTKKIFVGGLASTVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF+QFGTITDVVVMYDHNT+RPRGFGFIT+ SEDA D+ L KT
Sbjct  121  DFKKYFEQFGTITDVVVMYDHNTRRPRGFGFITFGSEDAADKVLLKT  167


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ F     A++V+ K
Sbjct  107  KIFVGGLASTVTEADFKKYFEQFGTITDVVVMYDHNTRRPRGFGFITFGSEDAADKVLLK  166

Query  394  EKHMIDGRTVEAKKAVPRD  450
              H ++G+ VE KKAVP++
Sbjct  167  TFHELNGKMVEVKKAVPKE  185



>ref|XP_003594254.1| RNA-binding protein, putative [Medicago truncatula]
Length=522

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 153/169 (91%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            +E D GK+FIGGISWDT+E+ L++YF+++G+VVEAVIM+DR TGRARGFGFV+FADP+VA
Sbjct  40   VEMDPGKLFIGGISWDTNEDRLRQYFQNFGDVVEAVIMKDRTTGRARGFGFVVFADPSVA  99

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPG--RTKKIFVGGLASTVT  552
            ERVV EKH+IDGRTVEAKKAVPRDDQN+  R+N    GSP P   RTKKIFVGGLASTVT
Sbjct  100  ERVVMEKHVIDGRTVEAKKAVPRDDQNVFTRSNSSSHGSPAPTPIRTKKIFVGGLASTVT  159

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AV++ L+KT
Sbjct  160  ESDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLHKT  208



>ref|XP_006352009.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Solanum 
tuberosum]
Length=474

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+ DLGK+F+GGISWDTD+E LKEYF +YGEVVEAVIM+DR TGRARGFGFV+FADPA A
Sbjct  1    MQVDLGKLFVGGISWDTDDERLKEYFSTYGEVVEAVIMKDRTTGRARGFGFVVFADPAAA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQG--SPGPGRTKKIFVGGLASTVT  552
            ERVVKEKH IDGR VEAK+AVPRDDQ+  +R++  I G  SPGPGRT+KIFVGGLASTVT
Sbjct  61   ERVVKEKHNIDGRMVEAKRAVPRDDQSTTSRSSPSIHGSPSPGPGRTRKIFVGGLASTVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E  FK YF+QFGTITD VVMYDHNTQRPRGFGFITYDSEDAVD+ L K+
Sbjct  121  ETAFKQYFEQFGTITDAVVMYDHNTQRPRGFGFITYDSEDAVDKVLLKS  169


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + +AV+M D NT R RGFGF+ + ++ AV + ++K
Sbjct  109  KIFVGGLASTVTETAFKQYFEQFGTITDAVVMYDHNTQRPRGFGFITYDSEDAVDKVLLK  168

Query  394  EKHMIDGRTVEAKKAVPRD  450
              H ++ + VE K+AVP++
Sbjct  169  SYHELNDKMVEVKRAVPKE  187



>ref|XP_009397215.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=463

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME DLGK+FIGGISWDT+E+ L++YF ++GEVVEAVIM+DR TGRARGFGFV+FADPAV 
Sbjct  1    MEVDLGKLFIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPAVT  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRN-NGGIQGSPGPGRTKKIFVGGLASTVTE  555
            ERVV EKH IDGR VEAKKAVPRDD   +N+N +  I GSP PG TKKIFVGGL+ST+TE
Sbjct  61   ERVVTEKHTIDGRMVEAKKAVPRDDHQFVNKNSSSSIHGSPVPGHTKKIFVGGLSSTITE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRAL  690
             DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L
Sbjct  121  GDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVL  165



>gb|AES64505.2| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=481

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +1

Query  208  DLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERV  387
            D GK+FIGGISWDT+E+ L++YF+++G+VVEAVIM+DR TGRARGFGFV+FADP+VAERV
Sbjct  2    DPGKLFIGGISWDTNEDRLRQYFQNFGDVVEAVIMKDRTTGRARGFGFVVFADPSVAERV  61

Query  388  VKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPG--RTKKIFVGGLASTVTEND  561
            V EKH+IDGRTVEAKKAVPRDDQN+  R+N    GSP P   RTKKIFVGGLASTVTE+D
Sbjct  62   VMEKHVIDGRTVEAKKAVPRDDQNVFTRSNSSSHGSPAPTPIRTKKIFVGGLASTVTESD  121

Query  562  FKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            FKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AV++ L+KT
Sbjct  122  FKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLHKT  167



>ref|XP_006657892.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Oryza 
brachyantha]
Length=471

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+EYF  +GEV EAVIMRDRNTGRARGFGFV+F+DP VA
Sbjct  1    MEADSGKLFVGGISWETDEDRLREYFGRFGEVTEAVIMRDRNTGRARGFGFVVFSDPGVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NNG   GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTMDKHMIDGRMVEAKKAVPRDDQSITSKNNGSSIGSPGPGRTRKIFVGGLASNVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K
Sbjct  121  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHK  166



>ref|XP_004140014.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Cucumis 
sativus]
 gb|KGN46587.1| hypothetical protein Csa_6G110300 [Cucumis sativus]
Length=476

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M++D GK+F+GGISWDTDE+ LKEYF +YG+VVEAVIM+DR TGR RGFGF++FADP+VA
Sbjct  1    MQTDSGKLFVGGISWDTDEDRLKEYFNAYGDVVEAVIMKDRTTGRGRGFGFIVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RV++EKH IDGR VEAK+AVPR+DQN++ R +G I  SPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DRVIREKHNIDGRMVEAKRAVPRNDQNIVGRTSGSINVSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +FKNYFDQFGTITDVVVMYDHNT RPRGFGFITYDSE+AV++ L KT
Sbjct  121  EFKNYFDQFGTITDVVVMYDHNTLRPRGFGFITYDSEEAVEKVLIKT  167



>gb|ABF70162.1| RNA-binding protein, putative [Musa acuminata]
Length=465

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME DLGK+FIGGISWDT+E+ L++YF ++GEVVEAVIM+DR TGRARGFGFV+FADPAV 
Sbjct  1    MEVDLGKLFIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPAVT  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRN-NGGIQGSPGPGRTKKIFVGGLASTVTE  555
            ERVV EKH IDGR VEAKKAVPRDD   +N+N +  I GSP PG TKKIFVGGL+ST+TE
Sbjct  61   ERVVTEKHTIDGRMVEAKKAVPRDDHQFLNKNSSSSIHGSPVPGHTKKIFVGGLSSTITE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRAL  690
             DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVD+ L
Sbjct  121  GDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVL  165



>ref|XP_008464191.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Cucumis 
melo]
Length=476

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M++D GK+F+GGISWDTDE+ LKEYF +YG+VVEAVIM+DR TGR RGFGF++FADP+VA
Sbjct  1    MQTDSGKLFVGGISWDTDEDRLKEYFNAYGDVVEAVIMKDRTTGRGRGFGFIVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            +RV++EKH IDGR VEAK+AVPR+DQN++ R +G I  SPGPGRT+KIFVGGLASTVTE+
Sbjct  61   DRVIREKHNIDGRMVEAKRAVPRNDQNIVGRTSGSINVSPGPGRTRKIFVGGLASTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +FKNYFDQFGTITDVVVMYDHNT RPRGFGFITYDSE+AV++ L KT
Sbjct  121  EFKNYFDQFGTITDVVVMYDHNTLRPRGFGFITYDSEEAVEKVLIKT  167



>ref|XP_004958148.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Setaria 
italica]
Length=471

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+EYF  +GEV EAVIMRDRNTGRARGFGFV+FAD AVA
Sbjct  1    MEADSGKLFVGGISWETDEDRLREYFGRFGEVTEAVIMRDRNTGRARGFGFVVFADSAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NNG   GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTTDKHMIDGRMVEAKKAVPRDDQSIASKNNGSSIGSPGPGRTRKIFVGGLASNVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K
Sbjct  121  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHK  166



>ref|XP_010557774.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Tarenaya 
hassleriana]
Length=475

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWD +EE LKEYF S+GEV+EAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDANEERLKEYFSSFGEVIEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            +RV+KEKH IDGR VEAKKAVPRDDQN+++R N+  +QGSPGPGRT+KIFVGGL S+VTE
Sbjct  61   DRVIKEKHNIDGRMVEAKKAVPRDDQNIVSRSNHSSVQGSPGPGRTRKIFVGGLPSSVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DF+ YF+QFGT TDVVVMYDHNTQRPRGFGFITY+ E+AV++ L KT
Sbjct  121  SDFRKYFEQFGTTTDVVVMYDHNTQRPRGFGFITYEDEEAVEKVLLKT  168



>gb|AAK92717.1| putative RNA-binding protein [Arabidopsis thaliana]
Length=494

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPSGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|NP_566321.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAL32012.1|AF436830_1 AT3g07810/F17A17_15 [Arabidopsis thaliana]
 gb|AAN12995.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AEE74606.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=494

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_002882552.1| hypothetical protein ARALYDRAFT_478119 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58811.1| hypothetical protein ARALYDRAFT_478119 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>gb|AAF21191.1|AC013483_15 putative RNA-binding protein [Arabidopsis thaliana]
Length=492

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|NP_850539.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE74607.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=495

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_010464424.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Camelina sativa]
Length=495

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADP+VA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_010464421.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010464423.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
Length=496

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADP+VA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_010457881.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010457959.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADP+VA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_004486327.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Cicer arietinum]
Length=478

 Score =   275 bits (702),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +1

Query  208  DLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERV  387
            D GK+FIGGISWDT+E+ L++YF+++G+VVEAVIM+DR TGRARGFGFV+FADP+VAERV
Sbjct  2    DPGKLFIGGISWDTNEDRLRQYFQNFGDVVEAVIMKDRTTGRARGFGFVVFADPSVAERV  61

Query  388  VKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPG--RTKKIFVGGLASTVTEND  561
            V EKH+IDGRTVEAKKAVPRDDQN+ +++N    GSPGP   RTKKIFVGGLASTVTE+D
Sbjct  62   VMEKHVIDGRTVEAKKAVPRDDQNVFSKSNSSGHGSPGPAPIRTKKIFVGGLASTVTESD  121

Query  562  FKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            FK+YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AV++ L+KT
Sbjct  122  FKSYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLHKT  167



>ref|XP_004486326.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Cicer arietinum]
Length=484

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +1

Query  208  DLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERV  387
            D GK+FIGGISWDT+E+ L++YF+++G+VVEAVIM+DR TGRARGFGFV+FADP+VAERV
Sbjct  2    DPGKLFIGGISWDTNEDRLRQYFQNFGDVVEAVIMKDRTTGRARGFGFVVFADPSVAERV  61

Query  388  VKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPG--RTKKIFVGGLASTVTEND  561
            V EKH+IDGRTVEAKKAVPRDDQN+ +++N    GSPGP   RTKKIFVGGLASTVTE+D
Sbjct  62   VMEKHVIDGRTVEAKKAVPRDDQNVFSKSNSSGHGSPGPAPIRTKKIFVGGLASTVTESD  121

Query  562  FKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            FK+YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AV++ L+KT
Sbjct  122  FKSYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLHKT  167



>ref|XP_010458039.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Camelina sativa]
Length=494

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADP+VA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_006297510.1| hypothetical protein CARUB_v10013535mg [Capsella rubella]
 gb|EOA30408.1| hypothetical protein CARUB_v10013535mg [Capsella rubella]
Length=495

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFGSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_010486352.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010486353.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Camelina sativa]
 ref|XP_010486354.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X3 [Camelina sativa]
Length=496

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADP+VA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_004236665.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
 ref|XP_010319226.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Solanum 
lycopersicum]
Length=469

 Score =   274 bits (701),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 155/166 (93%), Gaps = 4/166 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MES  GKVF+GGISWDT+++ L+EYF+++G+VVEAVIM+DR TGRARGFGFV+FADP++A
Sbjct  1    MES--GKVFVGGISWDTNDDRLREYFQAFGDVVEAVIMKDRITGRARGFGFVVFADPSIA  58

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E+VVKEKH+IDGRTVEAKKAVPRDDQ+ +NR NG IQGSPGP RT+KIFVGGLAS+VTE+
Sbjct  59   EKVVKEKHIIDGRTVEAKKAVPRDDQH-VNR-NGSIQGSPGPARTRKIFVGGLASSVTES  116

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +FK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD  LYK
Sbjct  117  EFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDSVLYK  162



>gb|KHG03317.1| RNA-binding Musashi [Gossypium arboreum]
Length=484

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+F+DPAVAERV+ 
Sbjct  5    GKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVAERVIL  64

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            EKH IDGR VEAKKAVPRDDQN+++R+     GSPGPGRTKKIFVGGLASTVTE+DFK Y
Sbjct  65   EKHNIDGRMVEAKKAVPRDDQNIMSRSTSSTHGSPGPGRTKKIFVGGLASTVTESDFKKY  124

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            FDQFG ITDVVVMYDHNTQRPRGFGFITYD E+AV++ L K
Sbjct  125  FDQFGNITDVVVMYDHNTQRPRGFGFITYDLEEAVEKVLLK  165



>ref|XP_006407794.1| hypothetical protein EUTSA_v10020586mg [Eutrema salsugineum]
 gb|ESQ49247.1| hypothetical protein EUTSA_v10020586mg [Eutrema salsugineum]
Length=494

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQN++NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNIVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_006407795.1| hypothetical protein EUTSA_v10020586mg [Eutrema salsugineum]
 gb|ESQ49248.1| hypothetical protein EUTSA_v10020586mg [Eutrema salsugineum]
Length=495

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSP-GPGRTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQN++NR N+  IQGSP GPGRT+KIFVGGL S+VT
Sbjct  61   EIVITEKHNIDGRLVEAKKAVPRDDQNIVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>gb|KJB42766.1| hypothetical protein B456_007G167500 [Gossypium raimondii]
 gb|KJB42769.1| hypothetical protein B456_007G167500 [Gossypium raimondii]
 gb|KJB42770.1| hypothetical protein B456_007G167500 [Gossypium raimondii]
 gb|KJB42773.1| hypothetical protein B456_007G167500 [Gossypium raimondii]
Length=477

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+F+DPAVAERV+ 
Sbjct  5    GKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVAERVIL  64

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            EKH IDGR VEAKKAVPRDDQN+++R+     GSPGPGRTKKIFVGGLASTVTE+DFK Y
Sbjct  65   EKHNIDGRMVEAKKAVPRDDQNIMSRSTSSTHGSPGPGRTKKIFVGGLASTVTESDFKKY  124

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            FDQFG ITDVVVMYDHNTQRPRGFGFITYD E+AV++ L K
Sbjct  125  FDQFGNITDVVVMYDHNTQRPRGFGFITYDLEEAVEKVLLK  165



>gb|KJB42767.1| hypothetical protein B456_007G167500 [Gossypium raimondii]
 gb|KJB42768.1| hypothetical protein B456_007G167500 [Gossypium raimondii]
Length=479

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+F+DPAVAERV+ 
Sbjct  5    GKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVAERVIL  64

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            EKH IDGR VEAKKAVPRDDQN+++R+     GSPGPGRTKKIFVGGLASTVTE+DFK Y
Sbjct  65   EKHNIDGRMVEAKKAVPRDDQNIMSRSTSSTHGSPGPGRTKKIFVGGLASTVTESDFKKY  124

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            FDQFG ITDVVVMYDHNTQRPRGFGFITYD E+AV++ L K
Sbjct  125  FDQFGNITDVVVMYDHNTQRPRGFGFITYDLEEAVEKVLLK  165



>ref|XP_006395215.1| hypothetical protein EUTSA_v10004139mg [Eutrema salsugineum]
 ref|XP_006395216.1| hypothetical protein EUTSA_v10004139mg [Eutrema salsugineum]
 gb|ESQ32501.1| hypothetical protein EUTSA_v10004139mg [Eutrema salsugineum]
 gb|ESQ32502.1| hypothetical protein EUTSA_v10004139mg [Eutrema salsugineum]
Length=472

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 150/169 (89%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEELLKEYFSSFGEVIEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR--NNGGIQGSPGPGRTKKIFVGGLASTVT  552
            E VVKEKH IDGR VEAKKAVPRDD N+INR  N+  IQGSPG GRTKKIFVGGL S+VT
Sbjct  61   ETVVKEKHNIDGRLVEAKKAVPRDDLNIINRSSNSNSIQGSPGSGRTKKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF++FGT TDVVVM+D NTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKMYFEEFGTTTDVVVMFDQNTQRPRGFGFITYDSEEAVEKVLLKT  169



>gb|KJB42772.1| hypothetical protein B456_007G167500 [Gossypium raimondii]
Length=477

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+F+DPAVAERV+ 
Sbjct  5    GKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVAERVIL  64

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            EKH IDGR VEAKKAVPRDDQN+++R+     GSPGPGRTKKIFVGGLASTVTE+DFK Y
Sbjct  65   EKHNIDGRMVEAKKAVPRDDQNIMSRSTSSTHGSPGPGRTKKIFVGGLASTVTESDFKKY  124

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            FDQFG ITDVVVMYDHNTQRPRGFGFITYD E+AV++ L K
Sbjct  125  FDQFGNITDVVVMYDHNTQRPRGFGFITYDLEEAVEKVLLK  165



>gb|EYU33847.1| hypothetical protein MIMGU_mgv1a008238mg [Erythranthe guttata]
Length=380

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  208  DLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERV  387
            + GK+F+GGISW+T EE L+EYF ++G+VVEAVIM+DR TGRARGFGFV+FA+ +V+ERV
Sbjct  2    EAGKLFVGGISWETSEERLREYFEAFGQVVEAVIMKDRTTGRARGFGFVVFANASVSERV  61

Query  388  VKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFK  567
            V+E+H+IDGRTVEAKKAVPRDD    NRN  G  GSPGP RT+KIFVGGLASTVT+ DFK
Sbjct  62   VRERHIIDGRTVEAKKAVPRDDHQNFNRNTNGPHGSPGPARTRKIFVGGLASTVTDKDFK  121

Query  568  NYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  122  SYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLFKT  165


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    ++  K YF  +G + + V+M D NT R RGFGF+ + ++ AV + + K
Sbjct  105  KIFVGGLASTVTDKDFKSYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLFK  164

Query  394  EKHMIDGRTVEAKKAVPRD  450
              H ++G+TVE K+AVP++
Sbjct  165  TFHELNGKTVEVKRAVPKE  183



>ref|XP_002460931.1| hypothetical protein SORBIDRAFT_02g037690 [Sorghum bicolor]
 gb|EER97452.1| hypothetical protein SORBIDRAFT_02g037690 [Sorghum bicolor]
Length=471

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+EYF  +GEV EAVIMRDRNTGRARGFGFV+FAD  +A
Sbjct  1    MEADSGKLFVGGISWETDEDRLREYFGRFGEVTEAVIMRDRNTGRARGFGFVVFADSGIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NNG   GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTMDKHMIDGRMVEAKKAVPRDDQSIASKNNGSSIGSPGPGRTRKIFVGGLASNVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K
Sbjct  121  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHK  166



>gb|KHG15677.1| DAZ-associated 1 [Gossypium arboreum]
Length=477

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT+E  LKEYF ++GEV+EAVIM+DR TGRARGFGFV+FADP VAERVVK
Sbjct  5    GKLFIGGISWDTNEGHLKEYFNTFGEVIEAVIMKDRTTGRARGFGFVVFADPIVAERVVK  64

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            EKH IDGR VEAKKAVPRDDQN+++R+   I GSPGPG T+KIFVGGLASTVTE+DFK Y
Sbjct  65   EKHSIDGRIVEAKKAVPRDDQNVMSRSTSSIHGSPGPGNTRKIFVGGLASTVTESDFKKY  124

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            FDQFG ITDVVVMYD NTQRPRGFGFITYDSE+AVD+ L K
Sbjct  125  FDQFGNITDVVVMYDQNTQRPRGFGFITYDSEEAVDKVLLK  165



>ref|XP_010545264.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Tarenaya hassleriana]
Length=448

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 3/172 (2%)
 Frame = +1

Query  193  RMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPA  372
            + MESDLGK+FIGGISWDTDEE L+EYF  YGEVVEAVIMRDR TGRARGFGF++FAD +
Sbjct  3    KKMESDLGKLFIGGISWDTDEERLREYFSKYGEVVEAVIMRDRATGRARGFGFIVFADFS  62

Query  373  VAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQG-SPGP--GRTKKIFVGGLAS  543
            VAERV+ EKHMIDGRTVEAKKAVPRDDQ  + R++  I   SPG   G+TKKIFVGGL S
Sbjct  63   VAERVIMEKHMIDGRTVEAKKAVPRDDQQALKRHSSPIHHMSPGHGGGKTKKIFVGGLPS  122

Query  544  TVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
             +TE +FKNYFDQFGTI+DVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  123  NITEAEFKNYFDQFGTISDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  174


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG+  +  E   K YF  +G + + V+M D NT R RGFGF+ +      +RV+ K
Sbjct  114  KIFVGGLPSNITEAEFKNYFDQFGTISDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHK  173

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRN  474
              H ++G+ VE K+AVP++     NR+
Sbjct  174  TFHELNGKMVEVKRAVPKELSLTPNRS  200



>gb|KJB42771.1| hypothetical protein B456_007G167500 [Gossypium raimondii]
Length=490

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT+EE LKEYF ++GEVVEAVIM+DR TGRARGFGFV+F+DPAVAERV+ 
Sbjct  5    GKLFIGGISWDTNEERLKEYFSTFGEVVEAVIMKDRTTGRARGFGFVVFSDPAVAERVIL  64

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            EKH IDGR VEAKKAVPRDDQN+++R+     GSPGPGRTKKIFVGGLASTVTE+DFK Y
Sbjct  65   EKHNIDGRMVEAKKAVPRDDQNIMSRSTSSTHGSPGPGRTKKIFVGGLASTVTESDFKKY  124

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            FDQFG ITDVVVMYDHNTQRPRGFGFITYD E+AV++ L K
Sbjct  125  FDQFGNITDVVVMYDHNTQRPRGFGFITYDLEEAVEKVLLK  165



>ref|NP_001060120.1| Os07g0584500 [Oryza sativa Japonica Group]
 dbj|BAC55617.2| putative heterogeneous nuclear ribonucleoprotein A1 [Oryza sativa 
Japonica Group]
 dbj|BAF22034.1| Os07g0584500 [Oryza sativa Japonica Group]
 dbj|BAG90564.1| unnamed protein product [Oryza sativa Japonica Group]
Length=472

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+EYF  +GEV EAVIMRDRNTGRARGFGFV+F D  VA
Sbjct  1    MEADSGKLFVGGISWETDEDRLREYFSRFGEVTEAVIMRDRNTGRARGFGFVVFTDAGVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NNG   GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTMDKHMIDGRMVEAKKAVPRDDQSITSKNNGSSIGSPGPGRTRKIFVGGLASNVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K
Sbjct  121  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHK  166



>ref|XP_010545265.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010545266.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Tarenaya hassleriana]
Length=444

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 149/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L+EYF  YGEVVEAVIMRDR TGRARGFGF++FAD +VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLREYFSKYGEVVEAVIMRDRATGRARGFGFIVFADFSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQG-SPGP--GRTKKIFVGGLASTV  549
            ERV+ EKHMIDGRTVEAKKAVPRDDQ  + R++  I   SPG   G+TKKIFVGGL S +
Sbjct  61   ERVIMEKHMIDGRTVEAKKAVPRDDQQALKRHSSPIHHMSPGHGGGKTKKIFVGGLPSNI  120

Query  550  TENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            TE +FKNYFDQFGTI+DVVVMYDHNTQRPRGFGFITYDSE+AVDR L+KT
Sbjct  121  TEAEFKNYFDQFGTISDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHKT  170


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVV-K  393
            K+F+GG+  +  E   K YF  +G + + V+M D NT R RGFGF+ +      +RV+ K
Sbjct  110  KIFVGGLPSNITEAEFKNYFDQFGTISDVVVMYDHNTQRPRGFGFITYDSEEAVDRVLHK  169

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRN  474
              H ++G+ VE K+AVP++     NR+
Sbjct  170  TFHELNGKMVEVKRAVPKELSLTPNRS  196



>gb|KJB10272.1| hypothetical protein B456_001G193100 [Gossypium raimondii]
 gb|KJB10273.1| hypothetical protein B456_001G193100 [Gossypium raimondii]
Length=476

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  SDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAER  384
            S+ GK+FIGGISWDT+E+ LKEYF SYGEVVEAVIM+DR TGRARGFGFV+FADPAV++R
Sbjct  2    SENGKLFIGGISWDTNEQRLKEYFDSYGEVVEAVIMKDRTTGRARGFGFVVFADPAVSDR  61

Query  385  VVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDF  564
            V+KEKH IDGR VEAKKAVPRD+QN+++R+   I GS GPGR +KIFVGGLASTVTE+DF
Sbjct  62   VIKEKHNIDGRMVEAKKAVPRDEQNIMSRSTSSIHGSLGPGRARKIFVGGLASTVTESDF  121

Query  565  KNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            K YFDQFG ITDVVVMYDHNTQRPRGFGFI+YDSE+AVD+ L K
Sbjct  122  KKYFDQFGNITDVVVMYDHNTQRPRGFGFISYDSEEAVDQVLLK  165


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ + ++ AV + ++K
Sbjct  106  KIFVGGLASTVTESDFKKYFDQFGNITDVVVMYDHNTQRPRGFGFISYDSEEAVDQVLLK  165

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGG  483
            + H ++G+ VE K+AVP++   + +R++ G
Sbjct  166  KFHELNGKMVEVKRAVPKELSPVSSRSSLG  195



>ref|XP_003562808.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Brachypodium 
distachyon]
Length=472

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDEE L+EYF  +GEV EAVIMRDRNTGRARGFGF++FA+P VA
Sbjct  1    MEADSGKLFVGGISWETDEERLREYFGRFGEVTEAVIMRDRNTGRARGFGFIVFAEPGVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NNG   GSPGP RT+KIFVGGLAS VTE 
Sbjct  61   ERVTMDKHMIDGRMVEAKKAVPRDDQSIASKNNGSSIGSPGPVRTRKIFVGGLASNVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K 
Sbjct  121  EFRRYFEQFGMITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHKN  167



>gb|KHG02993.1| DAZ-associated 1 [Gossypium arboreum]
Length=494

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  SDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAER  384
            S+ GK+FIGGISWDT+E+ LKEYF SYGEVVEAVIM+DR TGRARGFGFV+FADPAV++R
Sbjct  2    SEYGKLFIGGISWDTNEQRLKEYFDSYGEVVEAVIMKDRTTGRARGFGFVVFADPAVSDR  61

Query  385  VVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDF  564
            V+KEKH IDGR VEAKKAVPRD+QN+++R+   I GS GPGR +KIFVGGLASTVTE+DF
Sbjct  62   VIKEKHNIDGRMVEAKKAVPRDEQNIMSRSTSSIHGSLGPGRARKIFVGGLASTVTESDF  121

Query  565  KNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            K YFDQFG ITDVVVMYDHNTQRPRGFGFI+YDSE+AVD+ L K
Sbjct  122  KKYFDQFGNITDVVVMYDHNTQRPRGFGFISYDSEEAVDQVLLK  165


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G + + V+M D NT R RGFGF+ + ++ AV + ++K
Sbjct  106  KIFVGGLASTVTESDFKKYFDQFGNITDVVVMYDHNTQRPRGFGFISYDSEEAVDQVLLK  165

Query  394  EKHMIDGRTVEAKKAVPRD  450
            + H ++G+ VE K+AVP++
Sbjct  166  KFHELNGKMVEVKRAVPKE  184



>gb|EEC82342.1| hypothetical protein OsI_26646 [Oryza sativa Indica Group]
Length=472

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+EYF  +GEV EAVIMRDRNTGRARGFGFV+F D  VA
Sbjct  1    MEADSGKLFVGGISWETDEDRLREYFGRFGEVTEAVIMRDRNTGRARGFGFVVFTDAGVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NNG   GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTMDKHMIDGRMVEAKKAVPRDDQSITSKNNGSSIGSPGPGRTRKIFVGGLASNVTEV  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K
Sbjct  121  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHK  166



>ref|XP_009147022.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Brassica rapa]
Length=500

 Score =   273 bits (697),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF ++GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSPGPG-RTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+ R N+  IQGSPGPG RT+KIFVGGL S+VT
Sbjct  61   EFVITEKHHIDGRLVEAKKAVPRDDQNMVTRSNSSSIQGSPGPGARTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYD+E+AVD+ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDTEEAVDKVLLKT  169



>emb|CDY35966.1| BnaA05g29840D [Brassica napus]
Length=494

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF ++GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSPGPG-RTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+ R N+  IQGSPGPG RT+KIFVGGL S+VT
Sbjct  61   EFVITEKHHIDGRLVEAKKAVPRDDQNMVTRSNSSSIQGSPGPGARTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYD+E+AVD+ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDTEEAVDKVLLKT  169



>gb|EYU27681.1| hypothetical protein MIMGU_mgv1a005511mg [Erythranthe guttata]
Length=481

 Score =   272 bits (695),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME + GK+FIGGISWDT EE L+EYF ++GEVVEAVIM+DR TGRARGFGFV+FA+ +VA
Sbjct  1    MEMEPGKLFIGGISWDTSEERLREYFETFGEVVEAVIMKDRTTGRARGFGFVVFANASVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNG-GIQGSPGPGRTKKIFVGGLASTVTE  555
            +RVV+E+H IDGRTVEAKKAVPRDD   I+RN+G  IQGSPGP RT+KIFVGGLASTV E
Sbjct  61   DRVVRERHTIDGRTVEAKKAVPRDDHQNISRNSGSSIQGSPGPARTRKIFVGGLASTVKE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
             +FKNYFDQFGTITDVVVMYDHNTQRPRGFGFITY++E++VD+ L+KT
Sbjct  121  TEFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYETEESVDKVLFKT  168



>ref|XP_009147023.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Brassica rapa]
Length=498

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF ++GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSPGPG-RTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+ R N+  IQGSPGPG RT+KIFVGGL S+VT
Sbjct  61   EFVITEKHHIDGRLVEAKKAVPRDDQNMVTRSNSSSIQGSPGPGARTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYD+E+AVD+ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDTEEAVDKVLLKT  169



>ref|XP_002528240.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
 gb|EEF34155.1| Heterogeneous nuclear ribonucleoprotein 27C, putative [Ricinus 
communis]
Length=456

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME +LGK+FIGGISWDT+E+ L+EYF+ +GEV+EAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MEMELGKLFIGGISWDTNEDRLREYFQVFGEVMEAVIMKDRATGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRN-NGGIQGSPGPGRTKKIFVGGLASTVTE  555
            ERVV EKH+IDGR VEAKKAVPR+DQN++NRN +  I GSP P RTKKIFVGGLASTVTE
Sbjct  61   ERVVMEKHLIDGRNVEAKKAVPREDQNILNRNSSSSIHGSPSPARTKKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  121  SDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLHKT  168



>emb|CDY66272.1| BnaC05g52200D [Brassica napus]
Length=489

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF ++GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINR-NNGGIQGSPGPG-RTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQNM+ R N+  IQGSPGPG RT+KIFVGGL S+VT
Sbjct  61   EFVITEKHHIDGRLVEAKKAVPRDDQNMVTRSNSSSIQGSPGPGARTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYD+E+AVD+ L KT
Sbjct  121  ESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDTEEAVDKVLLKT  169



>gb|KJB22704.1| hypothetical protein B456_004G061400 [Gossypium raimondii]
 gb|KJB22705.1| hypothetical protein B456_004G061400 [Gossypium raimondii]
 gb|KJB22706.1| hypothetical protein B456_004G061400 [Gossypium raimondii]
Length=479

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M     K+FIGGISW TDE+ LKEYF S+GEVVEAVIM+DR TGRARGFGFV+FADPAVA
Sbjct  1    MSESGSKLFIGGISWGTDEDRLKEYFSSFGEVVEAVIMKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV+KEKH IDGR VEAKKAVPRDDQN+++R+   I GSP PG T+KIFVGGL STVTE+
Sbjct  61   ERVIKEKHNIDGRMVEAKKAVPRDDQNIMSRSTSSIHGSPSPGPTRKIFVGGLTSTVTES  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            DFK YFDQFG I DVVVMYDHNTQRPRGFGFITYDSE+AVD+ L K
Sbjct  121  DFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLK  166


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 61/100 (61%), Gaps = 14/100 (14%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIF-ADPAVAERVVK  393
            K+F+GG++    E   K+YF  +G +++ V+M D NT R RGFGF+ + ++ AV + ++K
Sbjct  107  KIFVGGLTSTVTESDFKKYFDQFGNIIDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLK  166

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRT  513
            + H ++G+ VE K+AVPR+              SPGP R+
Sbjct  167  KFHELNGKMVEVKRAVPREL-------------SPGPSRS  193



>gb|KJB08697.1| hypothetical protein B456_001G098300 [Gossypium raimondii]
 gb|KJB08698.1| hypothetical protein B456_001G098300 [Gossypium raimondii]
Length=477

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  GKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVK  393
            GK+FIGGISWDT+E  LKEYF ++GEV+EAVIM+DR TGRARGFGFV+FADP VAERV+K
Sbjct  5    GKLFIGGISWDTNEGHLKEYFNTFGEVIEAVIMKDRTTGRARGFGFVVFADPIVAERVIK  64

Query  394  EKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDFKNY  573
            EKH IDGR VEAKKAVPRDDQN+++R+   I GSPGPG T+KIFVGGLASTVTE+DFK Y
Sbjct  65   EKHSIDGRMVEAKKAVPRDDQNVMSRSTSSIHGSPGPGNTRKIFVGGLASTVTESDFKKY  124

Query  574  FDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            FDQFG ITDVVVMYD NT RPRGFGFITYDSE+AVD+ L K
Sbjct  125  FDQFGNITDVVVMYDQNTHRPRGFGFITYDSEEAVDKVLLK  165



>ref|XP_010536715.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X1 [Tarenaya hassleriana]
Length=460

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 149/176 (85%), Gaps = 7/176 (4%)
 Frame = +1

Query  193  RMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPA  372
            + MESDLGK+FIGG+SWDT EE L+EYF  YGEVVEAVIMRDR+TGRARGFGF++F+DP 
Sbjct  3    KKMESDLGKLFIGGVSWDTGEERLREYFGKYGEVVEAVIMRDRSTGRARGFGFIVFSDPF  62

Query  373  VAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSP-------GPGRTKKIFVG  531
            VAE+V+ EKHMIDGRTVEAKKAVPRDDQ  + R+   +  +P       G GRTKKIFVG
Sbjct  63   VAEKVIMEKHMIDGRTVEAKKAVPRDDQQALKRHASPLHHTPSSLSPGHGGGRTKKIFVG  122

Query  532  GLASTVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            GL ST+TE +FKNYFDQFG ++DVVVMYDHNTQRPRGFGFITYDSED+VDR L+KT
Sbjct  123  GLPSTITEAEFKNYFDQFGLVSDVVVMYDHNTQRPRGFGFITYDSEDSVDRVLHKT  178



>ref|XP_008670520.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Zea mays]
 tpg|DAA41245.1| TPA: hypothetical protein ZEAMMB73_495774 [Zea mays]
Length=470

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+EYF  +G+V EAVIMRDRNTGRARGFGFV+FAD  +A
Sbjct  1    MEADSGKLFVGGISWETDEDRLREYFGRFGDVTEAVIMRDRNTGRARGFGFVVFADSGIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  EKHMIDGR VEAKKAVPRDDQ++ ++NN  I GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTMEKHMIDGRMVEAKKAVPRDDQSIASKNNSSI-GSPGPGRTRKIFVGGLASNVTEV  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K 
Sbjct  120  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHKN  166



>ref|XP_002866102.1| hypothetical protein ARALYDRAFT_495641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42361.1| hypothetical protein ARALYDRAFT_495641 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 151/172 (88%), Gaps = 5/172 (3%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L++YF +YG+VVEAVIMRDR TGRARGFGF++FADP V+
Sbjct  1    MESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVS  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQ-GSP----GPGRTKKIFVGGLAS  543
            ERV+ EKH+IDGRTVEAKKAVPRDDQ ++ R+   IQ  SP    G GRTKKIFVGGL S
Sbjct  61   ERVIMEKHIIDGRTVEAKKAVPRDDQQVLKRHASPIQLMSPVHGGGGGRTKKIFVGGLPS  120

Query  544  TVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            ++TE +FKNYFDQFGTI DVVVMYDHNTQRPRGFGFIT+DS+DAVDR L+KT
Sbjct  121  SITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKT  172



>emb|CDY07975.1| BnaC03g35480D [Brassica napus]
Length=471

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 149/168 (89%), Gaps = 2/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDTDEE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTDEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGG-IQGSPGPGRTKKIFVGGLASTVTE  555
            E V+ EKH IDGR VEAKKAVPRDDQN + R+N   +QGSPG GRT+KIFVGGL S++TE
Sbjct  61   ETVITEKHNIDGRLVEAKKAVPRDDQNTVTRSNSSSLQGSPG-GRTRKIFVGGLPSSITE  119

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  120  SDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  167



>ref|XP_010536716.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 isoform 
X2 [Tarenaya hassleriana]
Length=456

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 148/174 (85%), Gaps = 7/174 (4%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGG+SWDT EE L+EYF  YGEVVEAVIMRDR+TGRARGFGF++F+DP VA
Sbjct  1    MESDLGKLFIGGVSWDTGEERLREYFGKYGEVVEAVIMRDRSTGRARGFGFIVFSDPFVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSP-------GPGRTKKIFVGGL  537
            E+V+ EKHMIDGRTVEAKKAVPRDDQ  + R+   +  +P       G GRTKKIFVGGL
Sbjct  61   EKVIMEKHMIDGRTVEAKKAVPRDDQQALKRHASPLHHTPSSLSPGHGGGRTKKIFVGGL  120

Query  538  ASTVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
             ST+TE +FKNYFDQFG ++DVVVMYDHNTQRPRGFGFITYDSED+VDR L+KT
Sbjct  121  PSTITEAEFKNYFDQFGLVSDVVVMYDHNTQRPRGFGFITYDSEDSVDRVLHKT  174



>tpg|DAA63349.1| TPA: hypothetical protein ZEAMMB73_769138 [Zea mays]
Length=342

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+ YF  +GEV EAVIMRDRNTGRARGFGFV+FAD  +A
Sbjct  1    MEADSGKLFVGGISWETDEDRLRAYFGRFGEVTEAVIMRDRNTGRARGFGFVVFADSGIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NN  I GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTLDKHMIDGRMVEAKKAVPRDDQSIASKNNSSI-GSPGPGRTRKIFVGGLASNVTEV  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K 
Sbjct  120  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHKN  166



>ref|XP_011095943.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1 [Sesamum 
indicum]
Length=464

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 8/167 (5%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME + GK+FIGGISWDT E        ++GEVVEAVIM+DR TGRARGFGFV+FA+ ++A
Sbjct  1    MEMEPGKLFIGGISWDTSE--------TFGEVVEAVIMKDRATGRARGFGFVVFANASIA  52

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            E+VV+EKH IDGRTVEAKKAVPRDD    NRNNG IQGSPGP RTKKIFVGGLASTVTE+
Sbjct  53   EKVVREKHTIDGRTVEAKKAVPRDDHQTFNRNNGSIQGSPGPARTKKIFVGGLASTVTES  112

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L+KT
Sbjct  113  DFKRYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLFKT  159



>ref|XP_010539320.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Tarenaya hassleriana]
Length=460

 Score =   269 bits (687),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 149/173 (86%), Gaps = 4/173 (2%)
 Frame = +1

Query  193  RMMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPA  372
            R MESDLGK+F+GGISWDTDEE L+ YF  YGEVVEAVIMRDR TGRARGFGF++FADP 
Sbjct  6    REMESDLGKLFVGGISWDTDEERLRGYFSKYGEVVEAVIMRDRATGRARGFGFIVFADPC  65

Query  373  VAERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQG-SP---GPGRTKKIFVGGLA  540
            VAERV+ EKHMIDGRTVEAKKAVPRDDQ  + ++   +   SP   G GRTKKIFVGGL 
Sbjct  66   VAERVIMEKHMIDGRTVEAKKAVPRDDQQGLKQHASPVHHMSPPGHGGGRTKKIFVGGLP  125

Query  541  STVTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            S++TE +FKNYF+QFG+I+DVVVMYDHNTQRPRGFGFITYDSED+VDR L+KT
Sbjct  126  SSITEAEFKNYFNQFGSISDVVVMYDHNTQRPRGFGFITYDSEDSVDRVLHKT  178



>gb|ADK92872.1| hnRNP [Hypericum perforatum]
Length=477

 Score =   269 bits (688),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+F+GGISWDT+EE LKEYF S+G+VVEAVIM+DR TGRARGFGF++FADP+VA
Sbjct  1    MQSDNGKLFVGGISWDTNEERLKEYFGSFGDVVEAVIMKDRTTGRARGFGFIVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNN-GGIQGSPGPGRTKKIFVGGLASTVTE  555
            +RV+KEKH IDGR VEAK+A+PRDDQN+ +RN+   + GSPGP  T+KIFVGGLASTVTE
Sbjct  61   DRVIKEKHNIDGRMVEAKRAIPRDDQNIPSRNSVSSMHGSPGPDHTRKIFVGGLASTVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFKNYFDQFG I D VVMYDHNTQRPRGFGFITYDS++AVD+ L KT
Sbjct  121  SDFKNYFDQFGIIIDAVVMYDHNTQRPRGFGFITYDSDEAVDKVLTKT  168



>ref|XP_010539319.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Tarenaya hassleriana]
Length=453

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 148/171 (87%), Gaps = 4/171 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+F+GGISWDTDEE L+ YF  YGEVVEAVIMRDR TGRARGFGF++FADP VA
Sbjct  1    MESDLGKLFVGGISWDTDEERLRGYFSKYGEVVEAVIMRDRATGRARGFGFIVFADPCVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQG-SP---GPGRTKKIFVGGLAST  546
            ERV+ EKHMIDGRTVEAKKAVPRDDQ  + ++   +   SP   G GRTKKIFVGGL S+
Sbjct  61   ERVIMEKHMIDGRTVEAKKAVPRDDQQGLKQHASPVHHMSPPGHGGGRTKKIFVGGLPSS  120

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +TE +FKNYF+QFG+I+DVVVMYDHNTQRPRGFGFITYDSED+VDR L+KT
Sbjct  121  ITEAEFKNYFNQFGSISDVVVMYDHNTQRPRGFGFITYDSEDSVDRVLHKT  171



>emb|CDY22136.1| BnaC01g39650D [Brassica napus]
Length=486

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSP-GPG-RTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQN +  N+  IQGSP GPG RT+KIFVGGL S+VT
Sbjct  61   EIVITEKHSIDGRLVEAKKAVPRDDQNTVRSNSSSIQGSPGGPGARTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTPTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>gb|KJB10738.1| hypothetical protein B456_001G220100 [Gossypium raimondii]
 gb|KJB10739.1| hypothetical protein B456_001G220100 [Gossypium raimondii]
Length=476

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  SDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAER  384
            S+ GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGF++F+DPAVAE+
Sbjct  2    SENGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDRTTGRARGFGFIVFSDPAVAEK  61

Query  385  VVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDF  564
            V+KEKH IDGR VEAKKAVPRDDQN+++R+   I  SPGPGRT+KIFVGGLASTVTE+DF
Sbjct  62   VIKEKHNIDGRMVEAKKAVPRDDQNIMSRSTSSIHSSPGPGRTRKIFVGGLASTVTESDF  121

Query  565  KNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            K YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L K
Sbjct  122  KKYFDQFGKITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLK  165



>ref|XP_009124131.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X2 [Brassica rapa]
Length=485

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSP-GPG-RTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQN +  N+  IQGSP GPG RT+KIFVGGL S+VT
Sbjct  61   EIVITEKHSIDGRLVEAKKAVPRDDQNTVRSNSSSIQGSPGGPGARTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTPTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|XP_010530068.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Tarenaya 
hassleriana]
 ref|XP_010530069.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Tarenaya 
hassleriana]
Length=408

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME D  K+FIGGISW+T+E+ L+EYF+++GEV+EAVIM+DR TGRARGFGFV+FADP +A
Sbjct  1    MEMDSCKLFIGGISWETNEDRLREYFQNFGEVLEAVIMKDRATGRARGFGFVVFADPNIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERVV +KHMI+G+TVEAKKAVPRD+  ++N++N  +QGSPGP  TKKIFVGGLAS+VTE 
Sbjct  61   ERVVLQKHMINGKTVEAKKAVPRDEHTILNKSNSSVQGSPGPANTKKIFVGGLASSVTEA  120

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            DFK YF QFGTITDVVVMYDH TQRPRGFGFITYDSEDAVD+ L + 
Sbjct  121  DFKKYFAQFGTITDVVVMYDHRTQRPRGFGFITYDSEDAVDKVLQRA  167


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +1

Query  217  KVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAERVVKE  396
            K+F+GG++    E   K+YF  +G + + V+M D  T R RGFGF+ +      ++V++ 
Sbjct  107  KIFVGGLASSVTEADFKKYFAQFGTITDVVVMYDHRTQRPRGFGFITYDSEDAVDKVLQR  166

Query  397  K-HMIDGRTVEAKKAVPRDDQNMINRN  474
              H ++G+ VE K AVP++     NRN
Sbjct  167  AFHELNGKMVEVKLAVPKEMSPSPNRN  193



>ref|XP_009124116.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Brassica rapa]
 ref|XP_009124125.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like isoform 
X1 [Brassica rapa]
Length=486

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSP-GPG-RTKKIFVGGLASTVT  552
            E V+ EKH IDGR VEAKKAVPRDDQN +  N+  IQGSP GPG RT+KIFVGGL S+VT
Sbjct  61   EIVITEKHSIDGRLVEAKKAVPRDDQNTVRSNSSSIQGSPGGPGARTRKIFVGGLPSSVT  120

Query  553  ENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            E+DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  121  ESDFKTYFEQFGTPTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  169



>ref|NP_001146396.1| uncharacterized protein LOC100279976 [Zea mays]
 gb|ACL53883.1| unknown [Zea mays]
 gb|ACN32061.1| unknown [Zea mays]
Length=470

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+ YF  +GEV EAVIMRDRNTGRARGFGFV+FAD  +A
Sbjct  1    MEADSGKLFVGGISWETDEDRLRAYFGRFGEVTEAVIMRDRNTGRARGFGFVVFADSGIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NN  I GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTLDKHMIDGRMVEAKKAVPRDDQSIASKNNSSI-GSPGPGRTRKIFVGGLASNVTEV  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K
Sbjct  120  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHK  165



>tpg|DAA63348.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_769138, 
partial [Zea mays]
Length=467

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            ME+D GK+F+GGISW+TDE+ L+ YF  +GEV EAVIMRDRNTGRARGFGFV+FAD  +A
Sbjct  1    MEADSGKLFVGGISWETDEDRLRAYFGRFGEVTEAVIMRDRNTGRARGFGFVVFADSGIA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTEN  558
            ERV  +KHMIDGR VEAKKAVPRDDQ++ ++NN  I GSPGPGRT+KIFVGGLAS VTE 
Sbjct  61   ERVTLDKHMIDGRMVEAKKAVPRDDQSIASKNNSSI-GSPGPGRTRKIFVGGLASNVTEV  119

Query  559  DFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            +F+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K
Sbjct  120  EFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHK  165



>ref|NP_851195.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 ref|NP_001190546.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AED96645.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AED96648.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=448

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 150/171 (88%), Gaps = 4/171 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L++YF +YG+VVEAVIMRDR TGRARGFGF++FADP V+
Sbjct  1    MESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVS  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQ-GSP---GPGRTKKIFVGGLAST  546
            ERV+ +KH+IDGRTVEAKKAVPRDDQ ++ R+   I   SP   G GRTKKIFVGGL S+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSS  120

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +TE +FKNYFDQFGTI DVVVMYDHNTQRPRGFGFIT+DS+DAVDR L+KT
Sbjct  121  ITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKT  171



>gb|AAM97088.1| RNA-binding protein-like [Arabidopsis thaliana]
Length=448

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 150/171 (88%), Gaps = 4/171 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L++YF +YG+VVEAVIMRDR TGRARGFGF++FADP V+
Sbjct  1    MESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVS  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQ-GSP---GPGRTKKIFVGGLAST  546
            ERV+ +KH+IDGRTVEAKKAVPRDDQ ++ R+   I   SP   G GRTKKIFVGGL S+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSS  120

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +TE +FKNYFDQFGTI DVVVMYDHNTQRPRGFGFIT+DS+DAVDR L+KT
Sbjct  121  ITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKT  171



>emb|CDX74030.1| BnaA03g30170D [Brassica napus]
Length=472

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            M+SD GK+FIGGISWDT+EE LKEYF S+GEV+EAVI++DR TGRARGFGFV+FADPAVA
Sbjct  1    MQSDSGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGG-IQGSPGPGRTKKIFVGGLASTVTE  555
            E V+ EKH IDGR VEAKKAVPRDDQN   R+N   +QGSPG GRT+KIFVGGL S++TE
Sbjct  61   ETVITEKHNIDGRLVEAKKAVPRDDQNTATRSNSSSLQGSPG-GRTRKIFVGGLPSSITE  119

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +DFK YF+QFGT TDVVVMYDHNTQRPRGFGFITYDSE+AV++ L KT
Sbjct  120  SDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKT  167



>emb|CDY11989.1| BnaC03g14150D [Brassica napus]
Length=432

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 151/171 (88%), Gaps = 4/171 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L+EYF +YG+VVEAVIMRDR TGRARGFGF++FADP+VA
Sbjct  1    MESDLGKLFIGGISWDTDEERLREYFTNYGDVVEAVIMRDRATGRARGFGFIVFADPSVA  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDD-QNMINRNNGGIQ-GSP--GPGRTKKIFVGGLAST  546
            ERV+ EKH+IDGRTVEAKKAVPRDD Q ++ R+   +   SP  G GRTKKIFVGGL S+
Sbjct  61   ERVILEKHIIDGRTVEAKKAVPRDDHQQVMKRHASPVHLMSPLHGGGRTKKIFVGGLPSS  120

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +TE +FKNYFDQFGTI DVVVMYDHNTQRPRGFGFIT+DS+DAVDR L+KT
Sbjct  121  ITETEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKT  171



>ref|XP_008652160.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Zea 
mays]
 tpg|DAA59915.1| TPA: hypothetical protein ZEAMMB73_814821 [Zea mays]
Length=448

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  196  MMESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAV  375
            M  +D GK+F+GGISW+T E+ L+EYF  +GEV EAVIMRDR+TGRARGFGFV+FAD AV
Sbjct  1    MEAADYGKLFVGGISWETSEDRLREYFGRFGEVTEAVIMRDRSTGRARGFGFVVFADAAV  60

Query  376  AERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTE  555
            AERV  +KH IDGR VEAKKAVPRDD ++++++NG   GSPGPGRT+KIFVGGL S+VTE
Sbjct  61   AERVTMDKHTIDGRMVEAKKAVPRDDHSIVSKSNGSSTGSPGPGRTRKIFVGGLPSSVTE  120

Query  556  NDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
             DF+ YF+QFG ITDVVVMYDHNTQRPRGFGFITYDSEDAVD+AL+K+
Sbjct  121  ADFRRYFEQFGIITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHKS  168



>ref|NP_568826.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 ref|NP_974937.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAK92731.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AAM20100.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AED96646.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AED96647.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=460

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 150/171 (88%), Gaps = 4/171 (2%)
 Frame = +1

Query  199  MESDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVA  378
            MESDLGK+FIGGISWDTDEE L++YF +YG+VVEAVIMRDR TGRARGFGF++FADP V+
Sbjct  1    MESDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVS  60

Query  379  ERVVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQ-GSP---GPGRTKKIFVGGLAST  546
            ERV+ +KH+IDGRTVEAKKAVPRDDQ ++ R+   I   SP   G GRTKKIFVGGL S+
Sbjct  61   ERVIMDKHIIDGRTVEAKKAVPRDDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSS  120

Query  547  VTENDFKNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYKT  699
            +TE +FKNYFDQFGTI DVVVMYDHNTQRPRGFGFIT+DS+DAVDR L+KT
Sbjct  121  ITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKT  171



>gb|KHG03345.1| RNA-binding Musashi Rbp6 [Gossypium arboreum]
Length=481

 Score =   266 bits (681),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  SDLGKVFIGGISWDTDEECLKEYFRSYGEVVEAVIMRDRNTGRARGFGFVIFADPAVAER  384
            S+ GK+FIGGISWDT+EE LKEYF S+GEVVEAVIM+DR TGRARGFGF++F+DPAVAE+
Sbjct  2    SENGKLFIGGISWDTNEERLKEYFSSFGEVVEAVIMKDRTTGRARGFGFIVFSDPAVAEK  61

Query  385  VVKEKHMIDGRTVEAKKAVPRDDQNMINRNNGGIQGSPGPGRTKKIFVGGLASTVTENDF  564
            V+KEKH IDGR VEAKKAVPRDDQN+++R+   I  SPGP RT+KIFVGGLASTVTE+DF
Sbjct  62   VIKEKHNIDGRMVEAKKAVPRDDQNIMSRSTSSIHSSPGPARTRKIFVGGLASTVTESDF  121

Query  565  KNYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDRALYK  696
            K YFDQFG ITDVVVMYDHNTQRPRGFGFITYDSE+AVD+ L K
Sbjct  122  KKYFDQFGNITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLK  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1225614785648