BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5071

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757134.1|  PREDICTED: uncharacterized protein LOC104210037    183   8e-49   Nicotiana sylvestris
ref|XP_009598060.1|  PREDICTED: symplekin                               176   2e-46   Nicotiana tomentosiformis
ref|XP_004246764.1|  PREDICTED: uncharacterized protein LOC101252517    170   3e-44   Solanum lycopersicum
ref|XP_006365598.1|  PREDICTED: uncharacterized protein LOC102603...    169   9e-44   
ref|XP_006365597.1|  PREDICTED: uncharacterized protein LOC102603...    169   1e-43   
ref|XP_006365596.1|  PREDICTED: uncharacterized protein LOC102603...    168   1e-43   Solanum tuberosum [potatoes]
emb|CDP06479.1|  unnamed protein product                                161   5e-41   Coffea canephora [robusta coffee]
ref|XP_003638563.1|  LCR/BET1-like protein                              148   1e-39   
ref|XP_006607069.1|  PREDICTED: uncharacterized protein LOC102665650    144   3e-38   
ref|XP_011095015.1|  PREDICTED: symplekin                               150   2e-37   Sesamum indicum [beniseed]
gb|KEH28877.1|  symplekin tight junction protein carboxy-terminal...    150   3e-37   Medicago truncatula
gb|KGN54383.1|  hypothetical protein Csa_4G310200                       148   1e-36   Cucumis sativus [cucumbers]
ref|XP_011653694.1|  PREDICTED: symplekin isoform X1                    147   5e-36   Cucumis sativus [cucumbers]
ref|XP_011653695.1|  PREDICTED: symplekin isoform X2                    147   5e-36   Cucumis sativus [cucumbers]
ref|XP_011653696.1|  PREDICTED: symplekin isoform X3                    146   8e-36   Cucumis sativus [cucumbers]
ref|XP_006573375.1|  PREDICTED: uncharacterized protein LOC100776...    146   8e-36   Glycine max [soybeans]
ref|XP_006573374.1|  PREDICTED: uncharacterized protein LOC100776...    146   9e-36   Glycine max [soybeans]
gb|KHN35575.1|  Symplekin                                               145   1e-35   Glycine soja [wild soybean]
ref|XP_008464199.1|  PREDICTED: uncharacterized protein LOC103502...    145   2e-35   Cucumis melo [Oriental melon]
ref|XP_008464198.1|  PREDICTED: uncharacterized protein LOC103502...    144   2e-35   Cucumis melo [Oriental melon]
ref|XP_004506749.1|  PREDICTED: symplekin-like isoform X1               144   4e-35   Cicer arietinum [garbanzo]
ref|XP_010253740.1|  PREDICTED: uncharacterized protein LOC104594...    143   7e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006576526.1|  PREDICTED: uncharacterized protein LOC100779...    143   9e-35   
ref|XP_010253742.1|  PREDICTED: uncharacterized protein LOC104594...    143   9e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006576525.1|  PREDICTED: uncharacterized protein LOC100779...    143   9e-35   
gb|KHN42510.1|  Symplekin                                               142   1e-34   Glycine soja [wild soybean]
gb|EYU41898.1|  hypothetical protein MIMGU_mgv1a000258mg                142   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_007133891.1|  hypothetical protein PHAVU_010G000700g             142   2e-34   Phaseolus vulgaris [French bean]
ref|XP_007133889.1|  hypothetical protein PHAVU_010G000700g             142   2e-34   Phaseolus vulgaris [French bean]
gb|KCW86107.1|  hypothetical protein EUGRSUZ_B02805                     139   2e-33   Eucalyptus grandis [rose gum]
ref|XP_010653297.1|  PREDICTED: uncharacterized protein LOC100262578    139   2e-33   Vitis vinifera
ref|XP_007208390.1|  hypothetical protein PRUPE_ppa000295mg             137   6e-33   Prunus persica
ref|XP_008243673.1|  PREDICTED: symplekin                               137   7e-33   Prunus mume [ume]
ref|XP_010044097.1|  PREDICTED: symplekin                               137   8e-33   Eucalyptus grandis [rose gum]
ref|XP_006286894.1|  hypothetical protein CARUB_v10000037mg             136   2e-32   Capsella rubella
ref|NP_195760.1|  Symplekin/Pta1-like protein                           136   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010095240.1|  hypothetical protein L484_008249                   134   7e-32   
ref|XP_010543210.1|  PREDICTED: uncharacterized protein LOC104816...    134   9e-32   Tarenaya hassleriana [spider flower]
ref|XP_010543208.1|  PREDICTED: uncharacterized protein LOC104816...    134   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_010423951.1|  PREDICTED: uncharacterized protein LOC104708990    133   2e-31   Camelina sativa [gold-of-pleasure]
gb|KHG27415.1|  Symplekin                                               133   3e-31   Gossypium arboreum [tree cotton]
ref|XP_010490570.1|  PREDICTED: uncharacterized protein LOC104768323    132   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007026695.1|  HEAT repeat-containing protein isoform 3           130   2e-30   
ref|XP_007026693.1|  HEAT repeat-containing protein isoform 1           130   2e-30   
ref|XP_007026696.1|  HEAT repeat-containing protein isoform 4           130   2e-30   
ref|XP_007026694.1|  HEAT repeat-containing protein isoform 2           130   2e-30   
ref|XP_007026697.1|  HEAT repeat-containing protein isoform 5           130   2e-30   
ref|XP_002322982.1|  hypothetical protein POPTR_0016s12390g             130   2e-30   
gb|KJB17063.1|  hypothetical protein B456_002G263300                    129   4e-30   Gossypium raimondii
gb|KJB17064.1|  hypothetical protein B456_002G263300                    129   4e-30   Gossypium raimondii
gb|KJB17065.1|  hypothetical protein B456_002G263300                    129   4e-30   Gossypium raimondii
gb|KJB17066.1|  hypothetical protein B456_002G263300                    129   4e-30   Gossypium raimondii
ref|XP_006398618.1|  hypothetical protein EUTSA_v10012442mg             129   5e-30   
ref|XP_008390696.1|  PREDICTED: symplekin isoform X1                    129   7e-30   
ref|XP_008390697.1|  PREDICTED: symplekin isoform X2                    129   7e-30   
ref|XP_011006561.1|  PREDICTED: uncharacterized protein LOC105112...    127   2e-29   Populus euphratica
ref|XP_011466471.1|  PREDICTED: uncharacterized protein LOC101312467    127   3e-29   Fragaria vesca subsp. vesca
gb|KFK24648.1|  hypothetical protein AALP_AA8G006900                    127   3e-29   Arabis alpina [alpine rockcress]
ref|XP_010451991.1|  PREDICTED: symplekin-like isoform X1               126   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010451992.1|  PREDICTED: symplekin-like isoform X2               126   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008793266.1|  PREDICTED: symplekin isoform X2                    125   1e-28   
ref|XP_008793258.1|  PREDICTED: symplekin isoform X1                    125   1e-28   
ref|XP_011006559.1|  PREDICTED: uncharacterized protein LOC105112...    124   2e-28   Populus euphratica
ref|XP_002870923.1|  hypothetical protein ARALYDRAFT_486936             124   2e-28   
ref|XP_011006560.1|  PREDICTED: uncharacterized protein LOC105112...    124   3e-28   Populus euphratica
ref|XP_002528089.1|  symplekin, putative                                120   5e-27   
ref|XP_009404651.1|  PREDICTED: uncharacterized protein LOC103987912    118   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010920861.1|  PREDICTED: uncharacterized protein LOC105044609    117   5e-26   Elaeis guineensis
ref|XP_006481043.1|  PREDICTED: uncharacterized protein LOC102608...    114   6e-25   Citrus sinensis [apfelsine]
ref|XP_006481042.1|  PREDICTED: uncharacterized protein LOC102608...    114   6e-25   Citrus sinensis [apfelsine]
ref|XP_006429396.1|  hypothetical protein CICLE_v10010921mg             113   1e-24   Citrus clementina [clementine]
gb|ERN05241.1|  hypothetical protein AMTR_s00007p00088050               106   4e-22   Amborella trichopoda
ref|XP_009125421.1|  PREDICTED: symplekin isoform X3                    105   7e-22   Brassica rapa
ref|XP_009125420.1|  PREDICTED: symplekin isoform X2                    105   7e-22   Brassica rapa
ref|XP_009125419.1|  PREDICTED: symplekin isoform X1                    105   7e-22   Brassica rapa
ref|XP_010676743.1|  PREDICTED: uncharacterized protein LOC104892...    105   9e-22   
ref|XP_010676744.1|  PREDICTED: uncharacterized protein LOC104892...    105   9e-22   
ref|XP_010676741.1|  PREDICTED: uncharacterized protein LOC104892...    104   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676740.1|  PREDICTED: uncharacterized protein LOC104892...    104   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676739.1|  PREDICTED: uncharacterized protein LOC104892...    104   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676742.1|  PREDICTED: uncharacterized protein LOC104892...    104   1e-21   
emb|CDY04840.1|  BnaAnng00220D                                          103   2e-21   
gb|EPS64126.1|  hypothetical protein M569_10655                       99.8    4e-20   Genlisea aurea
ref|XP_006843566.2|  PREDICTED: symplekin                               100   5e-20   
gb|KDP24446.1|  hypothetical protein JCGZ_25010                       98.6    2e-19   Jatropha curcas
ref|XP_012087849.1|  PREDICTED: uncharacterized protein LOC105646...  98.6    2e-19   Jatropha curcas
ref|XP_012087848.1|  PREDICTED: uncharacterized protein LOC105646...  98.6    2e-19   Jatropha curcas
tpg|DAA64259.1|  TPA: hypothetical protein ZEAMMB73_525160            79.3    2e-13   
ref|XP_008653537.1|  PREDICTED: symplekin isoform X1                  76.3    3e-12   Zea mays [maize]
ref|XP_009377759.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.5    5e-12   
ref|XP_010233552.1|  PREDICTED: uncharacterized protein LOC100836...  75.1    6e-12   
ref|XP_003559743.1|  PREDICTED: symplekin isoform X1                  75.1    7e-12   Brachypodium distachyon [annual false brome]
gb|EMT14451.1|  Symplekin                                             74.7    8e-12   
dbj|BAJ93522.1|  predicted protein                                    73.6    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC82740.1|  hypothetical protein OsI_27446                        73.6    2e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001060734.1|  Os07g0693900                                     73.6    2e-11   
ref|XP_002461279.1|  hypothetical protein SORBIDRAFT_02g044000        73.6    2e-11   
ref|XP_006658175.1|  PREDICTED: symplekin-like                        67.0    2e-09   Oryza brachyantha
ref|XP_004958811.1|  PREDICTED: symplekin-like                        64.3    2e-08   
gb|KDO81324.1|  hypothetical protein CISIN_1g025778mg                 58.9    2e-07   Citrus sinensis [apfelsine]
gb|KDO81323.1|  hypothetical protein CISIN_1g025778mg                 58.9    4e-07   Citrus sinensis [apfelsine]
gb|KDO81322.1|  hypothetical protein CISIN_1g025778mg                 58.5    5e-07   Citrus sinensis [apfelsine]
gb|KDO81320.1|  hypothetical protein CISIN_1g025778mg                 58.5    5e-07   Citrus sinensis [apfelsine]
gb|KDO81321.1|  hypothetical protein CISIN_1g025778mg                 58.5    5e-07   Citrus sinensis [apfelsine]
ref|XP_011626437.1|  PREDICTED: uncharacterized protein LOC18442422   59.3    7e-07   Amborella trichopoda
gb|ERN14175.1|  hypothetical protein AMTR_s00033p00031310             59.3    8e-07   Amborella trichopoda
ref|XP_002974966.1|  hypothetical protein SELMODRAFT_442688           58.5    1e-06   
ref|XP_010520816.1|  PREDICTED: uncharacterized protein LOC104799...  58.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_010520815.1|  PREDICTED: uncharacterized protein LOC104799...  58.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_006433722.1|  hypothetical protein CICLE_v10002279mg           55.8    3e-06   
ref|XP_010556503.1|  PREDICTED: uncharacterized protein LOC104825810  56.2    5e-06   
ref|XP_006433724.1|  hypothetical protein CICLE_v10002279mg           55.8    5e-06   
ref|XP_006433723.1|  hypothetical protein CICLE_v10002279mg           55.8    5e-06   
ref|XP_006472379.1|  PREDICTED: symplekin-like isoform X1             56.2    8e-06   Citrus sinensis [apfelsine]
ref|XP_006364969.1|  PREDICTED: symplekin-like                        55.1    2e-05   Solanum tuberosum [potatoes]
ref|XP_002510000.1|  conserved hypothetical protein                   54.7    3e-05   
ref|XP_010320519.1|  PREDICTED: uncharacterized protein LOC101249356  54.3    4e-05   Solanum lycopersicum
gb|EYU36425.1|  hypothetical protein MIMGU_mgv1a019483mg              53.1    4e-05   Erythranthe guttata [common monkey flower]
ref|XP_012068105.1|  PREDICTED: uncharacterized protein LOC105630...  53.1    5e-05   Jatropha curcas
emb|CAN82893.1|  hypothetical protein VITISV_043096                   53.5    6e-05   Vitis vinifera
ref|XP_012068103.1|  PREDICTED: uncharacterized protein LOC105630...  52.4    9e-05   Jatropha curcas
ref|XP_011074296.1|  PREDICTED: uncharacterized protein LOC105159...  51.6    2e-04   
ref|XP_011074297.1|  PREDICTED: uncharacterized protein LOC105159...  51.2    2e-04   
gb|KGN60293.1|  hypothetical protein Csa_3G893430                     50.8    2e-04   Cucumis sativus [cucumbers]
ref|XP_010104549.1|  hypothetical protein L484_025526                 51.2    4e-04   
ref|XP_006581045.1|  PREDICTED: uncharacterized protein LOC100810...  50.4    4e-04   
ref|XP_006581044.1|  PREDICTED: uncharacterized protein LOC100810...  50.4    4e-04   Glycine max [soybeans]
ref|XP_012068102.1|  PREDICTED: uncharacterized protein LOC105630...  50.4    7e-04   Jatropha curcas
gb|EPS73040.1|  hypothetical protein M569_01716                       50.1    9e-04   Genlisea aurea



>ref|XP_009757134.1| PREDICTED: uncharacterized protein LOC104210037 [Nicotiana sylvestris]
 ref|XP_009757135.1| PREDICTED: uncharacterized protein LOC104210037 [Nicotiana sylvestris]
Length=1328

 Score =   183 bits (465),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMM+ +SRE++A LLN++K A+ VPSK+  LRRL +E++ ADS LL+EFLP LLD VS
Sbjct  1    MVGMMSPISRERIASLLNAAKFASDVPSKLHSLRRLNNELAGADSQLLSEFLPSLLDLVS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRFSPVRK T EM+  IG +H EF+P I+P+LI+ALKDDTPAVARQ+ITCGI+IFR  L 
Sbjct  61   DRFSPVRKLTAEMVGYIGFKHGEFIPDIVPVLISALKDDTPAVARQAITCGIDIFRCTLV  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAIQGL+SSELDDSLE++WAWV KF  EI T+AF
Sbjct  121  KVAIQGLFSSELDDSLESAWAWVLKFREEIYTMAF  155



>ref|XP_009598060.1| PREDICTED: symplekin [Nicotiana tomentosiformis]
 ref|XP_009598061.1| PREDICTED: symplekin [Nicotiana tomentosiformis]
Length=1328

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMM+ +SRE++A LL+++K A+ VPSK+  LRRL +E++ ADS LL+EFLP LLD VS
Sbjct  1    MVGMMSPISRERIASLLSAAKFASDVPSKLHSLRRLNNELAGADSQLLSEFLPSLLDLVS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRFSPVRK T EM+  IG +H EF+P I+P+LI+ALKDD PAVARQ+ITCGI+IFR  L 
Sbjct  61   DRFSPVRKLTAEMVGYIGFKHGEFIPDIVPVLISALKDDMPAVARQAITCGIDIFRCTLV  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAIQGL+SSELDDSLE++WAWV KF  EI  +AF
Sbjct  121  KVAIQGLFSSELDDSLESAWAWVLKFREEIYAMAF  155



>ref|XP_004246764.1| PREDICTED: uncharacterized protein LOC101252517 [Solanum lycopersicum]
 ref|XP_010326075.1| PREDICTED: uncharacterized protein LOC101252517 [Solanum lycopersicum]
Length=1318

 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMM+ +SRE++A LLN++K A+ VPSK+  LRRLKDE+S A   LL EFLP L+D VS
Sbjct  1    MVGMMSPISRERIASLLNAAKFASDVPSKLHSLRRLKDELSGAGGPLLKEFLPTLIDLVS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRFSPVRK TI+M+  IG  H E LP IIP+LI+ALKDDTPAVARQ+ITCGI IFR  L 
Sbjct  61   DRFSPVRKLTIQMVGCIGFEHGELLPDIIPVLISALKDDTPAVARQAITCGIGIFRCTLV  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAIQGL+SS+LD SLE++WA + KF  EI T+AF
Sbjct  121  KVAIQGLFSSQLDGSLESAWALMLKFREEIYTMAF  155



>ref|XP_006365598.1| PREDICTED: uncharacterized protein LOC102603942 isoform X3 [Solanum 
tuberosum]
Length=1235

 Score =   169 bits (427),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMM+ +SRE++  LLN++K A+ VPSK+  LRRLKDE+S A   LL EFLP L+D VS
Sbjct  1    MVGMMSPISRERITSLLNAAKFASDVPSKLHSLRRLKDELSGAGGPLLKEFLPTLIDLVS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRFSPVRK TI+M+  IG  H E LP IIP+LI+ALKDDTPAVARQ+ITCGI IFR  L 
Sbjct  61   DRFSPVRKLTIQMVGCIGFEHGELLPDIIPVLISALKDDTPAVARQAITCGIGIFRCTLV  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAIQGL+SS+LD SLE++WA + KF  EI T+AF
Sbjct  121  KVAIQGLFSSQLDGSLESAWALMLKFREEIYTMAF  155



>ref|XP_006365597.1| PREDICTED: uncharacterized protein LOC102603942 isoform X2 [Solanum 
tuberosum]
Length=1299

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMM+ +SRE++  LLN++K A+ VPSK+  LRRLKDE+S A   LL EFLP L+D VS
Sbjct  1    MVGMMSPISRERITSLLNAAKFASDVPSKLHSLRRLKDELSGAGGPLLKEFLPTLIDLVS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRFSPVRK TI+M+  IG  H E LP IIP+LI+ALKDDTPAVARQ+ITCGI IFR  L 
Sbjct  61   DRFSPVRKLTIQMVGCIGFEHGELLPDIIPVLISALKDDTPAVARQAITCGIGIFRCTLV  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAIQGL+SS+LD SLE++WA + KF  EI T+AF
Sbjct  121  KVAIQGLFSSQLDGSLESAWALMLKFREEIYTMAF  155



>ref|XP_006365596.1| PREDICTED: uncharacterized protein LOC102603942 isoform X1 [Solanum 
tuberosum]
Length=1315

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMM+ +SRE++  LLN++K A+ VPSK+  LRRLKDE+S A   LL EFLP L+D VS
Sbjct  1    MVGMMSPISRERITSLLNAAKFASDVPSKLHSLRRLKDELSGAGGPLLKEFLPTLIDLVS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRFSPVRK TI+M+  IG  H E LP IIP+LI+ALKDDTPAVARQ+ITCGI IFR  L 
Sbjct  61   DRFSPVRKLTIQMVGCIGFEHGELLPDIIPVLISALKDDTPAVARQAITCGIGIFRCTLV  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAIQGL+SS+LD SLE++WA + KF  EI T+AF
Sbjct  121  KVAIQGLFSSQLDGSLESAWALMLKFREEIYTMAF  155



>emb|CDP06479.1| unnamed protein product [Coffea canephora]
Length=1377

 Score =   161 bits (407),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA VSR+K++ L+NS K  A +PSK+ +LR L DE+S+ADS+LL++FL  LLD +SDRFS
Sbjct  1    MATVSRDKISSLINSVKFDANIPSKLEHLRSLSDELSNADSVLLSKFLSPLLDLLSDRFS  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
            PVRKFT EM+  IG++  E +P I+P+LI  LKDDTPAVARQ+I CG+EIFR +LFKVA+
Sbjct  61   PVRKFTAEMIGDIGLKFAESIPEIVPVLIPVLKDDTPAVARQAIRCGMEIFRYVLFKVAL  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            QG+YS+ELD SLE+SW+W+ KF  EIC++AF
Sbjct  121  QGMYSNELDTSLESSWSWMLKFRDEICSLAF  151



>ref|XP_003638563.1| LCR/BET1-like protein, partial [Medicago truncatula]
Length=260

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA  SREK+A L++S+KLA+ +PSK+  LRRLK E+   D +LLTEFLP + DF+SD+FS
Sbjct  1    MAVTSREKLASLVHSAKLASDIPSKIESLRRLKIELPQEDPVLLTEFLPPIFDFLSDQFS  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
            PVRKF  EM+  IG+++ EFLP I+P+LI  L DDTPAV RQ+I CGI +FRS L K+AI
Sbjct  61   PVRKFVTEMIGEIGLKNTEFLPDIVPVLIDVLDDDTPAVVRQAILCGIRLFRSTLEKIAI  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            QGL+SS+LD ++E++W W+ KF  ++ ++AF
Sbjct  121  QGLFSSDLDSAVESAWEWMVKFKDKVYSIAF  151



>ref|XP_006607069.1| PREDICTED: uncharacterized protein LOC102665650, partial [Glycine 
max]
Length=216

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 116/158 (73%), Gaps = 3/158 (2%)
 Frame = +3

Query  234  MVGM---MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllD  404
            MVG    MAA SREK+A L+N++KLA  +PSK+  LR+L+ E+   D +LLTEFLP L  
Sbjct  1    MVGKTMSMAATSREKLASLVNAAKLAIDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFL  60

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SDRF PVRKF  EML  IG+++ EFL  I+P+LI  L DDTPAV RQ + CG ++FR+
Sbjct  61   FHSDRFGPVRKFLTEMLGEIGLKNTEFLSNIVPVLIDLLDDDTPAVVRQVLLCGTDLFRA  120

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+ +QGLYSS+LD +LE++WAW+ KF  ++ ++AF
Sbjct  121  TLEKIVVQGLYSSDLDGALESAWAWMLKFKDKVYSIAF  158



>ref|XP_011095015.1| PREDICTED: symplekin [Sesamum indicum]
Length=1346

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 121/157 (77%), Gaps = 2/157 (1%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLA--AAVPSKMGYLRRLKDEVSDADSIllteflplllDF  407
            MVG+MAAVSR K+A  +NS K +  A + +K+  LRRL+DE+  ADS+LL +FL  +LD 
Sbjct  1    MVGVMAAVSRAKLASRINSIKQSGSADMGTKLDKLRRLRDELLAADSVLLVDFLSPILDL  60

Query  408  VSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSM  587
            +SDR SPVRKF I+M+  IG++H E LP IIP LI ALKDDTPAVARQ+ITCG++IFR  
Sbjct  61   LSDRSSPVRKFIIQMIGEIGLKHSELLPDIIPALIAALKDDTPAVARQAITCGVDIFRCS  120

Query  588  LFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            L KVAIQGLYSSE ++SL++SW  V KF  EI ++AF
Sbjct  121  LVKVAIQGLYSSEFNESLKSSWECVLKFRDEIYSMAF  157



>gb|KEH28877.1| symplekin tight junction protein carboxy-terminal protein [Medicago 
truncatula]
Length=1338

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVG-MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVG  MA  SREK+A L++S+KLA+ +PSK+  LRRLK E+   D +LLTEFLP + DF+
Sbjct  1    MVGKAMAVTSREKLASLVHSAKLASDIPSKIESLRRLKIELPQEDPVLLTEFLPPIFDFL  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD+FSPVRKF  EM+  IG+++ EFLP I+P+LI  L DDTPAV RQ+I CGI +FRS L
Sbjct  61   SDQFSPVRKFVTEMIGEIGLKNTEFLPDIVPVLIDVLDDDTPAVVRQAILCGIRLFRSTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             K+AIQGL+SS+LD ++E++W W+ KF  ++ ++AF
Sbjct  121  EKIAIQGLFSSDLDSAVESAWEWMVKFKDKVYSIAF  156



>gb|KGN54383.1| hypothetical protein Csa_4G310200 [Cucumis sativus]
Length=1377

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  231  AMVGMMAAV-SREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDF  407
            AMVGMM AV SRE++  L+NS+K+A+ +PSK+  LR+LK+ +   D +LL+E LP +L+ 
Sbjct  47   AMVGMMMAVNSRERLYGLINSTKIASDIPSKLARLRQLKNVLLPEDPVLLSELLPRILEL  106

Query  408  VSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSM  587
             SDRFSP+RKF  EM+  IG +HI+ LP I+PLLIT L DDTPAV RQSITC I++FR  
Sbjct  107  QSDRFSPIRKFVTEMIGEIGFKHIDLLPQIVPLLITVLTDDTPAVVRQSITCAIDLFRIS  166

Query  588  LFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
            L K+A++GLYSSE+D+SL++ W W+ KF  EI ++A
Sbjct  167  LVKIAMKGLYSSEMDNSLQSLWTWMLKFKEEIYSIA  202



>ref|XP_011653694.1| PREDICTED: symplekin isoform X1 [Cucumis sativus]
Length=1325

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +3

Query  234  MVGMMAAV-SREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVGMM AV SRE++  L+NS+K+A+ +PSK+  LR+LK+ +   D +LL+E LP +L+  
Sbjct  1    MVGMMMAVNSRERLYGLINSTKIASDIPSKLARLRQLKNVLLPEDPVLLSELLPRILELQ  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDRFSP+RKF  EM+  IG +HI+ LP I+PLLIT L DDTPAV RQSITC I++FR  L
Sbjct  61   SDRFSPIRKFVTEMIGEIGFKHIDLLPQIVPLLITVLTDDTPAVVRQSITCAIDLFRISL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
             K+A++GLYSSE+D+SL++ W W+ KF  EI ++A
Sbjct  121  VKIAMKGLYSSEMDNSLQSLWTWMLKFKEEIYSIA  155



>ref|XP_011653695.1| PREDICTED: symplekin isoform X2 [Cucumis sativus]
Length=1324

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +3

Query  234  MVGMMAAV-SREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVGMM AV SRE++  L+NS+K+A+ +PSK+  LR+LK+ +   D +LL+E LP +L+  
Sbjct  1    MVGMMMAVNSRERLYGLINSTKIASDIPSKLARLRQLKNVLLPEDPVLLSELLPRILELQ  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDRFSP+RKF  EM+  IG +HI+ LP I+PLLIT L DDTPAV RQSITC I++FR  L
Sbjct  61   SDRFSPIRKFVTEMIGEIGFKHIDLLPQIVPLLITVLTDDTPAVVRQSITCAIDLFRISL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
             K+A++GLYSSE+D+SL++ W W+ KF  EI ++A
Sbjct  121  VKIAMKGLYSSEMDNSLQSLWTWMLKFKEEIYSIA  155



>ref|XP_011653696.1| PREDICTED: symplekin isoform X3 [Cucumis sativus]
Length=1311

 Score =   146 bits (368),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 87/155 (56%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +3

Query  234  MVGMMAAV-SREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVGMM AV SRE++  L+NS+K+A+ +PSK+  LR+LK+ +   D +LL+E LP +L+  
Sbjct  1    MVGMMMAVNSRERLYGLINSTKIASDIPSKLARLRQLKNVLLPEDPVLLSELLPRILELQ  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDRFSP+RKF  EM+  IG +HI+ LP I+PLLIT L DDTPAV RQSITC I++FR  L
Sbjct  61   SDRFSPIRKFVTEMIGEIGFKHIDLLPQIVPLLITVLTDDTPAVVRQSITCAIDLFRISL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
             K+A++GLYSSE+D+SL++ W W+ KF  EI ++A
Sbjct  121  VKIAMKGLYSSEMDNSLQSLWTWMLKFKEEIYSIA  155



>ref|XP_006573375.1| PREDICTED: uncharacterized protein LOC100776979 isoform X2 [Glycine 
max]
Length=1360

 Score =   146 bits (368),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = +3

Query  234  MVG---MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllD  404
            MVG    MAA SREK+  L+N++KLA  +PSK+  LR+L+ E+   D +LLTEFLP L  
Sbjct  1    MVGKTMCMAATSREKLTSLVNAAKLAIDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFL  60

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SDRF PVRKF  EML  IG+++ EFL  I+P+LI  L DDTPAV RQ++ CGI++FR+
Sbjct  61   FHSDRFGPVRKFLTEMLGEIGLKNTEFLSDIVPVLIDLLDDDTPAVVRQALLCGIDLFRA  120

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+A+QGLYSS+LD +LE++WAW+ KF  ++ ++AF
Sbjct  121  TLEKIAVQGLYSSDLDGALESAWAWMLKFKDKVYSIAF  158



>ref|XP_006573374.1| PREDICTED: uncharacterized protein LOC100776979 isoform X1 [Glycine 
max]
Length=1361

 Score =   146 bits (368),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = +3

Query  234  MVG---MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllD  404
            MVG    MAA SREK+  L+N++KLA  +PSK+  LR+L+ E+   D +LLTEFLP L  
Sbjct  1    MVGKTMCMAATSREKLTSLVNAAKLAIDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFL  60

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SDRF PVRKF  EML  IG+++ EFL  I+P+LI  L DDTPAV RQ++ CGI++FR+
Sbjct  61   FHSDRFGPVRKFLTEMLGEIGLKNTEFLSDIVPVLIDLLDDDTPAVVRQALLCGIDLFRA  120

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+A+QGLYSS+LD +LE++WAW+ KF  ++ ++AF
Sbjct  121  TLEKIAVQGLYSSDLDGALESAWAWMLKFKDKVYSIAF  158



>gb|KHN35575.1| Symplekin [Glycine soja]
Length=1353

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAA SREK+  L+N++KLA  +PSK+  LR+L+ E+   D +LLTEFLP L  F SDRF 
Sbjct  1    MAATSREKLTSLVNAAKLAIDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFLFHSDRFG  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
            PVRKF  EML  IG+++ EFL  I+P+LI  L DDTPAV RQ++ CGI++FR+ L K+A+
Sbjct  61   PVRKFLTEMLGEIGLKNTEFLSDIVPVLIDLLDDDTPAVVRQALLCGIDLFRATLEKIAV  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            QGLYSS+LD +LE++WAW+ KF  ++ ++AF
Sbjct  121  QGLYSSDLDGALESAWAWMLKFKDKVYSIAF  151



>ref|XP_008464199.1| PREDICTED: uncharacterized protein LOC103502136 isoform X2 [Cucumis 
melo]
Length=1324

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +3

Query  234  MVGMMAAV-SREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVGM+ AV SRE++  L+NS+K+A+ +PSK+  LR+LK+ +   D +LL+E LP +L+  
Sbjct  1    MVGMVMAVNSRERLYGLINSTKIASDIPSKLARLRQLKNVLLPEDPVLLSELLPRILELQ  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDRFSP+RKF  EM+  IG +HI+ LP I+PLLIT L DDTPAV RQSITC I++FR  L
Sbjct  61   SDRFSPIRKFVTEMIGEIGFKHIDLLPQIVPLLITVLTDDTPAVVRQSITCAIDLFRISL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
             K+A++GLYSSE+D+SL++ W W+ KF  EI ++A
Sbjct  121  VKIAMKGLYSSEIDNSLQSLWTWMLKFKEEIYSIA  155



>ref|XP_008464198.1| PREDICTED: uncharacterized protein LOC103502136 isoform X1 [Cucumis 
melo]
Length=1325

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +3

Query  234  MVGMMAAV-SREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVGM+ AV SRE++  L+NS+K+A+ +PSK+  LR+LK+ +   D +LL+E LP +L+  
Sbjct  1    MVGMVMAVNSRERLYGLINSTKIASDIPSKLARLRQLKNVLLPEDPVLLSELLPRILELQ  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDRFSP+RKF  EM+  IG +HI+ LP I+PLLIT L DDTPAV RQSITC I++FR  L
Sbjct  61   SDRFSPIRKFVTEMIGEIGFKHIDLLPQIVPLLITVLTDDTPAVVRQSITCAIDLFRISL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
             K+A++GLYSSE+D+SL++ W W+ KF  EI ++A
Sbjct  121  VKIAMKGLYSSEIDNSLQSLWTWMLKFKEEIYSIA  155



>ref|XP_004506749.1| PREDICTED: symplekin-like isoform X1 [Cicer arietinum]
Length=1335

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 117/156 (75%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGM-MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVG   AA SREK++ L++ +KLA  +PSK+  LR+LK E+   D +LLTEFLP + DF+
Sbjct  1    MVGQSKAATSREKLSSLVHRAKLAIDIPSKLEALRKLKIELPQEDPVLLTEFLPPIFDFL  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD FSPVRKF  EM+  IG+++ EFLP I+P+LI  L DDTPAV RQ I CGI++FRS L
Sbjct  61   SDDFSPVRKFVTEMVGEIGLKNTEFLPDIVPVLIDVLDDDTPAVIRQVILCGIDLFRSTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             K+ IQGLYSS+LD +LE++W W+ KF  ++ ++AF
Sbjct  121  EKITIQGLYSSDLDSALESAWEWMVKFKEKVYSIAF  156



>ref|XP_010253740.1| PREDICTED: uncharacterized protein LOC104594895 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010253741.1| PREDICTED: uncharacterized protein LOC104594895 isoform X1 [Nelumbo 
nucifera]
Length=1341

 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGM A  SREK A LL+S K +  +PSK+  LR+LK+ +   D  LLTEF+P L++  +
Sbjct  1    MVGMRAMGSREKAASLLSSVKFSMDIPSKIENLRQLKEVLLQRDPSLLTEFVPFLVELQT  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRFSPVRKF  EML  IG+ H +FLP IIP+L+  LKD+TPAVARQ+I+ G ++FR+ L 
Sbjct  61   DRFSPVRKFLAEMLGEIGMEHXDFLPEIIPVLLALLKDETPAVARQAISSGNDLFRNTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAI+GLYSSELDDSLE+SWAW+ KF   +  +AF
Sbjct  121  KVAIKGLYSSELDDSLESSWAWMLKFKGTVYPMAF  155



>ref|XP_006576526.1| PREDICTED: uncharacterized protein LOC100779360 isoform X2 [Glycine 
max]
Length=1357

 Score =   143 bits (360),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 116/158 (73%), Gaps = 3/158 (2%)
 Frame = +3

Query  234  MVGM---MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllD  404
            MVG    MAA SREK+A L+N++KLA  +PSK+  LR+L+ E+   D +LLTEFLP L  
Sbjct  1    MVGKTMSMAATSREKLASLVNAAKLAIDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFL  60

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SDRF PVRKF  EML  IG+++ EFL  I+P+LI  L DDTPAV RQ + CG ++FR+
Sbjct  61   FHSDRFGPVRKFLTEMLGEIGLKNTEFLSNIVPVLIDLLDDDTPAVVRQVLLCGTDLFRA  120

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+ +QGLYSS+LD +LE++WAW+ KF  ++ ++AF
Sbjct  121  TLEKIVVQGLYSSDLDGALESAWAWMLKFKDKVYSIAF  158



>ref|XP_010253742.1| PREDICTED: uncharacterized protein LOC104594895 isoform X2 [Nelumbo 
nucifera]
Length=1218

 Score =   143 bits (360),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGM A  SREK A LL+S K +  +PSK+  LR+LK+ +   D  LLTEF+P L++  +
Sbjct  1    MVGMRAMGSREKAASLLSSVKFSMDIPSKIENLRQLKEVLLQRDPSLLTEFVPFLVELQT  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRFSPVRKF  EML  IG+ H +FLP IIP+L+  LKD+TPAVARQ+I+ G ++FR+ L 
Sbjct  61   DRFSPVRKFLAEMLGEIGMEHXDFLPEIIPVLLALLKDETPAVARQAISSGNDLFRNTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAI+GLYSSELDDSLE+SWAW+ KF   +  +AF
Sbjct  121  KVAIKGLYSSELDDSLESSWAWMLKFKGTVYPMAF  155



>ref|XP_006576525.1| PREDICTED: uncharacterized protein LOC100779360 isoform X1 [Glycine 
max]
Length=1358

 Score =   143 bits (360),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 116/158 (73%), Gaps = 3/158 (2%)
 Frame = +3

Query  234  MVGM---MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllD  404
            MVG    MAA SREK+A L+N++KLA  +PSK+  LR+L+ E+   D +LLTEFLP L  
Sbjct  1    MVGKTMSMAATSREKLASLVNAAKLAIDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFL  60

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SDRF PVRKF  EML  IG+++ EFL  I+P+LI  L DDTPAV RQ + CG ++FR+
Sbjct  61   FHSDRFGPVRKFLTEMLGEIGLKNTEFLSNIVPVLIDLLDDDTPAVVRQVLLCGTDLFRA  120

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+ +QGLYSS+LD +LE++WAW+ KF  ++ ++AF
Sbjct  121  TLEKIVVQGLYSSDLDGALESAWAWMLKFKDKVYSIAF  158



>gb|KHN42510.1| Symplekin [Glycine soja]
Length=1352

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAA SREK+A L+N++KLA  +PSK+  LR+L+ E+   D +LLTEFLP L  F SDRF 
Sbjct  3    MAATSREKLASLVNAAKLAIDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFLFHSDRFG  62

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
            PVRKF  EML  IG+++ EFL  I+P+LI  L DDTPAV RQ + CG ++FR+ L K+ +
Sbjct  63   PVRKFLTEMLGEIGLKNTEFLSNIVPVLIDLLDDDTPAVVRQVLLCGTDLFRATLEKIVV  122

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            QGLYSS+LD +LE++WAW+ KF  ++ ++AF
Sbjct  123  QGLYSSDLDGALESAWAWMLKFKDKVYSIAF  153



>gb|EYU41898.1| hypothetical protein MIMGU_mgv1a000258mg [Erythranthe guttata]
Length=1348

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAA-VPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVGMMA +SREK+A  +NS K     +  K+  LRRL D+++  DS+LL EFL  ++D +
Sbjct  1    MVGMMAGISREKIASRINSIKYGGTDIGQKLDQLRRLGDDLAAVDSVLLVEFLSPIIDLL  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDR SPVRK    M+  IG++H+E LP IIP L+  LKDDTPAVARQ+ITCGI+IFRS L
Sbjct  61   SDRLSPVRKSVTRMIGEIGLKHLELLPEIIPALVDVLKDDTPAVARQAITCGIDIFRSSL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             KV IQGLYSS  ++S  +SW  V KF  EI ++AF
Sbjct  121  VKVTIQGLYSSGFNESQRSSWLSVLKFRDEIYSMAF  156



>ref|XP_007133891.1| hypothetical protein PHAVU_010G000700g [Phaseolus vulgaris]
 gb|ESW05885.1| hypothetical protein PHAVU_010G000700g [Phaseolus vulgaris]
Length=1255

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = +3

Query  234  MVGM---MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllD  404
            MVG    MA  SREK+A L+N++KLA+ +PSK+  LR+L+ E+   D +LLTEFLP L  
Sbjct  1    MVGKTMSMAVTSREKLASLVNAAKLASDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFL  60

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SDRF PVRKF  EM   IG+++ EFL  I+P+LI  L DDTPAV RQ++ CGI++FR 
Sbjct  61   FHSDRFGPVRKFITEMFGEIGLKNTEFLSDIVPMLIDVLDDDTPAVVRQALQCGIQLFRG  120

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+ +QGLYSS+LD +LE+ W W+ KF  ++ ++AF
Sbjct  121  TLEKIVVQGLYSSDLDGALESGWEWMLKFKDKVYSIAF  158



>ref|XP_007133889.1| hypothetical protein PHAVU_010G000700g [Phaseolus vulgaris]
 ref|XP_007133890.1| hypothetical protein PHAVU_010G000700g [Phaseolus vulgaris]
 gb|ESW05883.1| hypothetical protein PHAVU_010G000700g [Phaseolus vulgaris]
 gb|ESW05884.1| hypothetical protein PHAVU_010G000700g [Phaseolus vulgaris]
Length=1373

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = +3

Query  234  MVGM---MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllD  404
            MVG    MA  SREK+A L+N++KLA+ +PSK+  LR+L+ E+   D +LLTEFLP L  
Sbjct  1    MVGKTMSMAVTSREKLASLVNAAKLASDIPSKLESLRQLRHELPPEDPVLLTEFLPSLFL  60

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SDRF PVRKF  EM   IG+++ EFL  I+P+LI  L DDTPAV RQ++ CGI++FR 
Sbjct  61   FHSDRFGPVRKFITEMFGEIGLKNTEFLSDIVPMLIDVLDDDTPAVVRQALQCGIQLFRG  120

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+ +QGLYSS+LD +LE+ W W+ KF  ++ ++AF
Sbjct  121  TLEKIVVQGLYSSDLDGALESGWEWMLKFKDKVYSIAF  158



>gb|KCW86107.1| hypothetical protein EUGRSUZ_B02805 [Eucalyptus grandis]
Length=1076

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGMMA-AVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MV ++A A  RE++A L+ S+K +  +PSK+G LR LK+++   D +LL EFLP LLD +
Sbjct  1    MVAIVASATPRERLAGLVGSAKASPDIPSKLGRLRDLKEDLLQDDPVLLAEFLPQLLDLL  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDRFSPVRKF  +++  IGI+ +EFLP ++P+LI+ L D++P VARQ+I+CGI++FR   
Sbjct  61   SDRFSPVRKFIAQIIGEIGIKQLEFLPEMVPVLISLLTDESPPVARQAISCGIDLFRHTF  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
              +AIQGLY+S+LDDSLE++W W+ KF  ++ ++AF
Sbjct  121  ETIAIQGLYTSDLDDSLESAWEWMLKFKDKVYSIAF  156



>ref|XP_010653297.1| PREDICTED: uncharacterized protein LOC100262578 [Vitis vinifera]
 emb|CBI22794.3| unnamed protein product [Vitis vinifera]
Length=1332

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 115/155 (74%), Gaps = 7/155 (5%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMM        A L+NS+KLA  VPSK+ +LR+LK+++     +LL++FLP +LD  +
Sbjct  1    MVGMM-------TASLINSAKLALDVPSKLEHLRQLKEDLLHEGPVLLSQFLPRILDLHT  53

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DR SPVRKF  +M+  IG +H++ LP IIP+LI+ LKD TPAVARQ+ITC I++FR  L 
Sbjct  54   DRLSPVRKFIAQMIGEIGSKHLDLLPEIIPVLISLLKDGTPAVARQAITCAIDLFRCTLE  113

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVAIQGLYSSELD SLE+SW W+ KF  +I ++AF
Sbjct  114  KVAIQGLYSSELDVSLESSWEWMLKFKDKIYSIAF  148



>ref|XP_007208390.1| hypothetical protein PRUPE_ppa000295mg [Prunus persica]
 gb|EMJ09589.1| hypothetical protein PRUPE_ppa000295mg [Prunus persica]
Length=1332

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = +3

Query  234  MVGMM-AAVSREKVADLLNSSKLAAAVPSKMGYLRRLK-DEVSDADSIllteflplllDF  407
            MVGMM  A S E++A L++S+ LA+ +PSK+  LR+ K D V   D  LL+  LP L + 
Sbjct  1    MVGMMMVANSNERLASLMDSAILASDIPSKLDRLRQSKQDLVVQQDPALLSGLLPRLFEL  60

Query  408  VSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSM  587
             SDRFSPVRKF  EML  IG+ H+E LP I+P LI  L D TPAVARQ+IT GI +FR +
Sbjct  61   QSDRFSPVRKFATEMLGEIGLMHVELLPEIVPSLINVLSDGTPAVARQAITSGIHLFRCV  120

Query  588  LFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            L KV+IQGL+SSELD  LE+SWAWV K   EI ++AF
Sbjct  121  LEKVSIQGLHSSELDSLLESSWAWVLKLKEEIYSIAF  157



>ref|XP_008243673.1| PREDICTED: symplekin [Prunus mume]
Length=1327

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = +3

Query  234  MVGMM-AAVSREKVADLLNSSKLAAAVPSKMGYLRRLK-DEVSDADSIllteflplllDF  407
            MVGMM  A S E++A L++S+ LA+ +PSK+  LR+ K D V   D  LL+  LP L + 
Sbjct  1    MVGMMMVANSNERLASLMDSAILASDIPSKLDRLRQSKQDLVVQQDPALLSGLLPRLFEL  60

Query  408  VSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSM  587
             SDRFSPVRKF  EML  IG+ H+E LP I+P LI  L D TPAVARQ+IT GI +FR +
Sbjct  61   QSDRFSPVRKFATEMLGEIGLMHVELLPEIVPSLINVLSDGTPAVARQAITSGIHLFRCV  120

Query  588  LFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            L KV+IQGL+SSELD  LE+SWAWV K   EI ++AF
Sbjct  121  LEKVSIQGLHSSELDSLLESSWAWVLKLKEEIYSIAF  157



>ref|XP_010044097.1| PREDICTED: symplekin [Eucalyptus grandis]
Length=1298

 Score =   137 bits (345),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 80/156 (51%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGMMA-AVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MV ++A A  RE++A L+ S+K +  +PSK+G LR LK+++   D +LL EFLP LLD +
Sbjct  1    MVAIVASATPRERLAGLVGSAKASPDIPSKLGRLRDLKEDLLQDDPVLLAEFLPQLLDLL  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDRFSPVRKF  +++  IGI+ +EFLP ++P+LI+ L D++P VARQ+I+CGI++FR   
Sbjct  61   SDRFSPVRKFIAQIIGEIGIKQLEFLPEMVPVLISLLTDESPPVARQAISCGIDLFRHTF  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
              +AIQGLY+S+LDDSLE++W W+ KF  ++ ++AF
Sbjct  121  ETIAIQGLYTSDLDDSLESAWEWMLKFKDKVYSIAF  156



>ref|XP_006286894.1| hypothetical protein CARUB_v10000037mg [Capsella rubella]
 gb|EOA19792.1| hypothetical protein CARUB_v10000037mg [Capsella rubella]
Length=1456

 Score =   136 bits (343),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 80/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+MA+ SRE++  L +S+K A  +P K+  LR L+ ++   + +  TE LP L D +S
Sbjct  1    MVGIMASYSRERLEGLASSAKSATELPPKLQRLRNLRRDLQRDEPVFPTELLPHLFDLLS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D+F  VRKF  E+L  IG++++E LP I+P+LI +L+D+TPAVARQ I+CG ++FRS L 
Sbjct  61   DQFGAVRKFVAEILGEIGLKYVELLPEIVPILIKSLEDETPAVARQVISCGADLFRSTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            KVA+QGL+SSEL+D LE+SW W+ K   EIC+VAF
Sbjct  121  KVAVQGLHSSELNDLLESSWTWMIKVKDEICSVAF  155



>ref|NP_195760.1| Symplekin/Pta1-like protein [Arabidopsis thaliana]
 emb|CAB81923.1| putative protein [Arabidopsis thaliana]
 gb|AED90339.1| Symplekin/Pta1-like protein [Arabidopsis thaliana]
Length=1467

 Score =   136 bits (343),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 79/151 (52%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA+ SR ++ DL NS+K A  +P K+  LR ++ ++   DS+  TE LP L D +SD+F 
Sbjct  1    MASYSRARLKDLANSAKSATELPPKLQRLRYMRRDLQKDDSVFPTELLPHLFDLLSDQFG  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRKF  E+L  IG++++E +P I+PLLI +L+D+TPAVARQ I CG ++FRS L +VA+
Sbjct  61   AVRKFVAEILGEIGLKYVELIPEIVPLLIKSLEDETPAVARQVIACGADLFRSTLERVAV  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            QGL+SSEL+D LE+SW W+ KF  EIC+VAF
Sbjct  121  QGLHSSELNDLLESSWTWLIKFKDEICSVAF  151



>ref|XP_010095240.1| hypothetical protein L484_008249 [Morus notabilis]
 gb|EXB59008.1| hypothetical protein L484_008249 [Morus notabilis]
Length=968

 Score =   134 bits (337),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGMM-AAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVGMM  A S EK+A L++S+K A  +PSK+  LR+LK ++   +   L++ LP L +  
Sbjct  1    MVGMMMTANSTEKLAGLVDSAKFATDIPSKLDRLRQLKHDLLHENPSSLSDLLPRLFELQ  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SDRF PVRKF  +++  IG++++EFLP I+P+LIT L D TPAVARQ I CGI +FR  L
Sbjct  61   SDRFGPVRKFATKIIGEIGLKYVEFLPEIVPVLITVLNDATPAVARQGINCGINLFRRTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             ++A+QGL+SSELD SLE+SW W+ K   +I ++AF
Sbjct  121  ERIAVQGLHSSELDGSLESSWEWMLKLKEKIYSIAF  156



>ref|XP_010543210.1| PREDICTED: uncharacterized protein LOC104816196 isoform X2 [Tarenaya 
hassleriana]
Length=1406

 Score =   134 bits (337),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 81/155 (52%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M + S E++  L NS+KLA  +P K+  LR+L+  + +  +I  +E LPLL D +S
Sbjct  4    MVGIMTSNSGERLDGLANSAKLATELPPKLDRLRQLRRYLQEDSTIFSSELLPLLFDLLS  63

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRF  VRK   E+L  IG++H+++LP I+P+ I ALKD+TPAVARQ I CG  +FRS L 
Sbjct  64   DRFGAVRKIVAEILGEIGLKHLDYLPEIVPVFIEALKDETPAVARQVIACGANLFRSTLE  123

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             VA+QGL+SSEL++ LE+SWAW+ KF  EIC++AF
Sbjct  124  SVAVQGLHSSELNELLESSWAWMLKFKDEICSLAF  158



>ref|XP_010543208.1| PREDICTED: uncharacterized protein LOC104816196 isoform X1 [Tarenaya 
hassleriana]
Length=1419

 Score =   134 bits (337),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 81/155 (52%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M + S E++  L NS+KLA  +P K+  LR+L+  + +  +I  +E LPLL D +S
Sbjct  4    MVGIMTSNSGERLDGLANSAKLATELPPKLDRLRQLRRYLQEDSTIFSSELLPLLFDLLS  63

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DRF  VRK   E+L  IG++H+++LP I+P+ I ALKD+TPAVARQ I CG  +FRS L 
Sbjct  64   DRFGAVRKIVAEILGEIGLKHLDYLPEIVPVFIEALKDETPAVARQVIACGANLFRSTLE  123

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             VA+QGL+SSEL++ LE+SWAW+ KF  EIC++AF
Sbjct  124  SVAVQGLHSSELNELLESSWAWMLKFKDEICSLAF  158



>ref|XP_010423951.1| PREDICTED: uncharacterized protein LOC104708990 [Camelina sativa]
Length=1442

 Score =   133 bits (334),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 79/155 (51%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+MA+ SRE++  L +S+K A  +P K+  LR L+ ++   +S+   E LP L D +S
Sbjct  1    MVGIMASYSRERLEGLASSAKSATELPPKLQRLRNLRRDLQKDESVFPIELLPHLFDLLS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D+F  VRKF  E+L  IG++++E LP I+PLLI +L+D+TPAVARQ I C  ++FRS L 
Sbjct  61   DQFGAVRKFVAEILGEIGLKYVELLPEIVPLLIKSLEDETPAVARQVIACVADLFRSTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +VA+QGL+SSEL+D LE+SW W+ K   EIC+VAF
Sbjct  121  RVAVQGLHSSELNDLLESSWTWMIKVKDEICSVAF  155



>gb|KHG27415.1| Symplekin [Gossypium arboreum]
Length=1327

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+A L +S K A  + SK+   R+LK ++ + D+  L+EFLP + D  S
Sbjct  1    MVGIMNPVSREKLASLSSSVKFAIDLGSKLELCRQLKHDLLEEDAADLSEFLPRIFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRKF  E++  IG++H+EF+  I P LIT ++D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKFATEIIGEIGVKHLEFVAEIAPFLITVVEDATPAVARQSIACSIDLFRHTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            K+AI+GLYSSELD  LE+SW+W+ K   +I ++AF
Sbjct  121  KIAIRGLYSSELDSDLESSWSWMLKLKEKIYSIAF  155



>ref|XP_010490570.1| PREDICTED: uncharacterized protein LOC104768323 [Camelina sativa]
Length=1456

 Score =   132 bits (332),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 80/156 (51%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGMMAA-VSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFV  410
            MVG+MA+  SRE++  L +S+K A  +P K+  LR L+ ++   +S+   E LP L D +
Sbjct  1    MVGIMASSYSRERLEGLASSAKSATELPPKLQRLRNLRRDLQKDESVFPIELLPHLFDLL  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD+F  VRKF  E+L  IG++++E LP I+PLLI +L+D+TPAVARQ I CG ++FRS L
Sbjct  61   SDQFGAVRKFVAEILGEIGLKYVELLPEIVPLLIKSLEDETPAVARQVIACGADLFRSTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             +VA+QGL+SSEL+D LE+SW W+ K   EIC+VAF
Sbjct  121  ERVAVQGLHSSELNDFLESSWTWMIKVKDEICSVAF  156



>ref|XP_007026695.1| HEAT repeat-containing protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY07197.1| HEAT repeat-containing protein isoform 3, partial [Theobroma 
cacao]
Length=1295

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+A L NS KLA  + SK+    +LK  + + D+  L+EFLP L D  S
Sbjct  1    MVGIMNPVSREKLASLFNSVKLAVDLASKLDLSHQLKQTLLEEDAAALSEFLPRLFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRK   E++  IG+++++F+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKLATEIIGEIGVKNLDFVPEIAPFLITVLEDATPAVARQSIACSIDLFRLTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            K+AIQGLYSSELD  LE SW+W+ K   +I ++AF
Sbjct  121  KIAIQGLYSSELDSDLEASWSWMLKLKEKIYSIAF  155



>ref|XP_007026693.1| HEAT repeat-containing protein isoform 1 [Theobroma cacao]
 gb|EOY07195.1| HEAT repeat-containing protein isoform 1 [Theobroma cacao]
Length=1338

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+A L NS KLA  + SK+    +LK  + + D+  L+EFLP L D  S
Sbjct  1    MVGIMNPVSREKLASLFNSVKLAVDLASKLDLSHQLKQTLLEEDAAALSEFLPRLFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRK   E++  IG+++++F+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKLATEIIGEIGVKNLDFVPEIAPFLITVLEDATPAVARQSIACSIDLFRLTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            K+AIQGLYSSELD  LE SW+W+ K   +I ++AF
Sbjct  121  KIAIQGLYSSELDSDLEASWSWMLKLKEKIYSIAF  155



>ref|XP_007026696.1| HEAT repeat-containing protein isoform 4 [Theobroma cacao]
 gb|EOY07198.1| HEAT repeat-containing protein isoform 4 [Theobroma cacao]
Length=1266

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+A L NS KLA  + SK+    +LK  + + D+  L+EFLP L D  S
Sbjct  1    MVGIMNPVSREKLASLFNSVKLAVDLASKLDLSHQLKQTLLEEDAAALSEFLPRLFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRK   E++  IG+++++F+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKLATEIIGEIGVKNLDFVPEIAPFLITVLEDATPAVARQSIACSIDLFRLTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            K+AIQGLYSSELD  LE SW+W+ K   +I ++AF
Sbjct  121  KIAIQGLYSSELDSDLEASWSWMLKLKEKIYSIAF  155



>ref|XP_007026694.1| HEAT repeat-containing protein isoform 2 [Theobroma cacao]
 gb|EOY07196.1| HEAT repeat-containing protein isoform 2 [Theobroma cacao]
Length=1120

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+A L NS KLA  + SK+    +LK  + + D+  L+EFLP L D  S
Sbjct  1    MVGIMNPVSREKLASLFNSVKLAVDLASKLDLSHQLKQTLLEEDAAALSEFLPRLFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRK   E++  IG+++++F+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKLATEIIGEIGVKNLDFVPEIAPFLITVLEDATPAVARQSIACSIDLFRLTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            K+AIQGLYSSELD  LE SW+W+ K   +I ++AF
Sbjct  121  KIAIQGLYSSELDSDLEASWSWMLKLKEKIYSIAF  155



>ref|XP_007026697.1| HEAT repeat-containing protein isoform 5 [Theobroma cacao]
 gb|EOY07199.1| HEAT repeat-containing protein isoform 5 [Theobroma cacao]
Length=1125

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+A L NS KLA  + SK+    +LK  + + D+  L+EFLP L D  S
Sbjct  1    MVGIMNPVSREKLASLFNSVKLAVDLASKLDLSHQLKQTLLEEDAAALSEFLPRLFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRK   E++  IG+++++F+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKLATEIIGEIGVKNLDFVPEIAPFLITVLEDATPAVARQSIACSIDLFRLTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            K+AIQGLYSSELD  LE SW+W+ K   +I ++AF
Sbjct  121  KIAIQGLYSSELDSDLEASWSWMLKLKEKIYSIAF  155



>ref|XP_002322982.1| hypothetical protein POPTR_0016s12390g [Populus trichocarpa]
 gb|EEF04743.1| hypothetical protein POPTR_0016s12390g [Populus trichocarpa]
Length=1411

 Score =   130 bits (327),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 75/158 (47%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKD---EVSDADSIllteflplllD  404
            MV M  + SRE++A L+NS+K A+ +PSK+  LR+L     +  +A+S+          +
Sbjct  1    MVAMTKSSSRERLASLINSAKSASDIPSKLQTLRQLNQILQQQENANSLSEFLPRIF--E  58

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SD+ SPVRKF  EM+  IG++H+EF+P I+P+L+  L+D  PAVARQ+ITCGI +FR+
Sbjct  59   FQSDQHSPVRKFATEMIGEIGLKHLEFVPEIVPVLMLVLEDLVPAVARQAITCGISLFRA  118

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+AIQGLY+SELDD L++SW+ + +F  +I ++AF
Sbjct  119  TLEKLAIQGLYTSELDDLLKSSWSSMLEFKEKIYSIAF  156



>gb|KJB17063.1| hypothetical protein B456_002G263300 [Gossypium raimondii]
Length=1330

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+  L +S K A  + SK+   R+LK ++ + D+  L+EFLP + D  S
Sbjct  1    MVGIMNPVSREKLESLSSSVKFAIDLGSKLELCRQLKHDLLEEDAADLSEFLPRIFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRKF  E++  IG++H+EF+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKFATEIIGEIGVKHLEFVPEIAPFLITVLEDATPAVARQSIACSIDLFRHTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            ++AI+GLYSSELD  LE+SW+W+ K   +I ++AF
Sbjct  121  QIAIRGLYSSELDSDLESSWSWMLKLKEKIYSIAF  155



>gb|KJB17064.1| hypothetical protein B456_002G263300 [Gossypium raimondii]
Length=1332

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+  L +S K A  + SK+   R+LK ++ + D+  L+EFLP + D  S
Sbjct  1    MVGIMNPVSREKLESLSSSVKFAIDLGSKLELCRQLKHDLLEEDAADLSEFLPRIFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRKF  E++  IG++H+EF+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKFATEIIGEIGVKHLEFVPEIAPFLITVLEDATPAVARQSIACSIDLFRHTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            ++AI+GLYSSELD  LE+SW+W+ K   +I ++AF
Sbjct  121  QIAIRGLYSSELDSDLESSWSWMLKLKEKIYSIAF  155



>gb|KJB17065.1| hypothetical protein B456_002G263300 [Gossypium raimondii]
 gb|KJB17067.1| hypothetical protein B456_002G263300 [Gossypium raimondii]
 gb|KJB17068.1| hypothetical protein B456_002G263300 [Gossypium raimondii]
Length=1335

 Score =   129 bits (325),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 79/155 (51%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+  L +S K A  + SK+   R+LK ++ + D+  L+EFLP + D  S
Sbjct  1    MVGIMNPVSREKLESLSSSVKFAIDLGSKLELCRQLKHDLLEEDAADLSEFLPRIFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRKF  E++  IG++H+EF+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKFATEIIGEIGVKHLEFVPEIAPFLITVLEDATPAVARQSIACSIDLFRHTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            ++AI+GLYSSELD  LE+SW+W+ K   +I ++AF
Sbjct  121  QIAIRGLYSSELDSDLESSWSWMLKLKEKIYSIAF  155



>gb|KJB17066.1| hypothetical protein B456_002G263300 [Gossypium raimondii]
Length=1337

 Score =   129 bits (325),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 79/155 (51%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M  VSREK+  L +S K A  + SK+   R+LK ++ + D+  L+EFLP + D  S
Sbjct  1    MVGIMNPVSREKLESLSSSVKFAIDLGSKLELCRQLKHDLLEEDAADLSEFLPRIFDLYS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D   PVRKF  E++  IG++H+EF+P I P LIT L+D TPAVARQSI C I++FR  L 
Sbjct  61   DPSGPVRKFATEIIGEIGVKHLEFVPEIAPFLITVLEDATPAVARQSIACSIDLFRHTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            ++AI+GLYSSELD  LE+SW+W+ K   +I ++AF
Sbjct  121  QIAIRGLYSSELDSDLESSWSWMLKLKEKIYSIAF  155



>ref|XP_006398618.1| hypothetical protein EUTSA_v10012442mg [Eutrema salsugineum]
 gb|ESQ40071.1| hypothetical protein EUTSA_v10012442mg [Eutrema salsugineum]
Length=1426

 Score =   129 bits (324),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 80/155 (52%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+M + SRE +  L +S+K A  +  K+  LR L+ ++    S+  TE LPLL D +S
Sbjct  1    MVGIMVSYSRETLEGLASSAKSATELAPKLHCLRNLRRDLQKEASVFPTELLPLLFDLLS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D+F  VRKF  E+L  IG++++E LP I+PLLI + KD+TPAVARQ I CG ++FRS L 
Sbjct  61   DQFGAVRKFVAEVLGEIGLKYVELLPEIVPLLIKSHKDETPAVARQVIVCGTDLFRSTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +VA+QGL+SSELD+ LE+SW W+ KF  EIC++AF
Sbjct  121  RVAVQGLHSSELDELLESSWTWMIKFKDEICSLAF  155



>ref|XP_008390696.1| PREDICTED: symplekin isoform X1 [Malus domestica]
Length=1428

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 2/157 (1%)
 Frame = +3

Query  234  MVGMM-AAVSREKVADLLNSSKLAAAVPSKMGYLRRLK-DEVSDADSIllteflplllDF  407
            MVGMM  A S E++A L++S+  AA +PSK+  LR+ K D V   D  LL+E LP   + 
Sbjct  1    MVGMMMTANSHERLAGLMDSAIFAADIPSKLDRLRQSKQDLVRQQDPDLLSELLPRFFEL  60

Query  408  VSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSM  587
             SDRFSPVRKF  EML  IG+ H+E LP I+P LI  L D+TPAVARQ+IT G  +FR +
Sbjct  61   QSDRFSPVRKFATEMLGEIGLMHVELLPDIVPSLIDVLSDETPAVARQAITSGSNLFRCV  120

Query  588  LFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            L KV+IQGL++SELD SLE++WA V K   EI ++AF
Sbjct  121  LEKVSIQGLHASELDSSLESAWACVLKLKDEIYSIAF  157



>ref|XP_008390697.1| PREDICTED: symplekin isoform X2 [Malus domestica]
Length=1424

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 2/157 (1%)
 Frame = +3

Query  234  MVGMM-AAVSREKVADLLNSSKLAAAVPSKMGYLRRLK-DEVSDADSIllteflplllDF  407
            MVGMM  A S E++A L++S+  AA +PSK+  LR+ K D V   D  LL+E LP   + 
Sbjct  1    MVGMMMTANSHERLAGLMDSAIFAADIPSKLDRLRQSKQDLVRQQDPDLLSELLPRFFEL  60

Query  408  VSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSM  587
             SDRFSPVRKF  EML  IG+ H+E LP I+P LI  L D+TPAVARQ+IT G  +FR +
Sbjct  61   QSDRFSPVRKFATEMLGEIGLMHVELLPDIVPSLIDVLSDETPAVARQAITSGSNLFRCV  120

Query  588  LFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            L KV+IQGL++SELD SLE++WA V K   EI ++AF
Sbjct  121  LEKVSIQGLHASELDSSLESAWACVLKLKDEIYSIAF  157



>ref|XP_011006561.1| PREDICTED: uncharacterized protein LOC105112532 isoform X3 [Populus 
euphratica]
Length=1177

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKD---EVSDADSIllteflplllD  404
            MV M  + SRE++A L+NS+K A  +P K+  LR+L     +  +A+S+          +
Sbjct  1    MVAMTKSSSRERLASLINSAKSAPDIPLKLQTLRQLNQILQQQENANSLSEFLPGIF--E  58

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SD+ SPVRKF  E++  IG++H+EF+P I+P+L+  L+D  PAVARQ+ITCGI +FR+
Sbjct  59   FQSDQHSPVRKFATEIIGEIGLKHLEFVPEIVPVLMLVLEDPVPAVARQAITCGISLFRA  118

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+AIQGLY+SELDD L+ SW+ + +F  +I ++AF
Sbjct  119  TLEKLAIQGLYASELDDLLKFSWSSMLEFKEKIYSIAF  156



>ref|XP_011466471.1| PREDICTED: uncharacterized protein LOC101312467 [Fragaria vesca 
subsp. vesca]
Length=1322

 Score =   127 bits (318),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 79/158 (50%), Positives = 109/158 (69%), Gaps = 3/158 (2%)
 Frame = +3

Query  234  MVGMM---AAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllD  404
            MVGMM    A S E +  L++S+ +AA +PSK+  L +LK ++   D   ++E LP L +
Sbjct  1    MVGMMMMTTANSNEHLTRLMDSAVVAADIPSKLDRLTQLKRDLLRRDPAFISELLPRLFE  60

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
              SDRFSPVRKF  EML  IG+ H++ LP I+P LI  L D TPAVARQ+IT G E+FR 
Sbjct  61   LQSDRFSPVRKFATEMLGEIGLLHVDLLPEIVPSLINVLSDGTPAVARQAITSGTELFRC  120

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            ++ KVA+QGL+SSE+D  LE++W+W+ K   EI ++AF
Sbjct  121  VMEKVALQGLHSSEMDSLLESAWSWMLKLKEEIFSIAF  158



>gb|KFK24648.1| hypothetical protein AALP_AA8G006900 [Arabis alpina]
Length=1448

 Score =   127 bits (318),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 74/151 (49%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA+ SRE++  L  S+  +  +P K+  LR L+  +    S+   E LP L D +SD+F 
Sbjct  1    MASYSRERLQGLATSAISSTELPPKLHRLRNLRRNLQGDASVFPNELLPRLSDLLSDQFG  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRKF +E+L  IG++++E LP I+PLLI +LKD+TPAV RQ I CG ++FRS L +VA+
Sbjct  61   AVRKFVVEILGEIGLKYVELLPEIVPLLIKSLKDETPAVVRQVIACGADLFRSTLERVAV  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            QGL+SS+LD+ LE+SW W+ KF  EIC++AF
Sbjct  121  QGLHSSKLDEVLESSWTWMVKFKDEICSLAF  151



>ref|XP_010451991.1| PREDICTED: symplekin-like isoform X1 [Camelina sativa]
Length=1442

 Score =   126 bits (317),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 80/155 (52%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+MA+ SRE++  L +S+K A  +P K+  LR L+ ++   +S+   E LP L D +S
Sbjct  1    MVGIMASYSRERLEGLASSAKSATELPPKLHRLRNLRRDLRKDESVFPIELLPHLFDLLS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D+F  VRKF  E+L  IG++++E LP I+PLLI +L+D+TPAVARQ I CG ++FRS L 
Sbjct  61   DQFGAVRKFVAEILGEIGLKYVELLPEIVPLLIKSLEDETPAVARQVIACGADLFRSTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +VA+QGL+SSEL+D LE+SW W+ K   EIC+VAF
Sbjct  121  RVAVQGLHSSELNDFLESSWTWMIKVKDEICSVAF  155



>ref|XP_010451992.1| PREDICTED: symplekin-like isoform X2 [Camelina sativa]
Length=1441

 Score =   126 bits (317),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 80/155 (52%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+MA+ SRE++  L +S+K A  +P K+  LR L+ ++   +S+   E LP L D +S
Sbjct  1    MVGIMASYSRERLEGLASSAKSATELPPKLHRLRNLRRDLRKDESVFPIELLPHLFDLLS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            D+F  VRKF  E+L  IG++++E LP I+PLLI +L+D+TPAVARQ I CG ++FRS L 
Sbjct  61   DQFGAVRKFVAEILGEIGLKYVELLPEIVPLLIKSLEDETPAVARQVIACGADLFRSTLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +VA+QGL+SSEL+D LE+SW W+ K   EIC+VAF
Sbjct  121  RVAVQGLHSSELNDFLESSWTWMIKVKDEICSVAF  155



>ref|XP_008793266.1| PREDICTED: symplekin isoform X2 [Phoenix dactylifera]
Length=1271

 Score =   125 bits (313),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 0/154 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMMAA   E  A LLNS++ +  +P+K+ +LR+LK+ +   D  LL +F P L +  +
Sbjct  1    MVGMMAADWAETAASLLNSARSSGEIPAKLRWLRQLKEVLLHRDPSLLPDFAPRLAELQA  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DR SPVRK   EM+  IG++H+E LP +IP LI  LKD TPAVARQ+I  G  +FR++L 
Sbjct  61   DRASPVRKLLAEMIGDIGMKHMELLPEMIPSLIYFLKDSTPAVARQAIITGTYLFRNVLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
            KV IQGL SS+LDDSL++SWAW+ K+   +  +A
Sbjct  121  KVVIQGLCSSDLDDSLKSSWAWMLKYKNAVLPIA  154



>ref|XP_008793258.1| PREDICTED: symplekin isoform X1 [Phoenix dactylifera]
Length=1328

 Score =   125 bits (313),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 0/154 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMMAA   E  A LLNS++ +  +P+K+ +LR+LK+ +   D  LL +F P L +  +
Sbjct  1    MVGMMAADWAETAASLLNSARSSGEIPAKLRWLRQLKEVLLHRDPSLLPDFAPRLAELQA  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DR SPVRK   EM+  IG++H+E LP +IP LI  LKD TPAVARQ+I  G  +FR++L 
Sbjct  61   DRASPVRKLLAEMIGDIGMKHMELLPEMIPSLIYFLKDSTPAVARQAIITGTYLFRNVLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
            KV IQGL SS+LDDSL++SWAW+ K+   +  +A
Sbjct  121  KVVIQGLCSSDLDDSLKSSWAWMLKYKNAVLPIA  154



>ref|XP_011006559.1| PREDICTED: uncharacterized protein LOC105112532 isoform X1 [Populus 
euphratica]
Length=1357

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKD---EVSDADSIllteflplllD  404
            MV M  + SRE++A L+NS+K A  +P K+  LR+L     +  +A+S+          +
Sbjct  1    MVAMTKSSSRERLASLINSAKSAPDIPLKLQTLRQLNQILQQQENANSLSEFLPGIF--E  58

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SD+ SPVRKF  E++  IG++H+EF+P I+P+L+  L+D  PAVARQ+ITCGI +FR+
Sbjct  59   FQSDQHSPVRKFATEIIGEIGLKHLEFVPEIVPVLMLVLEDPVPAVARQAITCGISLFRA  118

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+AIQGLY+SELDD L+ SW+ + +F  +I ++AF
Sbjct  119  TLEKLAIQGLYASELDDLLKFSWSSMLEFKEKIYSIAF  156



>ref|XP_002870923.1| hypothetical protein ARALYDRAFT_486936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47182.1| hypothetical protein ARALYDRAFT_486936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1481

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 78/151 (52%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA+ SRE++  L +S+K A  +P K+  LR L+ ++   +S+  TE LP L D +SD+F 
Sbjct  1    MASYSRERLEGLASSAKSATELPPKLQRLRYLRRDLRKDESVFPTELLPHLFDLLSDQFG  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRKF  E+L  +G++++E LP I+PLLI +L+D+TPAVARQ I CG+++FRS L +VA+
Sbjct  61   AVRKFVAEILGEVGLKYVELLPEIVPLLIKSLEDETPAVARQVIACGVDLFRSTLERVAV  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            QGL+SSEL+D LE+SW WV KF  EIC++AF
Sbjct  121  QGLHSSELNDLLESSWTWVIKFKDEICSLAF  151



>ref|XP_011006560.1| PREDICTED: uncharacterized protein LOC105112532 isoform X2 [Populus 
euphratica]
Length=1327

 Score =   124 bits (311),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKD---EVSDADSIllteflplllD  404
            MV M  + SRE++A L+NS+K A  +P K+  LR+L     +  +A+S+          +
Sbjct  1    MVAMTKSSSRERLASLINSAKSAPDIPLKLQTLRQLNQILQQQENANSLSEFLPGIF--E  58

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            F SD+ SPVRKF  E++  IG++H+EF+P I+P+L+  L+D  PAVARQ+ITCGI +FR+
Sbjct  59   FQSDQHSPVRKFATEIIGEIGLKHLEFVPEIVPVLMLVLEDPVPAVARQAITCGISLFRA  118

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             L K+AIQGLY+SELDD L+ SW+ + +F  +I ++AF
Sbjct  119  TLEKLAIQGLYASELDDLLKFSWSSMLEFKEKIYSIAF  156



>ref|XP_002528089.1| symplekin, putative [Ricinus communis]
 gb|EEF34268.1| symplekin, putative [Ricinus communis]
Length=1341

 Score =   120 bits (302),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 75/153 (49%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = +3

Query  243  MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEV-SDADSIllteflplllDFVSDR  419
            MM + SR+++A L+N    A  +P+K+  LR+LK+ +  + D+  L++FLP LL+  SD 
Sbjct  1    MMKSSSRDRLASLINC---AMDIPTKLEILRQLKENLLQETDAASLSDFLPRLLELQSDE  57

Query  420  FSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKV  599
            +SPVRK   EM+  IG++H+EF+P I+ +LI  L+D  PAVARQ+ITCGI +FRS L K+
Sbjct  58   YSPVRKCVTEMIGDIGLKHLEFVPEIVNVLINVLEDRAPAVARQAITCGINLFRSTLQKI  117

Query  600  AIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            AI+GLY+SELDD L+ SW+ + +F  +I +VAF
Sbjct  118  AIKGLYTSELDDVLKLSWSSMLEFKEKIYSVAF  150



>ref|XP_009404651.1| PREDICTED: uncharacterized protein LOC103987912 [Musa acuminata 
subsp. malaccensis]
Length=1329

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 101/154 (66%), Gaps = 0/154 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            M  M AA   E+   LL S++ A  VPSK+  LR+LK  +   D  LL EF+  L +  S
Sbjct  1    MAAMTAAGWGERAVGLLESARTAGEVPSKLKQLRQLKAVLLHRDPPLLPEFVTRLTELQS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            +R SP+RKF  EM+  IG +HIE LP ++P LI  LKD+TPAVARQ+IT G  +F  +L 
Sbjct  61   ERASPIRKFLAEMIGDIGSKHIELLPEMVPCLIAFLKDETPAVARQAITTGTSLFGYVLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
            K+ IQGLYSSE+DDS ++SWAW+ KF   +  +A
Sbjct  121  KLVIQGLYSSEIDDSTKSSWAWMLKFKDAVLHIA  154



>ref|XP_010920861.1| PREDICTED: uncharacterized protein LOC105044609 [Elaeis guineensis]
Length=1337

 Score =   117 bits (294),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 74/154 (48%), Positives = 106/154 (69%), Gaps = 0/154 (0%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVGMMA    E  A LLNS++ +  +P+K+ +LR+LK+ +   D  LL +F+P L +  +
Sbjct  1    MVGMMAVNWGETAASLLNSARSSGDIPAKLRWLRQLKEVLLHRDLSLLPDFVPRLAELQA  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            DR  PVRK   EM+  IG++H+E LP +IP LI  LKD+TPAVARQ+I  G  +FRS+L 
Sbjct  61   DRAGPVRKLLAEMIGDIGMKHMELLPEMIPSLIFFLKDETPAVARQAIITGTYLFRSVLE  120

Query  594  KVAIQGLYSSELDDSLETSWAWVQKFMYEICTVA  695
            KV IQGL SS++DDSL++SW W+ ++   +  +A
Sbjct  121  KVVIQGLCSSDVDDSLKSSWTWMLEYKNAVFPIA  154



>ref|XP_006481043.1| PREDICTED: uncharacterized protein LOC102608920 isoform X2 [Citrus 
sinensis]
Length=1323

 Score =   114 bits (286),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 78/156 (50%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDAD-SIllteflplllDFV  410
            MVGM  + SREK   L+ S K A  +PSK+ YLRRLK  + D + ++L++E +P   D  
Sbjct  1    MVGMTNSNSREKYLSLVYSVKAAINLPSKLEYLRRLKQALLDEENALLISEIIPCFFDLF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD F+PVRKF  E++  +G++H++ +P I+P+LI+ L D TPAVARQ+IT G+++FR  L
Sbjct  61   SDSFAPVRKFATEVIGEVGLKHVQLVPEIVPVLISVLDDATPAVARQAITSGLDLFRFTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             KVAIQGL+SS+LD SLE+SW W+ KF  ++ ++AF
Sbjct  121  EKVAIQGLHSSDLDSSLESSWEWMLKFKDKVYSIAF  156



>ref|XP_006481042.1| PREDICTED: uncharacterized protein LOC102608920 isoform X1 [Citrus 
sinensis]
Length=1327

 Score =   114 bits (286),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 78/156 (50%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDAD-SIllteflplllDFV  410
            MVGM  + SREK   L+ S K A  +PSK+ YLRRLK  + D + ++L++E +P   D  
Sbjct  1    MVGMTNSNSREKYLSLVYSVKAAINLPSKLEYLRRLKQALLDEENALLISEIIPCFFDLF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD F+PVRKF  E++  +G++H++ +P I+P+LI+ L D TPAVARQ+IT G+++FR  L
Sbjct  61   SDSFAPVRKFATEVIGEVGLKHVQLVPEIVPVLISVLDDATPAVARQAITSGLDLFRFTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             KVAIQGL+SS+LD SLE+SW W+ KF  ++ ++AF
Sbjct  121  EKVAIQGLHSSDLDSSLESSWEWMLKFKDKVYSIAF  156



>ref|XP_006429396.1| hypothetical protein CICLE_v10010921mg [Citrus clementina]
 gb|ESR42636.1| hypothetical protein CICLE_v10010921mg [Citrus clementina]
Length=1327

 Score =   113 bits (283),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 78/156 (50%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDAD-SIllteflplllDFV  410
            MVGM  + SREK   L+ S K A  +PSK+ YLRRLK  + D + ++L++E +P   D  
Sbjct  1    MVGMTNSNSREKYLSLVYSVKAAINLPSKLEYLRRLKQALLDEENALLISEIIPCFFDLF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD F+PVRKF  E+   +G++H++ +P I+P+LI+ L D TPAVARQ+IT G+++FR  L
Sbjct  61   SDSFAPVRKFATEVTGEVGLKHVQLVPEIVPVLISVLDDATPAVARQAITSGLDLFRFTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             KVAIQGL+SS+LD SLE+SW W+ KF  ++ ++AF
Sbjct  121  EKVAIQGLHSSDLDSSLESSWEWMLKFKDKVYSIAF  156



>gb|ERN05241.1| hypothetical protein AMTR_s00007p00088050 [Amborella trichopoda]
Length=1327

 Score =   106 bits (264),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVS  413
            MVG+MA+  R+K   L NS+K +  +PSK+  LR+L++ V   D  LL EF+P L++  S
Sbjct  1    MVGVMASCPRDKALSLFNSAKFSIEIPSKLEPLRQLQEIVVYRDPTLLVEFVPHLMELQS  60

Query  414  DRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLF  593
            + FSP+RKF  EM+  IG++H +FLP ++P+LI+ LKDDTPAVA+Q+IT G  +FRS L 
Sbjct  61   EHFSPIRKFLAEMIGEIGLKHRQFLPEMVPVLISFLKDDTPAVAKQAITTGTNLFRSTLE  120

Query  594  KVAIQGLYSSELDDSL-ETSWAWVQKFMYEICTVAF  698
             VA+Q      L DSL E+SW  +  F   +  VAF
Sbjct  121  DVALQA-----LPDSLRESSWTCMLNFKEAVYPVAF  151



>ref|XP_009125421.1| PREDICTED: symplekin isoform X3 [Brassica rapa]
Length=1502

 Score =   105 bits (262),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 75/162 (46%), Positives = 103/162 (64%), Gaps = 7/162 (4%)
 Frame = +3

Query  234  MVG-MMAAVS------REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflp  392
            MVG +MAA S      REK+  L  S+K A  +P K+  LR L+  +    S+   E LP
Sbjct  1    MVGAIMAASSYSYSYSREKLQGLARSAKSATDLPPKLHRLRNLRRNLQGEASVFPAELLP  60

Query  393  lllDFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIE  572
            LL D +SD+F   RKF  ++L  +G+ ++E LP I+PL I +L+DDTPAV RQ I     
Sbjct  61   LLFDLLSDQFGAARKFVAQILGEVGLNYVELLPEIVPLFIKSLQDDTPAVVRQVIASASA  120

Query  573  IFRSMLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +FRS L K A+QGL+SSELD+ L++SW W+ K   EIC++AF
Sbjct  121  LFRSTLHKFALQGLHSSELDELLQSSWTWMLKLKDEICSLAF  162



>ref|XP_009125420.1| PREDICTED: symplekin isoform X2 [Brassica rapa]
Length=1515

 Score =   105 bits (262),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 75/162 (46%), Positives = 103/162 (64%), Gaps = 7/162 (4%)
 Frame = +3

Query  234  MVG-MMAAVS------REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflp  392
            MVG +MAA S      REK+  L  S+K A  +P K+  LR L+  +    S+   E LP
Sbjct  1    MVGAIMAASSYSYSYSREKLQGLARSAKSATDLPPKLHRLRNLRRNLQGEASVFPAELLP  60

Query  393  lllDFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIE  572
            LL D +SD+F   RKF  ++L  +G+ ++E LP I+PL I +L+DDTPAV RQ I     
Sbjct  61   LLFDLLSDQFGAARKFVAQILGEVGLNYVELLPEIVPLFIKSLQDDTPAVVRQVIASASA  120

Query  573  IFRSMLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +FRS L K A+QGL+SSELD+ L++SW W+ K   EIC++AF
Sbjct  121  LFRSTLHKFALQGLHSSELDELLQSSWTWMLKLKDEICSLAF  162



>ref|XP_009125419.1| PREDICTED: symplekin isoform X1 [Brassica rapa]
Length=1517

 Score =   105 bits (262),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 75/162 (46%), Positives = 103/162 (64%), Gaps = 7/162 (4%)
 Frame = +3

Query  234  MVG-MMAAVS------REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflp  392
            MVG +MAA S      REK+  L  S+K A  +P K+  LR L+  +    S+   E LP
Sbjct  1    MVGAIMAASSYSYSYSREKLQGLARSAKSATDLPPKLHRLRNLRRNLQGEASVFPAELLP  60

Query  393  lllDFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIE  572
            LL D +SD+F   RKF  ++L  +G+ ++E LP I+PL I +L+DDTPAV RQ I     
Sbjct  61   LLFDLLSDQFGAARKFVAQILGEVGLNYVELLPEIVPLFIKSLQDDTPAVVRQVIASASA  120

Query  573  IFRSMLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +FRS L K A+QGL+SSELD+ L++SW W+ K   EIC++AF
Sbjct  121  LFRSTLHKFALQGLHSSELDELLQSSWTWMLKLKDEICSLAF  162



>ref|XP_010676743.1| PREDICTED: uncharacterized protein LOC104892490 isoform X5 [Beta 
vulgaris subsp. vulgaris]
Length=1144

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEV-----SDADSIllteflplllDFV  410
            MAA+  E++  L++S   A   PSK+  L +LK E+     ++  ++  +EF+P LL   
Sbjct  1    MAAICEERINSLIDSVTFAIDTPSKLESLHQLKQELLRVAAAEDTTVYFSEFIPSLLILF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD FSPVRK   E++  IG+RH+E LP   P L+T + DDT AVARQ+IT G  IF   L
Sbjct  61   SDCFSPVRKCVTEVIGEIGLRHLEVLPETTPALLTVIDDDTSAVARQAITSGTNIFCRTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             ++AI+GL++S+LD SLE++W W+ K   +I ++AF
Sbjct  121  ERIAIEGLHASKLDSSLESAWEWMVKLKEKIYSIAF  156



>ref|XP_010676744.1| PREDICTED: uncharacterized protein LOC104892490 isoform X6 [Beta 
vulgaris subsp. vulgaris]
Length=1135

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEV-----SDADSIllteflplllDFV  410
            MAA+  E++  L++S   A   PSK+  L +LK E+     ++  ++  +EF+P LL   
Sbjct  1    MAAICEERINSLIDSVTFAIDTPSKLESLHQLKQELLRVAAAEDTTVYFSEFIPSLLILF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD FSPVRK   E++  IG+RH+E LP   P L+T + DDT AVARQ+IT G  IF   L
Sbjct  61   SDCFSPVRKCVTEVIGEIGLRHLEVLPETTPALLTVIDDDTSAVARQAITSGTNIFCRTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             ++AI+GL++S+LD SLE++W W+ K   +I ++AF
Sbjct  121  ERIAIEGLHASKLDSSLESAWEWMVKLKEKIYSIAF  156



>ref|XP_010676741.1| PREDICTED: uncharacterized protein LOC104892490 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=1336

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEV-----SDADSIllteflplllDFV  410
            MAA+  E++  L++S   A   PSK+  L +LK E+     ++  ++  +EF+P LL   
Sbjct  1    MAAICEERINSLIDSVTFAIDTPSKLESLHQLKQELLRVAAAEDTTVYFSEFIPSLLILF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD FSPVRK   E++  IG+RH+E LP   P L+T + DDT AVARQ+IT G  IF   L
Sbjct  61   SDCFSPVRKCVTEVIGEIGLRHLEVLPETTPALLTVIDDDTSAVARQAITSGTNIFCRTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             ++AI+GL++S+LD SLE++W W+ K   +I ++AF
Sbjct  121  ERIAIEGLHASKLDSSLESAWEWMVKLKEKIYSIAF  156



>ref|XP_010676740.1| PREDICTED: uncharacterized protein LOC104892490 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1338

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEV-----SDADSIllteflplllDFV  410
            MAA+  E++  L++S   A   PSK+  L +LK E+     ++  ++  +EF+P LL   
Sbjct  1    MAAICEERINSLIDSVTFAIDTPSKLESLHQLKQELLRVAAAEDTTVYFSEFIPSLLILF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD FSPVRK   E++  IG+RH+E LP   P L+T + DDT AVARQ+IT G  IF   L
Sbjct  61   SDCFSPVRKCVTEVIGEIGLRHLEVLPETTPALLTVIDDDTSAVARQAITSGTNIFCRTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             ++AI+GL++S+LD SLE++W W+ K   +I ++AF
Sbjct  121  ERIAIEGLHASKLDSSLESAWEWMVKLKEKIYSIAF  156



>ref|XP_010676739.1| PREDICTED: uncharacterized protein LOC104892490 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1342

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEV-----SDADSIllteflplllDFV  410
            MAA+  E++  L++S   A   PSK+  L +LK E+     ++  ++  +EF+P LL   
Sbjct  1    MAAICEERINSLIDSVTFAIDTPSKLESLHQLKQELLRVAAAEDTTVYFSEFIPSLLILF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD FSPVRK   E++  IG+RH+E LP   P L+T + DDT AVARQ+IT G  IF   L
Sbjct  61   SDCFSPVRKCVTEVIGEIGLRHLEVLPETTPALLTVIDDDTSAVARQAITSGTNIFCRTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             ++AI+GL++S+LD SLE++W W+ K   +I ++AF
Sbjct  121  ERIAIEGLHASKLDSSLESAWEWMVKLKEKIYSIAF  156



>ref|XP_010676742.1| PREDICTED: uncharacterized protein LOC104892490 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=1326

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEV-----SDADSIllteflplllDFV  410
            MAA+  E++  L++S   A   PSK+  L +LK E+     ++  ++  +EF+P LL   
Sbjct  1    MAAICEERINSLIDSVTFAIDTPSKLESLHQLKQELLRVAAAEDTTVYFSEFIPSLLILF  60

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            SD FSPVRK   E++  IG+RH+E LP   P L+T + DDT AVARQ+IT G  IF   L
Sbjct  61   SDCFSPVRKCVTEVIGEIGLRHLEVLPETTPALLTVIDDDTSAVARQAITSGTNIFCRTL  120

Query  591  FKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             ++AI+GL++S+LD SLE++W W+ K   +I ++AF
Sbjct  121  ERIAIEGLHASKLDSSLESAWEWMVKLKEKIYSIAF  156



>emb|CDY04840.1| BnaAnng00220D [Brassica napus]
Length=1455

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 74/162 (46%), Positives = 103/162 (64%), Gaps = 7/162 (4%)
 Frame = +3

Query  234  MVG-MMAAVS------REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflp  392
            MVG +MAA S      REK+  L  S+K A  +P K+  LR L+  +    S+   E LP
Sbjct  1    MVGAIMAASSYSYSYSREKLQGLARSAKSATDLPPKLHRLRNLRRNLQGEASVFPAELLP  60

Query  393  lllDFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIE  572
            LL D +SD+F   RKF +++L  +G+ ++E LP I+PL I +L+DDTPAV RQ I     
Sbjct  61   LLFDLLSDQFGAARKFVVQILGEVGLNYVELLPEIVPLFIKSLQDDTPAVVRQVIASASA  120

Query  573  IFRSMLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +F S L K A+QGL+SSELD+ L++SW W+ K   EIC++AF
Sbjct  121  LFPSTLHKFALQGLHSSELDELLQSSWTWMLKLKDEICSLAF  162



>gb|EPS64126.1| hypothetical protein M569_10655, partial [Genlisea aurea]
Length=1004

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +3

Query  300  AAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSPVRKFTIEMLSPIGIRHI  479
            A+ V +K+ +LR+++ E+ D+DS  + EFL  LLD +SD  SPVRK   E++  IG++H+
Sbjct  2    ASDVAAKLDHLRKIRRELLDSDSESVVEFLSRLLDLLSDGSSPVRKNVTELIGEIGLKHL  61

Query  480  EFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQGLYSSELDDSLETSWAW  659
            E LP I+P L+  L DDT +V RQ+I C I+IFR  L KVAIQGLYS+E+++SL  SW  
Sbjct  62   ELLPEIVPALMGVLNDDTLSVCRQAILCSIDIFRCCLVKVAIQGLYSTEINESLRLSWEC  121

Query  660  VQKFMYEICTVAF  698
            + K   E+C++AF
Sbjct  122  MLKLKDELCSIAF  134



>ref|XP_006843566.2| PREDICTED: symplekin [Amborella trichopoda]
Length=1323

 Score =   100 bits (248),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 71/152 (47%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA+  R+K   L NS+K +  +PSK+  LR+L++ V   D  LL EF+P L++  S+ FS
Sbjct  1    MASCPRDKALSLFNSAKFSIEIPSKLEPLRQLQEIVVYRDPTLLVEFVPHLMELQSEHFS  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
            P+RKF  EM+  IG++H +FLP ++P+LI+ LKDDTPAVA+Q+IT G  +FRS L  VA+
Sbjct  61   PIRKFLAEMIGEIGLKHRQFLPEMVPVLISFLKDDTPAVAKQAITTGTNLFRSTLEDVAL  120

Query  606  QGLYSSELDDSL-ETSWAWVQKFMYEICTVAF  698
            Q      L DSL E+SW  +  F   +  VAF
Sbjct  121  QA-----LPDSLRESSWTCMLNFKEAVYPVAF  147



>gb|KDP24446.1| hypothetical protein JCGZ_25010 [Jatropha curcas]
Length=1324

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 100/158 (63%), Gaps = 8/158 (5%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKM---GYLRRLKDEVSDADSIllteflplllD  404
            MVGM+ + SRE++A L+   K A  +P K+     L     E  D  S+         L 
Sbjct  1    MVGMVNSSSRERLASLV---KAAIDIPLKLETLRLLNENLLEEKDVGSLSEFLPRLFELQ  57

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            +  D+ SPVRK   +++  IG++H+EF+P I P+L++ L D  PAVARQ++TCGI +FRS
Sbjct  58   Y--DQHSPVRKSVAQIIGEIGLKHLEFVPEIAPVLMSVLDDRAPAVARQAVTCGINLFRS  115

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
               K+AIQGLY+SE+DD L++SW+ + +F  ++ ++AF
Sbjct  116  TFQKLAIQGLYASEVDDLLKSSWSSMLEFKEKLYSIAF  153



>ref|XP_012087849.1| PREDICTED: uncharacterized protein LOC105646588 isoform X2 [Jatropha 
curcas]
Length=1330

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 100/158 (63%), Gaps = 8/158 (5%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKM---GYLRRLKDEVSDADSIllteflplllD  404
            MVGM+ + SRE++A L+   K A  +P K+     L     E  D  S+         L 
Sbjct  1    MVGMVNSSSRERLASLV---KAAIDIPLKLETLRLLNENLLEEKDVGSLSEFLPRLFELQ  57

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            +  D+ SPVRK   +++  IG++H+EF+P I P+L++ L D  PAVARQ++TCGI +FRS
Sbjct  58   Y--DQHSPVRKSVAQIIGEIGLKHLEFVPEIAPVLMSVLDDRAPAVARQAVTCGINLFRS  115

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
               K+AIQGLY+SE+DD L++SW+ + +F  ++ ++AF
Sbjct  116  TFQKLAIQGLYASEVDDLLKSSWSSMLEFKEKLYSIAF  153



>ref|XP_012087848.1| PREDICTED: uncharacterized protein LOC105646588 isoform X1 [Jatropha 
curcas]
Length=1333

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 100/158 (63%), Gaps = 8/158 (5%)
 Frame = +3

Query  234  MVGMMAAVSREKVADLLNSSKLAAAVPSKM---GYLRRLKDEVSDADSIllteflplllD  404
            MVGM+ + SRE++A L+   K A  +P K+     L     E  D  S+         L 
Sbjct  1    MVGMVNSSSRERLASLV---KAAIDIPLKLETLRLLNENLLEEKDVGSLSEFLPRLFELQ  57

Query  405  FVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRS  584
            +  D+ SPVRK   +++  IG++H+EF+P I P+L++ L D  PAVARQ++TCGI +FRS
Sbjct  58   Y--DQHSPVRKSVAQIIGEIGLKHLEFVPEIAPVLMSVLDDRAPAVARQAVTCGINLFRS  115

Query  585  MLFKVAIQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
               K+AIQGLY+SE+DD L++SW+ + +F  ++ ++AF
Sbjct  116  TFQKLAIQGLYASEVDDLLKSSWSSMLEFKEKLYSIAF  153



>tpg|DAA64259.1| TPA: hypothetical protein ZEAMMB73_525160 [Zea mays]
Length=1116

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = +3

Query  402  DFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFR  581
            D  +D  SPVRK   E++  +G +H+ +LP +IP L+  L D+TPAV RQ++  G  +F 
Sbjct  38   DLHTDEASPVRKLVAEIIGELGSKHMRYLPDMIPCLLHLLNDETPAVVRQAVKTGTNLFA  97

Query  582  SMLFKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             +L K+AIQGL+S+  +DD+L++SW W+ KF   +  +AF
Sbjct  98   KVLQKLAIQGLFSNGGIDDALKSSWEWLLKFKSGVSHMAF  137



>ref|XP_008653537.1| PREDICTED: symplekin isoform X1 [Zea mays]
 ref|XP_008653538.1| PREDICTED: symplekin isoform X1 [Zea mays]
 ref|XP_008653539.1| PREDICTED: symplekin isoform X1 [Zea mays]
Length=1242

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = +3

Query  402  DFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFR  581
            D  +D  SPVRK   E++  +G +H+ +LP +IP L+  L D+TPAV RQ++  G  +F 
Sbjct  38   DLHTDEASPVRKLVAEIIGELGSKHMRYLPDMIPCLLHLLNDETPAVVRQAVKTGTNLFA  97

Query  582  SMLFKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             +L K+AIQGL+S+  +DD+L++SW W+ KF   +  +AF
Sbjct  98   KVLQKLAIQGLFSNGGIDDALKSSWEWLLKFKSGVSHMAF  137



>ref|XP_009377759.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103966329 
[Pyrus x bretschneideri]
Length=1218

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  450  MLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQGLYSSEL  629
            ML  IG+ H+E LP I+  LI  L D T AVARQ+IT GI +F  +L KV+IQ L++SEL
Sbjct  1    MLGEIGLMHVELLPEIVRSLINVLSDGTLAVARQAITTGIHLFHCVLEKVSIQVLHTSEL  60

Query  630  DDSLETSWAWVQKFMYEICTVAF  698
            D  LE +WAWV K   EI ++AF
Sbjct  61   DSLLELAWAWVLKLKDEIYSIAF  83



>ref|XP_010233552.1| PREDICTED: uncharacterized protein LOC100836703 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010233556.1| PREDICTED: uncharacterized protein LOC100836703 isoform X2 [Brachypodium 
distachyon]
Length=1022

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +3

Query  402  DFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFR  581
            D  SD  SPVRK   EM+  +G + + ++P ++P L+  L D+TPAVARQ++  G  +F 
Sbjct  47   DLRSDEASPVRKVVAEMIGEVGSKKMVYIPDMMPYLLDLLDDETPAVARQAVKTGTNLFA  106

Query  582  SMLFKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             +L ++ IQGL+SS  +DDSL+ SW W+ K    +  +AF
Sbjct  107  KVLQQLVIQGLFSSGGIDDSLKLSWEWMLKLKSAVSLLAF  146



>ref|XP_003559743.1| PREDICTED: symplekin isoform X1 [Brachypodium distachyon]
Length=1254

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +3

Query  402  DFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFR  581
            D  SD  SPVRK   EM+  +G + + ++P ++P L+  L D+TPAVARQ++  G  +F 
Sbjct  47   DLRSDEASPVRKVVAEMIGEVGSKKMVYIPDMMPYLLDLLDDETPAVARQAVKTGTNLFA  106

Query  582  SMLFKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             +L ++ IQGL+SS  +DDSL+ SW W+ K    +  +AF
Sbjct  107  KVLQQLVIQGLFSSGGIDDSLKLSWEWMLKLKSAVSLLAF  146



>gb|EMT14451.1| Symplekin [Aegilops tauschii]
Length=1205

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +3

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            +D  SPVRK  +EM+  IG +H  ++P ++P L+  L D+TPAVARQ++  G ++F  +L
Sbjct  28   ADEASPVRKVVVEMIGEIGSKHTVYIPDMMPCLLDLLNDETPAVARQAVKTGTDLFAKVL  87

Query  591  FKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             ++ IQGL+SS  +D+SL++SW W+ K    +  +AF
Sbjct  88   QELVIQGLFSSGGIDESLKSSWEWMLKLKSAVSLMAF  124



>dbj|BAJ93522.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1259

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +3

Query  411  SDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSML  590
            +D   PVRK   EM+  IG +H  F+P ++P L+  L D+TPAVARQ++  G ++F  +L
Sbjct  51   ADEAGPVRKLVAEMIGEIGSKHTVFIPDMMPSLLDLLNDETPAVARQAVKTGTDLFAKVL  110

Query  591  FKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             ++ +QGL+SS  ++DSL++SW W+ K    +  +AF
Sbjct  111  QELVVQGLFSSGGIEDSLKSSWEWMLKLKSAVSLMAF  147



>gb|EEC82740.1| hypothetical protein OsI_27446 [Oryza sativa Indica Group]
Length=1245

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 82/139 (59%), Gaps = 11/139 (8%)
 Frame = +3

Query  285  NSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSPVRKFTIEMLSPI  464
            N S L +++  ++  LRR          + L +F+  + D  +D+ SPVRK   EM+  +
Sbjct  16   NPSPLPSSMEPRLRQLRR----------VPLLDFVARIADLHADQASPVRKLVAEMIGEV  65

Query  465  GIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQGLYSS-ELDDSL  641
            G +H+ +LP ++P L+  L DDTPAVARQ+I  G  +F  +L ++ IQGL+SS  +DDSL
Sbjct  66   GSKHMAYLPNVMPCLLHLLNDDTPAVARQAIKTGTTLFAKVLRQLVIQGLFSSGGIDDSL  125

Query  642  ETSWAWVQKFMYEICTVAF  698
            + SW  + K    +  +AF
Sbjct  126  KLSWEALLKLKSAVSHMAF  144



>ref|NP_001060734.1| Os07g0693900 [Oryza sativa Japonica Group]
 dbj|BAD31201.1| putative symplekin [Oryza sativa Japonica Group]
 dbj|BAF22648.1| Os07g0693900 [Oryza sativa Japonica Group]
 gb|EEE67876.1| hypothetical protein OsJ_25697 [Oryza sativa Japonica Group]
Length=1245

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 82/139 (59%), Gaps = 11/139 (8%)
 Frame = +3

Query  285  NSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSPVRKFTIEMLSPI  464
            N S L +++  ++  LRR          + L +F+  + D  +D+ SPVRK   EM+  +
Sbjct  16   NPSPLPSSMEPRLRQLRR----------VPLLDFVARIADLHADQASPVRKLVAEMIGEV  65

Query  465  GIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQGLYSS-ELDDSL  641
            G +H+ +LP ++P L+  L DDTPAVARQ+I  G  +F  +L ++ IQGL+SS  +DDSL
Sbjct  66   GSKHMAYLPNVMPCLLHLLNDDTPAVARQAIKTGTTLFAKVLRQLVIQGLFSSGGIDDSL  125

Query  642  ETSWAWVQKFMYEICTVAF  698
            + SW  + K    +  +AF
Sbjct  126  KLSWEALLKLKSAVSHMAF  144



>ref|XP_002461279.1| hypothetical protein SORBIDRAFT_02g044000 [Sorghum bicolor]
 gb|EER97800.1| hypothetical protein SORBIDRAFT_02g044000 [Sorghum bicolor]
Length=1170

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = +3

Query  402  DFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFR  581
            D  +D  SPVRK   E++  +G +H+ +LP +IP L+  L D+TPAV RQ++  G  +F 
Sbjct  38   DLHTDEASPVRKLVAEIIGELGSKHMAYLPDMIPCLLHLLNDETPAVVRQAVKTGTNLFS  97

Query  582  SMLFKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             +L K+ IQGL+S+  +DD+L+ SW W+ KF   +  +AF
Sbjct  98   KVLQKLVIQGLFSTGGIDDALKLSWEWLLKFKSVVSHMAF  137



>ref|XP_006658175.1| PREDICTED: symplekin-like [Oryza brachyantha]
Length=1243

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +3

Query  402  DFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFR  581
            D  +D  SPVRK   EM+  +G R + +LP ++P L+  L D+TPAVARQ+I  G  +F 
Sbjct  43   DLHADEASPVRKLVAEMIGEVGSRRMAYLPNVMPCLLDLLNDETPAVARQAIKTGTSLFA  102

Query  582  SMLFKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             +L ++ IQGL+SS  +DDSL+  W  + K    +  +AF
Sbjct  103  KVLQQLVIQGLFSSGGIDDSLKLCWDALLKLKSAVSHMAF  142



>ref|XP_004958811.1| PREDICTED: symplekin-like [Setaria italica]
Length=1249

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +3

Query  402  DFVSDRFSPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFR  581
            D  +D  SPVRK   E++  +G +H+ +LP IIP L+  L D+ PAV RQ+I  G  +F 
Sbjct  48   DLHTDEASPVRKHVAEIIGEVGSKHMAYLPDIIPCLLHLLNDEVPAVVRQAIKTGTVLFA  107

Query  582  SMLFKVAIQGLYSS-ELDDSLETSWAWVQKFMYEICTVAF  698
             +L  + IQGL+S+  +DD+L+ SW  + KF   +  +AF
Sbjct  108  QLLQHLVIQGLFSTGGIDDALKLSWERLLKFKSTVSLMAF  147



>gb|KDO81324.1| hypothetical protein CISIN_1g025778mg [Citrus sinensis]
Length=201

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAAVSR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>gb|KDO81323.1| hypothetical protein CISIN_1g025778mg [Citrus sinensis]
Length=241

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAAVSR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>gb|KDO81322.1| hypothetical protein CISIN_1g025778mg [Citrus sinensis]
Length=240

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAAVSR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>gb|KDO81320.1| hypothetical protein CISIN_1g025778mg [Citrus sinensis]
Length=242

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAAVSR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>gb|KDO81321.1| hypothetical protein CISIN_1g025778mg [Citrus sinensis]
Length=248

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAAVSR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>ref|XP_011626437.1| PREDICTED: uncharacterized protein LOC18442422 [Amborella trichopoda]
Length=1318

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 45/152 (30%), Positives = 80/152 (53%), Gaps = 0/152 (0%)
 Frame = +3

Query  243  MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRF  422
            M A   R +   LL ++K    +  K+  LR+ +D +  +D  +  E +P + D      
Sbjct  1    MAATNPRSQAISLLVAAKNHNDLAVKLSSLRQARDILISSDPTVAAELIPYVADLQDSPD  60

Query  423  SPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVA  602
            S VRK   E++  +G+   E +  ++P+L+  LKD++P V +Q+I  G ++FR+ L  +A
Sbjct  61   SLVRKTLAELIGDLGLMVGERICMLVPVLVAFLKDNSPDVVKQTIVSGSKLFRNSLEDIA  120

Query  603  IQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +Q L   +++  LE  W W+ KF   +C  A 
Sbjct  121  LQFLKFGKVERWLEELWLWMMKFKDAVCDTAL  152



>gb|ERN14175.1| hypothetical protein AMTR_s00033p00031310 [Amborella trichopoda]
Length=1417

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 45/152 (30%), Positives = 80/152 (53%), Gaps = 0/152 (0%)
 Frame = +3

Query  243  MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRF  422
            M A   R +   LL ++K    +  K+  LR+ +D +  +D  +  E +P + D      
Sbjct  1    MAATNPRSQAISLLVAAKNHNDLAVKLSSLRQARDILISSDPTVAAELIPYVADLQDSPD  60

Query  423  SPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVA  602
            S VRK   E++  +G+   E +  ++P+L+  LKD++P V +Q+I  G ++FR+ L  +A
Sbjct  61   SLVRKTLAELIGDLGLMVGERICMLVPVLVAFLKDNSPDVVKQTIVSGSKLFRNSLEDIA  120

Query  603  IQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +Q L   +++  LE  W W+ KF   +C  A 
Sbjct  121  LQFLKFGKVERWLEELWLWMMKFKDAVCDTAL  152



>ref|XP_002974966.1| hypothetical protein SELMODRAFT_442688 [Selaginella moellendorffii]
 gb|EFJ23751.1| hypothetical protein SELMODRAFT_442688 [Selaginella moellendorffii]
Length=1167

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 50/151 (33%), Positives = 89/151 (59%), Gaps = 14/151 (9%)
 Frame = +3

Query  258  SREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSPVRK  437
            +RE+   LL+ ++L     +K+  LR L++     +  LL E LP+LL+  +DR S +R 
Sbjct  7    ARERAVALLHDAQLHPDAAAKLDSLRELRELALHREPRLLPELLPVLLELRNDRASAIRN  66

Query  438  FTIE--------MLSP-----IGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIF  578
            F +E         L+P     +G+R +E++P ++P+L+T L+ + PA AR++IT G  +F
Sbjct  67   FLVERGSQCRVIFLAPRIIEEVGLRQVEYVPVMMPVLLTLLRGE-PAFARRAITAGTNLF  125

Query  579  RSMLFKVAIQGLYSSELDDSLETSWAWVQKF  671
            R  L  V ++G+Y+ ++D  ++ SW  V +F
Sbjct  126  RHTLEYVLLKGIYTRQVDKFMQDSWISVLQF  156



>ref|XP_010520816.1| PREDICTED: uncharacterized protein LOC104799842 isoform X2 [Tarenaya 
hassleriana]
Length=1302

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 79/152 (52%), Gaps = 0/152 (0%)
 Frame = +3

Query  243  MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRF  422
            M A+ SR+    LL ++     +  K+  +R++K+ +   D  L  E  P L +  S R 
Sbjct  1    MAASASRDHALSLLAATNNHGDLAVKLSSIRQVKEILLSVDPSLAAELFPYLAELQSSRE  60

Query  423  SPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVA  602
              VRK  +E++  +G+R +E    ++P+L+  L+D+ P VA+QSI+ G   F S L + +
Sbjct  61   PLVRKSLVEIIEEVGLRMMEHSHVLVPVLLALLRDNDPVVAKQSISSGSNFFCSFLEETS  120

Query  603  IQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +Q L+   ++      W W+ KF   +   AF
Sbjct  121  LQFLHRGNVERWAGELWTWLIKFKNAVFATAF  152



>ref|XP_010520815.1| PREDICTED: uncharacterized protein LOC104799842 isoform X1 [Tarenaya 
hassleriana]
Length=1335

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 79/152 (52%), Gaps = 0/152 (0%)
 Frame = +3

Query  243  MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRF  422
            M A+ SR+    LL ++     +  K+  +R++K+ +   D  L  E  P L +  S R 
Sbjct  1    MAASASRDHALSLLAATNNHGDLAVKLSSIRQVKEILLSVDPSLAAELFPYLAELQSSRE  60

Query  423  SPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVA  602
              VRK  +E++  +G+R +E    ++P+L+  L+D+ P VA+QSI+ G   F S L + +
Sbjct  61   PLVRKSLVEIIEEVGLRMMEHSHVLVPVLLALLRDNDPVVAKQSISSGSNFFCSFLEETS  120

Query  603  IQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            +Q L+   ++      W W+ KF   +   AF
Sbjct  121  LQFLHRGNVERWAGELWTWLIKFKNAVFATAF  152



>ref|XP_006433722.1| hypothetical protein CICLE_v10002279mg [Citrus clementina]
 gb|ESR46962.1| hypothetical protein CICLE_v10002279mg [Citrus clementina]
Length=201

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 80/151 (53%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAA SR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAASRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILVPVLLAFLRDGDSRVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>ref|XP_010556503.1| PREDICTED: uncharacterized protein LOC104825810 [Tarenaya hassleriana]
Length=291

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 78/143 (55%), Gaps = 0/143 (0%)
 Frame = +3

Query  243  MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRF  422
            M A+  R++   LL ++     +  K+  LR++K+ +   D  L  E  P L +  S R 
Sbjct  1    MAASALRDQALSLLAAANNHGDLAVKLSSLRQVKEILLLVDPSLSAELFPYLAELQSSRE  60

Query  423  SPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVA  602
              VRK  IE++  +G+R +E    ++ +L+  L+D+ P VA+QSI+ G + F S++ ++A
Sbjct  61   PLVRKSLIEIIEKVGLRMMEHSYVLVGVLLALLRDNDPVVAKQSISSGTKFFCSVVEEMA  120

Query  603  IQGLYSSELDDSLETSWAWVQKF  671
            +Q ++   ++      W W+ KF
Sbjct  121  LQFIHRGNVERWARELWTWLVKF  143



>ref|XP_006433724.1| hypothetical protein CICLE_v10002279mg [Citrus clementina]
 gb|ESR46964.1| hypothetical protein CICLE_v10002279mg [Citrus clementina]
Length=241

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 80/151 (53%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAA SR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAASRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILVPVLLAFLRDGDSRVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>ref|XP_006433723.1| hypothetical protein CICLE_v10002279mg [Citrus clementina]
 gb|ESR46963.1| hypothetical protein CICLE_v10002279mg [Citrus clementina]
Length=248

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 80/151 (53%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAA SR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAASRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILVPVLLAFLRDGDSRVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>ref|XP_006472379.1| PREDICTED: symplekin-like isoform X1 [Citrus sinensis]
Length=1337

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 81/151 (54%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAAVSR++   LL ++     +  K+  L++++  +S AD  L  E  P L++  S   S
Sbjct  1    MAAVSRDQALSLLAAANNHGDLAVKLSSLKQVRGILSSADPSLAAELFPYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  IE +  IG++ +E    ++P+L+  L+D    VA +SI CG   F  +L ++ +
Sbjct  61   LVRKSLIETIEDIGLKAMEHSSILMPVLLAFLRDGDSGVAGKSIVCGTNFFCRVLEEITM  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q  +  +++  LE  W W+ +F   +  +A 
Sbjct  121  QFRWHGKVERWLEELWTWMVRFKDAVFAIAL  151



>ref|XP_006364969.1| PREDICTED: symplekin-like [Solanum tuberosum]
Length=1332

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA   RE+   LL S+     +  K+  L++LKD +  A+   + E L  L+D  S   S
Sbjct  1    MAGPIREQALPLLASANNHGDLAVKLSSLKQLKDVLLSAEPSQVAELLSYLIDLQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             +RK  IE++  +G++  E L  ++P+L   LKD    VA+QSI  G++IF  +L +++ 
Sbjct  61   LLRKCLIEVIEEVGMKAKEHLLVVMPVLFACLKDMNSMVAKQSIISGMKIFCGVLEELSS  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q      ++  LE  W W+ KF   +  V F
Sbjct  121  QFHRHGLVERWLEELWTWMVKFKDAVFGVMF  151



>ref|XP_002510000.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52187.1| conserved hypothetical protein [Ricinus communis]
Length=1390

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 79/149 (53%), Gaps = 6/149 (4%)
 Frame = +3

Query  258  SREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSP---  428
            SR++   LL ++   + +  K+  L++ KD +    S+  +    L    +  +FSP   
Sbjct  3    SRDQALSLLTAANNHSDLAVKLSSLKQAKDIIL---SVEPSFAAELFPYLLQLQFSPESL  59

Query  429  VRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQ  608
            VRK  +E++  + ++  E    ++P+L+  LKD+ P +ARQSI CG  +F ++L ++A Q
Sbjct  60   VRKMLLEIIEEMSLKATEHCSLLVPVLLEFLKDNVPVIARQSIVCGTHLFSAILEEMAFQ  119

Query  609  GLYSSELDDSLETSWAWVQKFMYEICTVA  695
                 +++  LE  W W+ KF   +  +A
Sbjct  120  FQRCGKVERWLEELWIWMLKFKDAVFAIA  148



>ref|XP_010320519.1| PREDICTED: uncharacterized protein LOC101249356 [Solanum lycopersicum]
Length=1325

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 47/151 (31%), Positives = 79/151 (52%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA   RE+   LL S+     +  K+  L++LKD +  A+   + E L  L+D  S   S
Sbjct  1    MAGPIREQALPLLASANNHGDLSVKLSSLKQLKDVLLSAEPSQVAELLSYLIDLQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             +RK  IE++  +G++  E L  ++P+L   LKD    VA+QS+  G++IF  +L +++ 
Sbjct  61   LLRKGLIEVIEAVGMKAKEHLLVLMPVLFACLKDMNSMVAKQSVISGMKIFCGVLEELSS  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q      ++  LE  W W+ KF   +  + F
Sbjct  121  QFHRHGIVERWLEELWTWMVKFKDTVVGIIF  151



>gb|EYU36425.1| hypothetical protein MIMGU_mgv1a019483mg [Erythranthe guttata]
Length=245

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 73/151 (48%), Gaps = 16/151 (11%)
 Frame = +3

Query  243  MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKD-----EVSDADSIllteflplllDF  407
            M    +RE+   LL ++     +  K+  L++ KD     E S A  I            
Sbjct  1    MAGPPAREQALSLLAAANNHGDLAVKLSSLKQAKDILLSVEPSQAAEIFPY--------L  52

Query  408  VSDRFSP---VRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIF  578
            V  ++SP   VRK+ +E++  IG +  E L  ++P L+T LKD+ P VA+QSI  G   F
Sbjct  53   VELQYSPETLVRKYLLEIIDEIGAKTTEHLSILLPALLTFLKDNNPTVAKQSIVTGTNFF  112

Query  579  RSMLFKVAIQGLYSSELDDSLETSWAWVQKF  671
              +L ++A Q      ++  LE  W W+ KF
Sbjct  113  CVVLEELAFQFQRRGIVERWLEELWTWILKF  143



>ref|XP_012068105.1| PREDICTED: uncharacterized protein LOC105630767 isoform X3 [Jatropha 
curcas]
Length=255

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 72/145 (50%), Gaps = 0/145 (0%)
 Frame = +3

Query  261  REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSPVRKF  440
            R++   LL ++     +  K+  LR+ KD +   +     E  P L +      S VRK 
Sbjct  4    RDQALSLLTAANNHGDLAVKLSSLRQAKDILLSVEPSSAAELFPYLTELQFSHESLVRKM  63

Query  441  TIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQGLYS  620
             +E++  IG++ +E     +P+L+  LKD  P +A+QSI  G   F  +L ++A+Q    
Sbjct  64   LVEIIEEIGLKGMEHCSIFMPVLVAFLKDTDPDIAKQSIVSGTHFFCGVLEEMALQYHRR  123

Query  621  SELDDSLETSWAWVQKFMYEICTVA  695
             ++D  LE  W W+ KF   +  VA
Sbjct  124  GKVDRWLEELWLWMLKFKDAVFAVA  148



>emb|CAN82893.1| hypothetical protein VITISV_043096 [Vitis vinifera]
Length=561

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 72/126 (57%), Gaps = 19/126 (15%)
 Frame = +3

Query  90   FHPPKRPSFQSGDGSLQ------LSLYHSIFRARILHETLVTEAR-RTRVS--LRGAMVG  242
            F PP    ++  D S++       S  HSI    +L E+  T A  R +++     AMVG
Sbjct  431  FLPPLSREYEVEDLSIEGEEESTSSTNHSI---DLLDESAATMATCRDQIAKGFSSAMVG  487

Query  243  MMAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRF  422
            MM        A L+NS+KLA  VPSK+ +LR+LK+++     +LL++FLP +LD  +DR 
Sbjct  488  MM-------TASLINSAKLALDVPSKLEHLRQLKEDLLHEGPVLLSQFLPRILDLHTDRL  540

Query  423  SPVRKF  440
            SPVRKF
Sbjct  541  SPVRKF  546



>ref|XP_012068103.1| PREDICTED: uncharacterized protein LOC105630767 isoform X2 [Jatropha 
curcas]
Length=273

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 72/145 (50%), Gaps = 0/145 (0%)
 Frame = +3

Query  261  REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSPVRKF  440
            R++   LL ++     +  K+  LR+ KD +   +     E  P L +      S VRK 
Sbjct  4    RDQALSLLTAANNHGDLAVKLSSLRQAKDILLSVEPSSAAELFPYLTELQFSHESLVRKM  63

Query  441  TIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQGLYS  620
             +E++  IG++ +E     +P+L+  LKD  P +A+QSI  G   F  +L ++A+Q    
Sbjct  64   LVEIIEEIGLKGMEHCSIFMPVLVAFLKDTDPDIAKQSIVSGTHFFCGVLEEMALQYHRR  123

Query  621  SELDDSLETSWAWVQKFMYEICTVA  695
             ++D  LE  W W+ KF   +  VA
Sbjct  124  GKVDRWLEELWLWMLKFKDAVFAVA  148



>ref|XP_011074296.1| PREDICTED: uncharacterized protein LOC105159059 isoform X2 [Sesamum 
indicum]
Length=262

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 79/152 (52%), Gaps = 1/152 (1%)
 Frame = +3

Query  246  MAAVS-REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRF  422
            MA V  RE+   LL ++     +  K+  L++ KD +   +     E  P L++  S   
Sbjct  1    MAGVQPREQALPLLAAANNHGDLAVKLSSLKQAKDILLSVEPSQAAELFPYLVELQSSPE  60

Query  423  SPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVA  602
            + VRK+ +E++  IG R  E L  ++P+L+T LKD+ P +A+QSI  G + F  +L ++A
Sbjct  61   TLVRKYLLEVIDEIGARTREHLSILLPVLLTFLKDNNPVIAKQSIVTGTKFFCIVLEELA  120

Query  603  IQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             Q      ++  LE  W W+ KF   +  + F
Sbjct  121  FQFQRRGIVERWLEELWTWMIKFRDAVLGIIF  152



>ref|XP_011074297.1| PREDICTED: uncharacterized protein LOC105159059 isoform X3 [Sesamum 
indicum]
Length=254

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 79/152 (52%), Gaps = 1/152 (1%)
 Frame = +3

Query  246  MAAVS-REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRF  422
            MA V  RE+   LL ++     +  K+  L++ KD +   +     E  P L++  S   
Sbjct  1    MAGVQPREQALPLLAAANNHGDLAVKLSSLKQAKDILLSVEPSQAAELFPYLVELQSSPE  60

Query  423  SPVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVA  602
            + VRK+ +E++  IG R  E L  ++P+L+T LKD+ P +A+QSI  G + F  +L ++A
Sbjct  61   TLVRKYLLEVIDEIGARTREHLSILLPVLLTFLKDNNPVIAKQSIVTGTKFFCIVLEELA  120

Query  603  IQGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
             Q      ++  LE  W W+ KF   +  + F
Sbjct  121  FQFQRRGIVERWLEELWTWMIKFRDAVLGIIF  152



>gb|KGN60293.1| hypothetical protein Csa_3G893430 [Cucumis sativus]
Length=243

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 77/151 (51%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA V RE+   LL ++     +  K+  L ++KD +   +     E    L++  S   S
Sbjct  1    MAGVLRERALSLLAAANNHGDLTVKISSLNQVKDIILAIEPSFAAELYSYLVELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             +RK  IE++  IG+R +E  P ++ +L+ +LKD    VA QSI  G ++F   L ++A+
Sbjct  61   SLRKLLIEVIEDIGLRAMEHSPLLMSVLLASLKDGESIVAGQSIISGQKLFCGTLREMAL  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q     +++  LE  W  + KF  E+  +A 
Sbjct  121  QLHRRGKVERWLEELWMRMLKFKDEVLAIAL  151



>ref|XP_010104549.1| hypothetical protein L484_025526 [Morus notabilis]
 gb|EXC01150.1| hypothetical protein L484_025526 [Morus notabilis]
Length=1212

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 80/151 (53%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MA   R++   LL ++     +  K+  L++ KD +   D     +  P L++  S   +
Sbjct  1    MAGAPRDQALSLLAAANNHGDLAVKLSSLKQAKDILFSLDPSSAVDLFPYLVELQSSPET  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  ++++  IG++ +E    ++P+L+T L+DD  AVA+QSI  G  IF  +L ++ +
Sbjct  61   LVRKLLLDLVEEIGLKAMEHSSVLMPVLLTLLRDDDSAVAKQSIVSGSIIFCCVLEEMTL  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q     +++  LE  W+W+ KF   +  +A 
Sbjct  121  QFHRHGKVERWLEELWSWMAKFKDAVFAIAL  151



>ref|XP_006581045.1| PREDICTED: uncharacterized protein LOC100810420 isoform X3 [Glycine 
max]
Length=241

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 78/151 (52%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAA +R++V  LL ++     +  K   L++ KD +   D  L  +  P LL+  S   S
Sbjct  1    MAAPTRDQVLSLLAAANNHGDLAVKTSSLKQAKDLLLSIDPSLAADLFPYLLELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  I+++  IG +  E  P +I +L+T L+D+   V +QSI  G  IF S+  ++ +
Sbjct  61   LVRKLLIQIIEEIGFKAAEQSPTLISVLLTFLRDNDEIVVKQSIVSGTNIFCSIFEELIV  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q     +++  LE  W W+ KF   +  +A 
Sbjct  121  QFQQYGKVERWLEDIWVWMLKFKDAVFGIAL  151



>ref|XP_006581044.1| PREDICTED: uncharacterized protein LOC100810420 isoform X2 [Glycine 
max]
Length=242

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 78/151 (52%), Gaps = 0/151 (0%)
 Frame = +3

Query  246  MAAVSREKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFS  425
            MAA +R++V  LL ++     +  K   L++ KD +   D  L  +  P LL+  S   S
Sbjct  1    MAAPTRDQVLSLLAAANNHGDLAVKTSSLKQAKDLLLSIDPSLAADLFPYLLELQSSPES  60

Query  426  PVRKFTIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAI  605
             VRK  I+++  IG +  E  P +I +L+T L+D+   V +QSI  G  IF S+  ++ +
Sbjct  61   LVRKLLIQIIEEIGFKAAEQSPTLISVLLTFLRDNDEIVVKQSIVSGTNIFCSIFEELIV  120

Query  606  QGLYSSELDDSLETSWAWVQKFMYEICTVAF  698
            Q     +++  LE  W W+ KF   +  +A 
Sbjct  121  QFQQYGKVERWLEDIWVWMLKFKDAVFGIAL  151



>ref|XP_012068102.1| PREDICTED: uncharacterized protein LOC105630767 isoform X1 [Jatropha 
curcas]
 gb|KDP41537.1| hypothetical protein JCGZ_15944 [Jatropha curcas]
Length=1333

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 72/145 (50%), Gaps = 0/145 (0%)
 Frame = +3

Query  261  REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSPVRKF  440
            R++   LL ++     +  K+  LR+ KD +   +     E  P L +      S VRK 
Sbjct  4    RDQALSLLTAANNHGDLAVKLSSLRQAKDILLSVEPSSAAELFPYLTELQFSHESLVRKM  63

Query  441  TIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQGLYS  620
             +E++  IG++ +E     +P+L+  LKD  P +A+QSI  G   F  +L ++A+Q    
Sbjct  64   LVEIIEEIGLKGMEHCSIFMPVLVAFLKDTDPDIAKQSIVSGTHFFCGVLEEMALQYHRR  123

Query  621  SELDDSLETSWAWVQKFMYEICTVA  695
             ++D  LE  W W+ KF   +  VA
Sbjct  124  GKVDRWLEELWLWMLKFKDAVFAVA  148



>gb|EPS73040.1| hypothetical protein M569_01716, partial [Genlisea aurea]
Length=1298

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 78/146 (53%), Gaps = 0/146 (0%)
 Frame = +3

Query  261  REKVADLLNSSKLAAAVPSKMGYLRRLKDEVSDADSIllteflplllDFVSDRFSPVRKF  440
            RE++  LL  +     +  K+  L++ KD +   +  L+++F P L D  S     VRK 
Sbjct  1    REQLLPLLAKANNHGDLGVKLSALKQAKDILLSVEPGLVSDFFPFLADLHSSPEPIVRKH  60

Query  441  TIEMLSPIGIRHIEFlpaiipllitalKDDTPAVARQSITCGIEIFRSMLFKVAIQGLYS  620
             +E++  IG R  E +  ++P+L T L+D  P +A+QSI  G +IF ++L ++ IQ    
Sbjct  61   LVEIIDDIGARTREHICTLLPVLFTLLRDHNPLIAKQSIMTGSKIFSAVLVELVIQFQRR  120

Query  621  SELDDSLETSWAWVQKFMYEICTVAF  698
              ++  LE  WAW+ KF   +  V F
Sbjct  121  GIVERWLEELWAWMLKFRNAVLDVFF  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1225614785648