BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5035

Length=712
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004145937.1|  PREDICTED: ATPase family AAA domain-containi...    426   4e-146   Cucumis sativus [cucumbers]
gb|KJB37401.1|  hypothetical protein B456_006G203100                    424   6e-146   Gossypium raimondii
ref|XP_010109212.1|  ATPase family AAA domain-containing protein 1-A    425   6e-146   Morus notabilis
gb|KJB37400.1|  hypothetical protein B456_006G203100                    425   1e-145   Gossypium raimondii
ref|XP_006491956.1|  PREDICTED: ATPase family AAA domain-containi...    423   3e-145   
ref|XP_006441188.1|  hypothetical protein CICLE_v10020488mg             424   3e-145   Citrus clementina [clementine]
ref|XP_004240969.1|  PREDICTED: ATPase family AAA domain-containi...    423   4e-145   Solanum lycopersicum
ref|XP_010322232.1|  PREDICTED: ATPase family AAA domain-containi...    423   4e-145   Solanum lycopersicum
ref|XP_006367358.1|  PREDICTED: ATPase family AAA domain-containi...    423   5e-145   Solanum tuberosum [potatoes]
ref|XP_006367356.1|  PREDICTED: ATPase family AAA domain-containi...    423   6e-145   Solanum tuberosum [potatoes]
gb|KHG23355.1|  ATPase family AAA domain-containing protein 1-A         422   8e-145   Gossypium arboreum [tree cotton]
ref|XP_007039157.1|  P-loop containing nucleoside triphosphate hy...    422   1e-144   
ref|XP_008456001.1|  PREDICTED: ATPase family AAA domain-containi...    422   1e-144   Cucumis melo [Oriental melon]
ref|XP_011651304.1|  PREDICTED: ATPase family AAA domain-containi...    421   2e-144   Cucumis sativus [cucumbers]
gb|KJB23967.1|  hypothetical protein B456_004G122900                    421   2e-144   Gossypium raimondii
ref|XP_009775966.1|  PREDICTED: ATPase family AAA domain-containi...    420   6e-144   Nicotiana sylvestris
ref|XP_010448091.1|  PREDICTED: ATPase family AAA domain-containi...    419   2e-143   Camelina sativa [gold-of-pleasure]
ref|XP_006282639.1|  hypothetical protein CARUB_v10004969mg             419   2e-143   Capsella rubella
ref|XP_010322233.1|  PREDICTED: ATPase family AAA domain-containi...    419   3e-143   Solanum lycopersicum
ref|XP_010322230.1|  PREDICTED: ATPase family AAA domain-containi...    419   3e-143   Solanum lycopersicum
ref|XP_009361314.1|  PREDICTED: ATPase family AAA domain-containi...    419   3e-143   Pyrus x bretschneideri [bai li]
ref|XP_009590015.1|  PREDICTED: ATPase family AAA domain-containi...    418   6e-143   Nicotiana tomentosiformis
emb|CDX92836.1|  BnaC07g40940D                                          418   6e-143   
emb|CDY29857.1|  BnaA03g48780D                                          417   6e-143   Brassica napus [oilseed rape]
emb|CDY71574.1|  BnaAnng37990D                                          416   2e-142   Brassica napus [oilseed rape]
ref|XP_010433328.1|  PREDICTED: ATPase family AAA domain-containi...    417   2e-142   Camelina sativa [gold-of-pleasure]
emb|CDY19035.1|  BnaC01g20330D                                          416   3e-142   Brassica napus [oilseed rape]
ref|NP_194498.1|  P-loop containing nucleoside triphosphate hydro...    416   4e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234684.1|  PREDICTED: ATPase family AAA domain-containi...    416   5e-142   Prunus mume [ume]
ref|XP_010438567.1|  PREDICTED: ATPase family AAA domain-containi...    416   5e-142   Camelina sativa [gold-of-pleasure]
ref|XP_009137686.1|  PREDICTED: ATPase family AAA domain-containi...    415   5e-142   Brassica rapa
ref|XP_007218110.1|  hypothetical protein PRUPE_ppa006767mg             416   6e-142   Prunus persica
gb|KFK29291.1|  hypothetical protein AALP_AA7G114300                    415   6e-142   Arabis alpina [alpine rockcress]
ref|XP_012081080.1|  PREDICTED: ATPase family AAA domain-containi...    415   6e-142   Jatropha curcas
ref|XP_008376772.1|  PREDICTED: ATPase family AAA domain-containi...    415   7e-142   Malus domestica [apple tree]
ref|XP_010520944.1|  PREDICTED: ATPase family AAA domain-containi...    415   8e-142   Tarenaya hassleriana [spider flower]
ref|XP_006413042.1|  hypothetical protein EUTSA_v10025375mg             415   1e-141   Eutrema salsugineum [saltwater cress]
ref|XP_009143884.1|  PREDICTED: ATPase family AAA domain-containi...    414   1e-141   Brassica rapa
ref|XP_010555747.1|  PREDICTED: ATPase family AAA domain-containi...    413   5e-141   Tarenaya hassleriana [spider flower]
gb|AFP55582.1|  AAA domain-containing protein                           413   5e-141   Rosa rugosa [Japanese rose]
gb|KCW89108.1|  hypothetical protein EUGRSUZ_A01431                     410   6e-141   Eucalyptus grandis [rose gum]
ref|XP_002869548.1|  hypothetical protein ARALYDRAFT_492017             412   1e-140   Arabidopsis lyrata subsp. lyrata
ref|XP_010662912.1|  PREDICTED: ATPase family AAA domain-containi...    411   2e-140   Vitis vinifera
ref|XP_010048785.1|  PREDICTED: ATPase family AAA domain-containi...    411   2e-140   Eucalyptus grandis [rose gum]
gb|KCW89106.1|  hypothetical protein EUGRSUZ_A01431                     411   2e-140   Eucalyptus grandis [rose gum]
ref|XP_010919328.1|  PREDICTED: ATPase family AAA domain-containi...    410   6e-140   Elaeis guineensis
ref|XP_010919330.1|  PREDICTED: ATPase family AAA domain-containi...    409   7e-140   Elaeis guineensis
ref|XP_011075925.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase famil...    409   8e-140   
ref|XP_008803940.1|  PREDICTED: ATPase family AAA domain-containi...    408   1e-139   
ref|XP_008803936.1|  PREDICTED: ATPase family AAA domain-containi...    409   1e-139   
ref|XP_009382660.1|  PREDICTED: ATPase family AAA domain-containi...    408   3e-139   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933793.1|  PREDICTED: ATPase family AAA domain-containi...    407   7e-139   Elaeis guineensis
ref|XP_008790557.1|  PREDICTED: ATPase family AAA domain-containi...    405   2e-138   Phoenix dactylifera
ref|XP_008790555.1|  PREDICTED: ATPase family AAA domain-containi...    406   2e-138   Phoenix dactylifera
ref|XP_009351939.1|  PREDICTED: ATPase family AAA domain-containi...    406   3e-138   Pyrus x bretschneideri [bai li]
gb|EYU45294.1|  hypothetical protein MIMGU_mgv1a008723mg                405   3e-138   Erythranthe guttata [common monkey flower]
emb|CDP05016.1|  unnamed protein product                                405   5e-138   Coffea canephora [robusta coffee]
ref|XP_009395395.1|  PREDICTED: ATPase family AAA domain-containi...    405   6e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008437619.1|  PREDICTED: ATPase family AAA domain-containi...    404   1e-137   Cucumis melo [Oriental melon]
ref|XP_011044702.1|  PREDICTED: ATPase family AAA domain-containi...    404   1e-137   Populus euphratica
ref|XP_011084744.1|  PREDICTED: ATPase family AAA domain-containi...    404   2e-137   Sesamum indicum [beniseed]
ref|XP_009588602.1|  PREDICTED: ATPase family AAA domain-containi...    403   4e-137   Nicotiana tomentosiformis
gb|EYU19675.1|  hypothetical protein MIMGU_mgv1a008066mg                402   4e-137   Erythranthe guttata [common monkey flower]
ref|XP_002321379.1|  MSP1 family protein                                402   5e-137   
ref|XP_007161509.1|  hypothetical protein PHAVU_001G075200g             402   6e-137   Phaseolus vulgaris [French bean]
emb|CBI23057.3|  unnamed protein product                                412   9e-137   Vitis vinifera
ref|XP_006581002.1|  PREDICTED: uncharacterized protein LOC100788...    400   3e-136   Glycine max [soybeans]
ref|NP_001242680.1|  uncharacterized protein LOC100788677               399   3e-136   Glycine max [soybeans]
ref|XP_003544721.1|  PREDICTED: ATPase family AAA domain-containi...    400   4e-136   Glycine max [soybeans]
ref|XP_006580999.1|  PREDICTED: uncharacterized protein LOC100788...    400   4e-136   Glycine max [soybeans]
ref|XP_006581001.1|  PREDICTED: uncharacterized protein LOC100788...    399   5e-136   Glycine max [soybeans]
ref|XP_006581000.1|  PREDICTED: uncharacterized protein LOC100788...    399   5e-136   Glycine max [soybeans]
ref|NP_001242817.1|  uncharacterized protein LOC100796908               400   6e-136   Glycine max [soybeans]
ref|XP_007136479.1|  hypothetical protein PHAVU_009G048700g             399   9e-136   Phaseolus vulgaris [French bean]
ref|XP_007136480.1|  hypothetical protein PHAVU_009G048700g             399   9e-136   Phaseolus vulgaris [French bean]
gb|KHN19528.1|  ATPase family AAA domain-containing protein 1-A         397   6e-135   Glycine soja [wild soybean]
ref|XP_006849184.1|  PREDICTED: ATPase family AAA domain-containi...    396   8e-135   Amborella trichopoda
ref|XP_011625168.1|  PREDICTED: ATPase family AAA domain-containi...    396   1e-134   Amborella trichopoda
ref|XP_010671370.1|  PREDICTED: ATPase family AAA domain-containi...    395   7e-134   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK49593.1|  unknown                                                 394   8e-134   Lotus japonicus
ref|XP_004502708.1|  PREDICTED: ATPase family AAA domain-containi...    394   2e-133   Cicer arietinum [garbanzo]
ref|XP_004502711.1|  PREDICTED: ATPase family AAA domain-containi...    392   2e-133   
ref|XP_004502710.1|  PREDICTED: ATPase family AAA domain-containi...    392   3e-133   Cicer arietinum [garbanzo]
ref|NP_200166.1|  P-loop containing nucleoside triphosphate hydro...    391   3e-132   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ95139.1|  predicted protein                                      390   3e-132   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001058575.1|  Os06g0714500                                       390   4e-132   
gb|EMS48070.1|  ATPase family AAA domain-containing protein 1           389   1e-131   Triticum urartu
ref|XP_008643762.1|  PREDICTED: ATPase family AAA domain-containi...    389   2e-131   
ref|NP_001150200.1|  ATPase family AAA domain-containing protein 1      387   2e-131   
ref|XP_006656486.1|  PREDICTED: ATPase family AAA domain-containi...    388   3e-131   Oryza brachyantha
ref|XP_010442921.1|  PREDICTED: ATPase family AAA domain-containi...    387   4e-131   Camelina sativa [gold-of-pleasure]
ref|XP_004966439.1|  PREDICTED: ATPase family AAA domain-containi...    387   5e-131   Setaria italica
ref|XP_004966440.1|  PREDICTED: ATPase family AAA domain-containi...    386   5e-131   Setaria italica
gb|EMT10747.1|  ATPase family AAA domain-containing protein 1           387   6e-131   
ref|NP_001141554.1|  hypothetical protein                               382   6e-131   
ref|XP_006280570.1|  hypothetical protein CARUB_v10026523mg             387   6e-131   Capsella rubella
ref|XP_002865978.1|  hypothetical protein ARALYDRAFT_495431             387   9e-131   Arabidopsis lyrata subsp. lyrata
ref|XP_004502709.1|  PREDICTED: ATPase family AAA domain-containi...    387   1e-130   
ref|XP_010227470.1|  PREDICTED: ATPase family AAA domain-containi...    386   1e-130   Brachypodium distachyon [annual false brome]
ref|XP_003563565.1|  PREDICTED: ATPase family AAA domain-containi...    385   2e-130   Brachypodium distachyon [annual false brome]
ref|XP_004307898.1|  PREDICTED: ATPase family AAA domain-containi...    385   6e-130   Fragaria vesca subsp. vesca
ref|XP_001766326.1|  predicted protein                                  385   7e-130   
ref|XP_010445896.1|  PREDICTED: ATPase family AAA domain-containi...    384   2e-129   Camelina sativa [gold-of-pleasure]
ref|XP_008647557.1|  PREDICTED: uncharacterized protein LOC100273...    383   2e-129   
ref|XP_008647558.1|  PREDICTED: uncharacterized protein LOC100273...    382   2e-129   Zea mays [maize]
gb|KFK26979.1|  hypothetical protein AALP_AA8G318300                    384   2e-129   Arabis alpina [alpine rockcress]
gb|ACJ86310.1|  unknown                                                 379   3e-129   Medicago truncatula
ref|XP_001757757.1|  predicted protein                                  383   4e-129   
ref|XP_003602312.1|  ATPase family AAA domain-containing protein        381   2e-128   Medicago truncatula
ref|XP_006401692.1|  hypothetical protein EUTSA_v10013746mg             381   2e-128   Eutrema salsugineum [saltwater cress]
ref|XP_003602313.1|  ATPase family AAA domain-containing protein        378   4e-128   
ref|XP_002986862.1|  hypothetical protein SELMODRAFT_182690             379   5e-128   Selaginella moellendorffii
ref|XP_009761417.1|  PREDICTED: ATPase family AAA domain-containi...    379   8e-128   Nicotiana sylvestris
ref|XP_002990044.1|  hypothetical protein SELMODRAFT_130943             379   1e-127   
ref|XP_004502707.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase famil...    374   6e-126   Cicer arietinum [garbanzo]
ref|XP_010273365.1|  PREDICTED: ATPase family AAA domain-containi...    374   7e-126   Nelumbo nucifera [Indian lotus]
ref|XP_010273377.1|  PREDICTED: ATPase family AAA domain-containi...    373   9e-126   Nelumbo nucifera [Indian lotus]
ref|XP_006343793.1|  PREDICTED: ATPase family AAA domain-containi...    371   3e-125   Solanum tuberosum [potatoes]
gb|EPS62159.1|  hypothetical protein M569_12633                         368   1e-124   Genlisea aurea
ref|XP_009119902.1|  PREDICTED: ATPase family AAA domain-containi...    370   2e-124   Brassica rapa
emb|CDY20251.1|  BnaC09g29880D                                          370   3e-124   Brassica napus [oilseed rape]
emb|CDY14372.1|  BnaA10g06830D                                          370   4e-124   Brassica napus [oilseed rape]
ref|XP_004235000.1|  PREDICTED: ATPase family AAA domain-containi...    368   2e-123   Solanum lycopersicum
ref|XP_006350497.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase famil...    367   4e-123   
gb|KJB52362.1|  hypothetical protein B456_008G257900                    365   7e-123   Gossypium raimondii
gb|KEH35474.1|  P-loop nucleoside triphosphate hydrolase superfam...    365   7e-123   Medicago truncatula
gb|AES72565.2|  P-loop nucleoside triphosphate hydrolase superfam...    366   8e-123   Medicago truncatula
gb|KJB52361.1|  hypothetical protein B456_008G257900                    365   8e-123   Gossypium raimondii
ref|XP_004245465.1|  PREDICTED: ATPase family AAA domain-containi...    365   1e-122   Solanum lycopersicum
ref|XP_002515675.1|  Protein MSP1, putative                             365   3e-122   Ricinus communis
ref|XP_007039413.1|  P-loop containing nucleoside triphosphate hy...    359   2e-120   
gb|ADE77829.1|  unknown                                                 360   2e-120   Picea sitchensis
ref|XP_003602314.1|  Spastin                                            360   4e-120   
ref|XP_007039158.1|  P-loop containing nucleoside triphosphate hy...    358   4e-120   
ref|XP_009588539.1|  PREDICTED: ATPase family AAA domain-containi...    358   7e-120   Nicotiana tomentosiformis
ref|XP_009787743.1|  PREDICTED: ATPase family AAA domain-containi...    358   8e-120   Nicotiana sylvestris
emb|CDY38752.1|  BnaC03g14970D                                          348   7e-116   Brassica napus [oilseed rape]
ref|XP_001416905.1|  predicted protein                                  329   4e-108   Ostreococcus lucimarinus CCE9901
gb|EYU19674.1|  hypothetical protein MIMGU_mgv1a009250mg                327   9e-108   Erythranthe guttata [common monkey flower]
emb|CDY47077.1|  BnaA03g12210D                                          326   6e-107   Brassica napus [oilseed rape]
ref|XP_002985635.1|  hypothetical protein SELMODRAFT_45400              322   4e-106   
ref|XP_007511046.1|  predicted protein                                  324   1e-105   Bathycoccus prasinos
emb|CEF97071.1|  P-loop containing nucleoside triphosphate hydrolase    321   7e-105   Ostreococcus tauri
gb|ERM94739.1|  hypothetical protein AMTR_s00011p00253490               311   3e-103   Amborella trichopoda
ref|XP_011623829.1|  PREDICTED: ATPase family AAA domain-containi...    313   7e-102   Amborella trichopoda
ref|XP_003078097.1|  AAA+-type ATPase (ISS)                             322   2e-101   
ref|XP_009590016.1|  PREDICTED: ATPase family AAA domain-containi...    308   1e-100   Nicotiana tomentosiformis
ref|XP_010322234.1|  PREDICTED: ATPase family AAA domain-containi...    306   6e-100   
ref|XP_008343803.1|  PREDICTED: ATPase family AAA domain-containi...    296   3e-98    
ref|XP_010933794.1|  PREDICTED: ATPase family AAA domain-containi...    301   4e-98    
ref|XP_002974265.1|  hypothetical protein SELMODRAFT_149735             293   1e-94    
ref|XP_003055969.1|  predicted protein                                  272   1e-86    Micromonas pusilla CCMP1545
ref|XP_002500505.1|  predicted protein                                  270   7e-86    Micromonas commoda
gb|ABR17208.1|  unknown                                                 259   1e-81    Picea sitchensis
ref|XP_005819543.1|  hypothetical protein GUITHDRAFT_91001              252   9e-78    Guillardia theta CCMP2712
gb|KDD73870.1|  AAA+ ATPase                                             224   6e-69    Helicosporidium sp. ATCC 50920
gb|KFH65278.1|  hypothetical protein MVEG_08759                         227   9e-69    Mortierella verticillata NRRL 6337
ref|XP_005644664.1|  AAA-domain-containing protein                      226   2e-68    Coccomyxa subellipsoidea C-169
ref|XP_004365787.1|  ATPase                                             217   5e-65    Capsaspora owczarzaki ATCC 30864
ref|XP_009516748.1|  hypothetical protein PHYSODRAFT_473306             218   8e-65    Phytophthora sojae
ref|XP_008913560.1|  hypothetical protein, variant                      216   4e-64    Phytophthora parasitica INRA-310
ref|XP_002997321.1|  ATPase                                             216   6e-64    Phytophthora infestans T30-4
ref|XP_008913559.1|  hypothetical protein PPTG_17635                    216   9e-64    Phytophthora parasitica INRA-310
gb|ETP32744.1|  hypothetical protein F442_18631                         216   9e-64    Phytophthora parasitica P10297
gb|KDN41754.1|  hypothetical protein RSAG8_07285                        213   3e-63    Rhizoctonia solani AG-8 WAC10335
ref|XP_009268805.1|  hypothetical protein J056_000902                   213   4e-63    Wallemia ichthyophaga EXF-994
ref|XP_007881898.1|  hypothetical protein PFL1_06168                    212   1e-62    Anthracocystis flocculosa PF-1
emb|CDS10722.1|  hypothetical protein LRAMOSA11208                      211   2e-62    Lichtheimia ramosa
dbj|GAK62152.1|  AAA-domain-containing protein                          211   3e-62    Moesziomyces antarcticus
gb|EIE76521.1|  hypothetical protein RO3G_01225                         210   3e-62    Rhizopus delemar RA 99-880
emb|CEG77197.1|  Putative ATPase, AAA-type domain containing protein    210   4e-62    Rhizopus microsporus
emb|CEL62644.1|  putative AAA domain-containing protein C24B10,10...    210   4e-62    Rhizoctonia solani AG-1 IB
gb|EIE82175.1|  hypothetical protein RO3G_06880                         209   5e-62    Rhizopus delemar RA 99-880
dbj|GAC93341.1|  hypothetical protein PHSY_000906                       211   5e-62    Pseudozyma hubeiensis SY62
emb|CCF54256.1|  probable MSP1-intra-mitochondrial sorting protein      210   6e-62    Ustilago hordei
ref|XP_011345735.1|  PREDICTED: ATPase family AAA domain-containi...    209   8e-62    Ooceraea biroi
gb|KDE05272.1|  hypothetical protein MVLG_04304                         209   9e-62    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_011386356.1|  putative intra-mitochondrial sorting protein       210   1e-61    Ustilago maydis 521
ref|XP_011400023.1|  NAD(P) transhydrogenase, mitochondrial             220   1e-61    Auxenochlorella protothecoides
ref|XP_005851607.1|  hypothetical protein CHLNCDRAFT_19045              207   1e-61    Chlorella variabilis
emb|CDI51431.1|  probable MSP1-intra-mitochondrial sorting protein      208   1e-61    Melanopsichium pennsylvanicum 4
gb|KIN99709.1|  hypothetical protein M404DRAFT_1004432                  209   2e-61    Pisolithus tinctorius Marx 270
emb|CBQ67919.1|  probable MSP1-intra-mitochondrial sorting protein      209   2e-61    Sporisorium reilianum SRZ2
gb|EUC63346.1|  AAA family ATPase                                       208   2e-61    Rhizoctonia solani AG-3 Rhs1AP
gb|ESA21149.1|  hypothetical protein GLOINDRAFT_17786                   208   2e-61    
gb|EST06444.1|  AAA+-type ATPase                                        209   2e-61    Kalmanozyma brasiliensis GHG001
emb|CCI50566.1|  unnamed protein product                                209   2e-61    Albugo candida
gb|EPB82322.1|  hypothetical protein HMPREF1544_10917                   208   3e-61    Mucor circinelloides f. circinelloides 1006PhL
emb|CEP18180.1|  hypothetical protein                                   207   3e-61    Parasitella parasitica
ref|XP_006682309.1|  hypothetical protein BATDEDRAFT_91915              208   3e-61    Batrachochytrium dendrobatidis JAM81
ref|XP_002596223.1|  hypothetical protein BRAFLDRAFT_202938             206   4e-61    Branchiostoma floridae
gb|KIM66696.1|  hypothetical protein SCLCIDRAFT_1211084                 208   4e-61    Scleroderma citrinum Foug A
emb|CCO30742.1|  putative AAA domain-containing protein C24B10,10c      206   4e-61    Rhizoctonia solani AG-1 IB
ref|XP_006959407.1|  AAA-domain-containing protein                      207   5e-61    Wallemia mellicola CBS 633.66
emb|CCA26236.1|  ATPase putative                                        209   5e-61    Albugo laibachii Nc14
dbj|GAN06580.1|  AAA-domain-containing protein                          207   6e-61    Mucor ambiguus
dbj|GAC73746.1|  AAA+-type ATPase                                       209   6e-61    Moesziomyces antarcticus T-34
emb|CCU99686.1|  unnamed protein product                                206   6e-61    Malassezia sympodialis ATCC 42132
gb|ETS63750.1|  hypothetical protein PaG_02066                          209   7e-61    Moesziomyces aphidis DSM 70725
gb|KFM58058.1|  ATPase family AAA domain-containing protein 1-B         206   7e-61    Stegodyphus mimosarum
ref|XP_007867103.1|  AAA-domain-containing protein                      206   1e-60    Gloeophyllum trabeum ATCC 11539
ref|XP_011059003.1|  PREDICTED: ATPase family AAA domain-containi...    206   1e-60    Acromyrmex echinatior
ref|XP_012056822.1|  PREDICTED: ATPase family AAA domain-containi...    206   1e-60    Atta cephalotes
gb|EKC24532.1|  ATPase family AAA domain-containing protein 1           205   2e-60    Crassostrea gigas
ref|XP_011695750.1|  PREDICTED: ATPase family AAA domain-containi...    206   2e-60    Wasmannia auropunctata
gb|KIJ54509.1|  hypothetical protein M422DRAFT_200318                   205   4e-60    Sphaerobolus stellatus SS14
ref|XP_011413741.1|  PREDICTED: ATPase family AAA domain-containi...    205   4e-60    Crassostrea gigas
ref|XP_001634116.1|  predicted protein                                  203   5e-60    Nematostella vectensis
ref|XP_004994607.1|  hypothetical protein PTSG_04511                    204   8e-60    Salpingoeca rosetta
ref|XP_011259169.1|  PREDICTED: ATPase family AAA domain-containi...    204   9e-60    Camponotus floridanus
gb|KIL67766.1|  hypothetical protein M378DRAFT_9045                     202   1e-59    Amanita muscaria Koide BX008
ref|XP_008604991.1|  hypothetical protein SDRG_01252                    205   1e-59    Saprolegnia diclina VS20
ref|XP_011159910.1|  PREDICTED: ATPase family AAA domain-containi...    203   2e-59    Solenopsis invicta [imported red fire ant]
gb|KIR42926.1|  ATPase                                                  203   2e-59    Cryptococcus gattii VGII Ram5
ref|XP_003033705.1|  hypothetical protein SCHCODRAFT_81603              201   2e-59    Schizophyllum commune H4-8
ref|XP_011636456.1|  PREDICTED: ATPase family AAA domain-containi...    203   3e-59    Pogonomyrmex barbatus
gb|KIK14103.1|  hypothetical protein PISMIDRAFT_688202                  202   3e-59    Pisolithus microcarpus 441
gb|KIJ15034.1|  hypothetical protein PAXINDRAFT_78055                   202   3e-59    Paxillus involutus ATCC 200175
gb|KIJ59043.1|  hypothetical protein HYDPIDRAFT_101433                  202   3e-59    Hydnomerulius pinastri MD-312
gb|KDO34988.1|  hypothetical protein SPRG_01051                         204   3e-59    Saprolegnia parasitica CBS 223.65
gb|KIY63841.1|  AAA-domain-containing protein                           202   4e-59    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_008879528.1|  hypothetical protein H310_13690                    204   4e-59    Aphanomyces invadans
ref|XP_005704010.1|  AAA-type ATPase                                    204   4e-59    Galdieria sulphuraria
emb|CCG81226.1|  putative Membrane-spanning ATPase                      202   4e-59    Taphrina deformans PYCC 5710
ref|XP_007415396.1|  hypothetical protein MELLADRAFT_92596              202   5e-59    Melampsora larici-populina 98AG31
ref|XP_002414347.1|  26S proteasome regulatory subunit, putative        202   5e-59    Ixodes scapularis [blacklegged tick]
ref|XP_009841758.1|  hypothetical protein H257_15364                    204   6e-59    Aphanomyces astaci
ref|XP_011135055.1|  PREDICTED: ATPase family AAA domain-containi...    202   7e-59    
gb|KGB75016.1|  ATPase                                                  201   8e-59    Cryptococcus gattii VGII R265
ref|XP_011134806.1|  PREDICTED: ATPase family AAA domain-containi...    201   9e-59    Harpegnathos saltator
dbj|BAN21555.1|  ATPase family AAA domain-containing protein            199   1e-58    Riptortus pedestris
gb|EMS22937.1|  ATPase, AAA-type domain containing protein              201   1e-58    Rhodotorula toruloides NP11
gb|KDN37536.1|  putative MSP1-intra-mitochondrial sorting protein       202   1e-58    Tilletiaria anomala UBC 951
ref|NP_001239116.1|  ATPase family AAA domain-containing protein ...    201   1e-58    Nasonia vitripennis
ref|XP_007768861.1|  ATPase                                             201   2e-58    Coniophora puteana RWD-64-598 SS2
gb|KDQ62132.1|  hypothetical protein JAAARDRAFT_700353                  200   2e-58    Jaapia argillacea MUCL 33604
gb|EPT00249.1|  hypothetical protein FOMPIDRAFT_1146685                 200   2e-58    Fomitopsis pinicola FP-58527 SS1
gb|KIM74814.1|  hypothetical protein PILCRDRAFT_827872                  199   3e-58    Piloderma croceum F 1598
ref|XP_011861696.1|  PREDICTED: ATPase family AAA domain-containi...    200   4e-58    Vollenhovia emeryi
ref|XP_007001751.1|  hypothetical protein TREMEDRAFT_59618              200   4e-58    Tremella mesenterica DSM 1558
ref|XP_012049441.1|  ATPase                                             199   4e-58    Cryptococcus neoformans var. grubii H99
gb|KIO29284.1|  hypothetical protein M407DRAFT_171965                   199   4e-58    Tulasnella calospora MUT 4182
ref|XP_570595.1|  ATPase                                                199   5e-58    Cryptococcus neoformans var. neoformans JEC21
ref|XP_008044940.1|  ATPase                                             199   5e-58    Trametes versicolor FP-101664 SS1
gb|KKA26044.1|  hypothetical protein TD95_000347                        201   6e-58    Thielaviopsis punctulata
ref|XP_009545862.1|  AAA family ATPase, CDC48 subfamily                 198   1e-57    Heterobasidion irregulare TC 32-1
ref|XP_007329926.1|  hypothetical protein AGABI1DRAFT_120625            198   1e-57    Agaricus bisporus var. burnettii JB137-S8
gb|KIK69864.1|  hypothetical protein GYMLUDRAFT_34253                   198   1e-57    Gymnopus luxurians FD-317 M1
gb|AAC19276.1|  T14P8.7                                                 198   2e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007366160.1|  AAA-domain-containing protein                      197   2e-57    Dichomitus squalens LYAD-421 SS1
gb|KIP02717.1|  hypothetical protein PHLGIDRAFT_95701                   198   2e-57    Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_003743323.1|  PREDICTED: ATPase family AAA domain-containi...    198   2e-57    Galendromus occidentalis
gb|KIM43074.1|  hypothetical protein M413DRAFT_443888                   197   2e-57    Hebeloma cylindrosporum h7
ref|XP_011113208.1|  hypothetical protein H072_7454                     198   2e-57    
ref|XP_004924407.1|  PREDICTED: ATPase family AAA domain-containi...    198   2e-57    Bombyx mori [silk moth]
gb|ETN61589.1|  aaa atpase                                              198   2e-57    Anopheles darlingi [American malaria mosquito]
gb|EFN90162.1|  ATPase family AAA domain-containing protein 1-B         201   3e-57    Harpegnathos saltator
gb|KIK36877.1|  hypothetical protein CY34DRAFT_490180                   198   3e-57    Suillus luteus UH-Slu-Lm8-n1
gb|KDQ16005.1|  hypothetical protein BOTBODRAFT_31090                   197   3e-57    Botryobasidium botryosum FD-172 SS1
ref|XP_006462479.1|  hypothetical protein AGABI2DRAFT_206823            197   3e-57    Agaricus bisporus var. bisporus H97
gb|EMD39600.1|  hypothetical protein CERSUDRAFT_111911                  197   3e-57    Gelatoporia subvermispora B
gb|ETE66294.1|  ATPase family AAA domain-containing protein 1           195   4e-57    Ophiophagus hannah
emb|CDO72197.1|  hypothetical protein BN946_scf184970.g49               197   4e-57    Trametes cinnabarina
ref|XP_001835627.2|  ATPase                                             197   4e-57    Coprinopsis cinerea okayama7#130
ref|XP_008534288.1|  PREDICTED: ATPase family AAA domain-containi...    193   5e-57    Equus przewalskii [Przewalski horse]
ref|XP_002948744.1|  hypothetical protein VOLCADRAFT_73960              197   5e-57    Volvox carteri f. nagariensis
emb|CDR37614.1|  CYFA0S01e13344g1_1                                     196   5e-57    Cyberlindnera fabianii
ref|XP_004924408.1|  PREDICTED: ATPase family AAA domain-containi...    197   5e-57    
ref|NP_588013.1|  mitochondrial outer membrane ATPase Msp1 (predi...    196   6e-57    Schizosaccharomyces pombe
ref|XP_001650903.1|  AAEL005454-PA                                      197   7e-57    Aedes aegypti
dbj|BAK03805.1|  predicted protein                                      197   7e-57    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW60181.1|  hypothetical protein ZEAMMB73_551737                    199   7e-57    
ref|XP_005537452.1|  unknown conserved AAA protein                      197   8e-57    Cyanidioschyzon merolae strain 10D
ref|XP_007305042.1|  AAA-domain-containing protein                      196   9e-57    Stereum hirsutum FP-91666 SS1
gb|KFZ48410.1|  ATPase family AAA domain-containing protein 1           192   9e-57    Antrostomus carolinensis
gb|ENN73205.1|  hypothetical protein YQE_10184                          196   9e-57    Dendroctonus ponderosae
ref|XP_010172551.1|  PREDICTED: ATPase family AAA domain-containi...    192   1e-56    Antrostomus carolinensis
emb|CCM03726.1|  predicted protein                                      196   1e-56    Fibroporia radiculosa
gb|KFQ49824.1|  ATPase family AAA domain-containing protein 1           192   1e-56    Pelecanus crispus
ref|XP_004653254.1|  PREDICTED: ATPase family AAA domain-containi...    196   1e-56    
ref|XP_502194.1|  YALI0C23749p                                          196   1e-56    
dbj|BAE64834.1|  unnamed protein product                                196   1e-56    
ref|XP_001274823.1|  membrane-spanning ATPase, putative                 197   1e-56    
ref|XP_009477306.1|  PREDICTED: ATPase family AAA domain-containi...    191   2e-56    
ref|XP_003715261.1|  ATPase family AAA domain-containing protein 1      197   2e-56    
gb|AAH73998.1|  ATAD1 protein                                           193   2e-56    
gb|EWC44102.1|  protein MSP1                                            196   2e-56    
ref|XP_001752278.1|  predicted protein                                  194   2e-56    
ref|XP_004924406.1|  PREDICTED: ATPase family AAA domain-containi...    196   2e-56    
gb|EGW09896.1|  ATPase family AAA domain-containing protein 1           194   2e-56    
ref|XP_001866728.1|  aaa atpase                                         196   2e-56    
ref|XP_011538605.1|  PREDICTED: ATPase family AAA domain-containi...    193   2e-56    
ref|XP_002115272.1|  hypothetical protein TRIADDRAFT_59287              194   2e-56    
ref|XP_008028217.1|  hypothetical protein SETTUDRAFT_92705              197   2e-56    
dbj|GAD94388.1|  membrane-spanning ATPase, putative                     196   2e-56    
ref|XP_746586.1|  membrane-spanning ATPase                              196   3e-56    
gb|EFB20294.1|  hypothetical protein PANDA_002316                       193   3e-56    
ref|XP_008436304.1|  PREDICTED: ATPase family AAA domain-containi...    195   3e-56    
ref|XP_008574036.1|  PREDICTED: ATPase family AAA domain-containi...    193   3e-56    
ref|XP_006440093.1|  hypothetical protein CICLE_v100185462mg            197   3e-56    
ref|XP_001262405.1|  membrane-spanning ATPase, putative                 196   3e-56    
ref|XP_007544175.1|  PREDICTED: ATPase family AAA domain-containi...    194   3e-56    
gb|AAH63530.1|  ATAD1 protein                                           194   3e-56    
ref|XP_005270310.1|  PREDICTED: ATPase family AAA domain-containi...    194   3e-56    
ref|XP_010190798.1|  PREDICTED: ATPase family AAA domain-containi...    191   3e-56    
ref|XP_003922486.1|  PREDICTED: ATPase family AAA domain-containi...    193   3e-56    
ref|XP_006307719.1|  hypothetical protein CARUB_v100081071mg            197   3e-56    
ref|XP_011738380.1|  PREDICTED: ATPase family AAA domain-containi...    194   4e-56    
ref|XP_004464584.1|  PREDICTED: ATPase family AAA domain-containi...    193   4e-56    
emb|CCA75135.1|  probable MSP1-intra-mitochondrial sorting protein      194   4e-56    
ref|XP_002287038.1|  26S proteasome regulatory particle chain rpt...    192   4e-56    
ref|XP_008940689.1|  PREDICTED: ATPase family AAA domain-containi...    191   4e-56    
ref|XP_009243869.1|  PREDICTED: ATPase family AAA domain-containi...    194   4e-56    
gb|KFQ19077.1|  ATPase family AAA domain-containing protein 1           191   4e-56    
gb|KFQ25800.1|  ATPase family AAA domain-containing protein 1           191   4e-56    
gb|ELU38153.1|  ATPase                                                  194   5e-56    
ref|XP_006732682.1|  PREDICTED: ATPase family AAA domain-containi...    193   5e-56    
gb|EDL41728.1|  ATPase family, AAA domain containing 1, isoform C...    193   5e-56    
gb|EPY49775.1|  outer membrane ATPase Msp1                              194   5e-56    
ref|XP_005844590.1|  hypothetical protein CHLNCDRAFT_32508              196   5e-56    
gb|KEZ46497.1|  ATPase family aaa domain-containing protein 1           195   5e-56    
ref|XP_004942050.1|  PREDICTED: ATPase family AAA domain-containi...    194   5e-56    
ref|XP_010712455.1|  PREDICTED: ATPase family AAA domain-containi...    194   5e-56    
ref|XP_004701144.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_010219184.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
gb|KFQ89256.1|  ATPase family AAA domain-containing protein 1           194   6e-56    
gb|EPS30738.1|  hypothetical protein PDE_05690                          195   6e-56    
gb|KFZ64731.1|  ATPase family AAA domain-containing protein 1           194   6e-56    
ref|XP_007520819.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_004680951.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_007478375.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_005352206.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
gb|KGL81602.1|  ATPase family AAA domain-containing protein 1           194   6e-56    
ref|XP_004583438.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_005017360.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_003708159.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_004607557.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_003474002.1|  PREDICTED: ATPase family AAA domain-containi...    194   6e-56    
ref|XP_451808.1|  hypothetical protein                                  194   6e-56    
ref|NP_001030174.1|  ATPase family AAA domain-containing protein 1      194   7e-56    
ref|XP_005242648.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_005005346.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_006880378.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_004764185.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
gb|EHH19196.1|  hypothetical protein EGK_19863                          194   7e-56    
ref|XP_010377929.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase famil...    194   7e-56    
ref|XP_006630434.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|NP_116199.2|  ATPase family AAA domain-containing protein 1         194   7e-56    
ref|XP_007942221.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_006169792.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_003755111.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_004464583.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_004020060.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_006937777.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_003409299.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_004887385.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|NP_001192510.1|  ATPase family AAA domain-containing protein 1      194   7e-56    
ref|XP_004369958.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_003510359.1|  PREDICTED: ATPase family AAA domain-containi...    194   7e-56    
ref|XP_006926040.1|  PREDICTED: ATPase family AAA domain-containi...    193   7e-56    
ref|XP_002168533.2|  PREDICTED: ATPase family AAA domain-containi...    194   8e-56    
ref|XP_008836077.1|  PREDICTED: ATPase family AAA domain-containi...    193   8e-56    
ref|XP_001757401.1|  predicted protein                                  194   8e-56    
ref|XP_001503243.3|  PREDICTED: ATPase family AAA domain-containi...    193   8e-56    
gb|ELR48479.1|  ATPase family AAA domain-containing protein 1           194   8e-56    
ref|XP_007125600.1|  PREDICTED: ATPase family AAA domain-containi...    194   8e-56    
gb|AAI51347.1|  ATAD1 protein                                           194   8e-56    
ref|XP_003255219.1|  PREDICTED: uncharacterized protein LOC100604157    193   8e-56    
emb|CAB41125.1|  putative protein                                       196   8e-56    
emb|CDO92275.1|  unnamed protein product                                193   9e-56    
ref|XP_001506311.1|  PREDICTED: ATPase family AAA domain-containi...    193   9e-56    
gb|EYU44233.1|  hypothetical protein MIMGU_mgv1a025625mg                192   9e-56    
ref|XP_010603287.1|  PREDICTED: ATPase family AAA domain-containi...    193   9e-56    
ref|XP_001211418.1|  ATPase family AAA domain-containing protein 1      195   9e-56    
ref|XP_004049785.1|  PREDICTED: ATPase family AAA domain-containi...    193   9e-56    
ref|XP_007544174.1|  PREDICTED: ATPase family AAA domain-containi...    195   1e-55    
ref|XP_001589289.1|  hypothetical protein SS1G_09923                    194   1e-55    
ref|XP_007125603.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_008114504.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_006121517.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_005810520.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_002186992.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
gb|EMF16152.1|  AAA-domain-containing protein                           194   1e-55    
gb|KFB39528.1|  AGAP009625-PA-like protein                              194   1e-55    
ref|XP_008925306.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_005530789.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_007079320.1|  PREDICTED: ATPase family AAA domain-containi...    194   1e-55    
ref|XP_010406941.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_009082064.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_008631503.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_005352205.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
dbj|GAM35956.1|  hypothetical protein TCE0_018f04682                    195   1e-55    
ref|XP_004806308.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_005495956.1|  PREDICTED: ATPase family AAA domain-containi...    192   1e-55    
ref|XP_005983358.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
gb|KFW83570.1|  ATPase family AAA domain-containing protein 1           193   1e-55    
ref|XP_005430337.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_003993911.2|  PREDICTED: ATPase family AAA domain-containi...    194   1e-55    
ref|XP_005048092.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
gb|KFO58803.1|  ATPase family AAA domain-containing protein 1           193   1e-55    
ref|XP_004806311.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_007895098.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_011505926.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase famil...    193   1e-55    
ref|XP_007125599.1|  PREDICTED: ATPase family AAA domain-containi...    193   1e-55    
ref|XP_006283021.1|  hypothetical protein CARUB_v10004013mg             202   1e-55    
ref|XP_005292549.1|  PREDICTED: ATPase family AAA domain-containi...    192   1e-55    
gb|KIK85956.1|  hypothetical protein PAXRUDRAFT_831938                  194   2e-55    
ref|XP_006009984.1|  PREDICTED: ATPase family AAA domain-containi...    192   2e-55    
gb|KFO23279.1|  ATPase family AAA domain-containing protein 1           193   2e-55    
ref|XP_007071644.1|  PREDICTED: ATPase family AAA domain-containi...    192   2e-55    
ref|XP_009901270.1|  PREDICTED: ATPase family AAA domain-containi...    192   2e-55    
ref|XP_318657.4|  AGAP009625-PA                                         193   2e-55    
ref|XP_011186583.1|  PREDICTED: ATPase family AAA domain-containi...    193   2e-55    
ref|XP_001825967.2|  ATPase family AAA domain-containing protein 1      194   2e-55    
ref|XP_395325.3|  PREDICTED: ATPase family AAA domain-containing ...    193   2e-55    
ref|XP_002377613.1|  membrane-spanning ATPase, putative                 194   2e-55    
ref|XP_007470360.1|  PREDICTED: ATPase family AAA domain-containi...    194   2e-55    
gb|KFV69221.1|  ATPase family AAA domain-containing protein 1           192   2e-55    
ref|XP_010481336.1|  PREDICTED: spastin-like                            199   2e-55    
ref|XP_004522760.1|  PREDICTED: ATPase family AAA domain-containi...    193   2e-55    
ref|XP_003402817.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase famil...    193   2e-55    
gb|KJK61045.1|  SpoVK                                                   194   2e-55    
ref|XP_010194144.1|  PREDICTED: ATPase family AAA domain-containi...    192   2e-55    
ref|XP_008302812.1|  PREDICTED: ATPase family AAA domain-containi...    192   2e-55    
gb|AJS08690.1|  Msp1p                                                   192   2e-55    
ref|XP_002718538.2|  PREDICTED: ATPase family AAA domain-containi...    193   2e-55    
ref|XP_007179217.1|  PREDICTED: ATPase family AAA domain-containi...    193   2e-55    
ref|XP_008758552.1|  PREDICTED: ATPase family AAA domain-containi...    193   2e-55    
gb|KFP29284.1|  ATPase family AAA domain-containing protein 1           192   2e-55    
ref|XP_003449514.1|  PREDICTED: ATPase family AAA domain-containi...    192   2e-55    
gb|KIY47195.1|  ATPase                                                  192   3e-55    
ref|XP_006527375.2|  PREDICTED: ATPase family AAA domain-containi...    193   3e-55    
ref|XP_010863021.1|  PREDICTED: ATPase family AAA domain-containi...    192   3e-55    
ref|XP_005948553.1|  PREDICTED: ATPase family AAA domain-containi...    192   3e-55    
ref|XP_006793348.1|  PREDICTED: ATPase family AAA domain-containi...    192   3e-55    
ref|XP_004565288.1|  PREDICTED: ATPase family AAA domain-containi...    192   3e-55    
gb|KIK06203.1|  hypothetical protein K443DRAFT_674487                   192   3e-55    
gb|EJU03064.1|  AAA-domain-containing protein                           191   3e-55    
gb|KGO70918.1|  ATPase, AAA-type, core                                  193   3e-55    
emb|CDM26754.1|  Protein MSP1                                           193   3e-55    
ref|XP_006579598.1|  PREDICTED: uncharacterized protein LOC100790...    201   3e-55    
ref|XP_005505255.1|  PREDICTED: ATPase family AAA domain-containi...    192   3e-55    
gb|EMC87588.1|  ATPase family AAA domain-containing protein 1           192   3e-55    
ref|XP_005153773.1|  PREDICTED: ATPase family AAA domain-containi...    192   3e-55    
gb|KII91042.1|  hypothetical protein PLICRDRAFT_52711                   191   3e-55    
gb|KHN14100.1|  Spastin                                                 201   3e-55    
ref|XP_008547836.1|  PREDICTED: ATPase family AAA domain-containi...    192   3e-55    
gb|KFQ46086.1|  ATPase family AAA domain-containing protein 1           192   3e-55    
dbj|BAO40861.1|  protein MSP1                                           192   3e-55    
ref|XP_006579597.1|  PREDICTED: uncharacterized protein LOC100790...    201   3e-55    
ref|XP_006600805.1|  PREDICTED: uncharacterized protein LOC100816731    201   3e-55    
dbj|BAP72324.1|  protein MSP1                                           192   3e-55    
ref|XP_009560066.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
ref|XP_010074499.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
gb|AAL57218.1|AF361493_1  FNP001                                        192   4e-55    
gb|KFV09193.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
ref|XP_001876174.1|  predicted protein                                  192   4e-55    
gb|AFW60180.1|  hypothetical protein ZEAMMB73_551737                    199   4e-55    
ref|XP_009879826.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
ref|XP_010310311.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
ref|XP_003321506.2|  adenosinetriphosphatase                            193   4e-55    
gb|KFO76817.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
gb|KFO07610.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
gb|KFP07228.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
ref|XP_009807367.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
ref|XP_009331041.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
gb|KGL86239.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
ref|XP_009045355.1|  hypothetical protein LOTGIDRAFT_177773             191   4e-55    
gb|KHN34412.1|  Spastin                                                 201   4e-55    
gb|AJR78616.1|  Msp1p                                                   192   4e-55    
ref|XP_010564237.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
ref|XP_009949294.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
ref|XP_003660388.1|  hypothetical protein MYCTH_2298652                 193   4e-55    
ref|XP_011597184.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
ref|XP_010436397.1|  PREDICTED: uncharacterized protein LOC104720133    201   4e-55    
gb|KFQ11161.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
gb|KFW73270.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
gb|KFV90842.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
ref|XP_006029061.1|  PREDICTED: ATPase family AAA domain-containi...    191   4e-55    
gb|KFV48543.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
gb|KFP14881.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
gb|KFQ78520.1|  ATPase family AAA domain-containing protein 1           192   4e-55    
ref|XP_009925789.1|  PREDICTED: ATPase family AAA domain-containi...    191   4e-55    
ref|XP_008500280.1|  PREDICTED: ATPase family AAA domain-containi...    191   4e-55    
gb|EWG91012.1|  Msp1p                                                   191   4e-55    
gb|KFV73232.1|  ATPase family AAA domain-containing protein 1           191   4e-55    
gb|KFQ97757.1|  ATPase family AAA domain-containing protein 1           191   4e-55    
ref|XP_010159638.1|  PREDICTED: ATPase family AAA domain-containi...    191   4e-55    
gb|KFV41631.1|  ATPase family AAA domain-containing protein 1           191   4e-55    
ref|XP_011213994.1|  PREDICTED: ATPase family AAA domain-containi...    192   4e-55    
ref|NP_011542.3|  Msp1p                                                 191   4e-55    
gb|KFW90932.1|  ATPase family AAA domain-containing protein 1           191   4e-55    
gb|KFP43482.1|  ATPase family AAA domain-containing protein 1           191   4e-55    
gb|KFR11486.1|  ATPase family AAA domain-containing protein 1           191   4e-55    
gb|EGA82813.1|  Msp1p                                                   191   5e-55    
ref|XP_006273486.1|  PREDICTED: ATPase family AAA domain-containi...    191   5e-55    
gb|KDR82549.1|  hypothetical protein GALMADRAFT_87937                   191   5e-55    
ref|XP_007155539.1|  hypothetical protein PHAVU_003G210300g             201   5e-55    
ref|XP_009933880.1|  PREDICTED: ATPase family AAA domain-containi...    191   5e-55    
gb|AJS04244.1|  Msp1p                                                   191   5e-55    



>ref|XP_004145937.1| PREDICTED: ATPase family AAA domain-containing protein 1 [Cucumis 
sativus]
 gb|KGN49850.1| hypothetical protein Csa_5G139280 [Cucumis sativus]
Length=392

 Score =   426 bits (1094),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G GSSET+ +QEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLI
Sbjct  2    GSGSSETRFVQELILYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
            QTN YEDVIACDVINPDHIDVEFNSIGGLE+IKQAL ELVILPL+RPELFSHGKLLGPQK
Sbjct  62   QTNPYEDVIACDVINPDHIDVEFNSIGGLESIKQALIELVILPLKRPELFSHGKLLGPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRTTDHEAMTNMKTEFMALWDGFTTD  220



>gb|KJB37401.1| hypothetical protein B456_006G203100 [Gossypium raimondii]
Length=355

 Score =   424 bits (1090),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G  SSETK+LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLI
Sbjct  5    GSSSSETKLLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLI  64

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             TN YEDVIACDVINPDHIDVEF SIGGLEAIKQALYELVILPL+RPELFSHGKLLGPQK
Sbjct  65   NTNPYEDVIACDVINPDHIDVEFESIGGLEAIKQALYELVILPLRRPELFSHGKLLGPQK  124

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPA
Sbjct  125  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPA  184

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  185  IIFIDEVDSFLGQRRNTDHEAMTNMKTEFMALWDGFTTD  223



>ref|XP_010109212.1| ATPase family AAA domain-containing protein 1-A [Morus notabilis]
 gb|EXC21392.1| ATPase family AAA domain-containing protein 1-A [Morus notabilis]
Length=391

 Score =   425 bits (1093),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPL+Q
Sbjct  2    GGSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLVQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLEAIKQALYELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFESIGGLEAIKQALYELVILPLRRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRNTDHEAMTNMKTEFMALWDGFTTD  219



>gb|KJB37400.1| hypothetical protein B456_006G203100 [Gossypium raimondii]
Length=397

 Score =   425 bits (1092),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G  SSETK+LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLI
Sbjct  5    GSSSSETKLLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLI  64

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             TN YEDVIACDVINPDHIDVEF SIGGLEAIKQALYELVILPL+RPELFSHGKLLGPQK
Sbjct  65   NTNPYEDVIACDVINPDHIDVEFESIGGLEAIKQALYELVILPLRRPELFSHGKLLGPQK  124

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPA
Sbjct  125  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPA  184

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  185  IIFIDEVDSFLGQRRNTDHEAMTNMKTEFMALWDGFTTD  223



>ref|XP_006491956.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X2 [Citrus sinensis]
Length=369

 Score =   423 bits (1087),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPLIQ
Sbjct  6    GNSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLIQ  65

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLE IKQALYELVILPL+RPELFSHGKLLGPQKG
Sbjct  66   TNPYEDVIACDVINPDHIDVEFESIGGLETIKQALYELVILPLRRPELFSHGKLLGPQKG  125

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  126  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  185

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+++DHEALTNMKTEFMALWDGFTTD
Sbjct  186  IFIDEVDSFLGQRRTSDHEALTNMKTEFMALWDGFTTD  223



>ref|XP_006441188.1| hypothetical protein CICLE_v10020488mg [Citrus clementina]
 ref|XP_006491955.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Citrus sinensis]
 gb|ESR54428.1| hypothetical protein CICLE_v10020488mg [Citrus clementina]
 gb|KDO59684.1| hypothetical protein CISIN_1g016044mg [Citrus sinensis]
Length=396

 Score =   424 bits (1089),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPLIQ
Sbjct  6    GNSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLIQ  65

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLE IKQALYELVILPL+RPELFSHGKLLGPQKG
Sbjct  66   TNPYEDVIACDVINPDHIDVEFESIGGLETIKQALYELVILPLRRPELFSHGKLLGPQKG  125

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  126  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  185

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+++DHEALTNMKTEFMALWDGFTTD
Sbjct  186  IFIDEVDSFLGQRRTSDHEALTNMKTEFMALWDGFTTD  223



>ref|XP_004240969.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X4 [Solanum lycopersicum]
Length=392

 Score =   423 bits (1088),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
             GSSETK+LQEL+LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  3    SGSSETKLLQELILYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIQ  62

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDV+NPDHIDVEFNSIGGLE+IKQAL ELVILP++RPELFSHGKLLGPQKG
Sbjct  63   TNPYEDVIACDVVNPDHIDVEFNSIGGLESIKQALCELVILPMRRPELFSHGKLLGPQKG  122

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAI
Sbjct  123  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAI  182

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  183  IFIDEVDSFLGQRKATDHEALTNMKTEFMALWDGFTTD  220



>ref|XP_010322232.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X2 [Solanum lycopersicum]
Length=393

 Score =   423 bits (1088),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
             GSSETK+LQEL+LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  3    SGSSETKLLQELILYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIQ  62

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDV+NPDHIDVEFNSIGGLE+IKQAL ELVILP++RPELFSHGKLLGPQKG
Sbjct  63   TNPYEDVIACDVVNPDHIDVEFNSIGGLESIKQALCELVILPMRRPELFSHGKLLGPQKG  122

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAI
Sbjct  123  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAI  182

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  183  IFIDEVDSFLGQRKATDHEALTNMKTEFMALWDGFTTD  220



>ref|XP_006367358.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006367359.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X4 [Solanum tuberosum]
Length=392

 Score =   423 bits (1087),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
             GSSETK+LQEL+LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  3    SGSSETKLLQELILYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIQ  62

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDV+NPDHIDVEFNSIGGLE+IKQAL ELVILP++RPELFSHGKLLGPQKG
Sbjct  63   TNPYEDVIACDVVNPDHIDVEFNSIGGLESIKQALCELVILPMRRPELFSHGKLLGPQKG  122

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAI
Sbjct  123  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAI  182

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  183  IFIDEVDSFLGQRKATDHEALTNMKTEFMALWDGFTTD  220



>ref|XP_006367356.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006367357.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X2 [Solanum tuberosum]
Length=393

 Score =   423 bits (1087),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
             GSSETK+LQEL+LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  3    SGSSETKLLQELILYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIQ  62

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDV+NPDHIDVEFNSIGGLE+IKQAL ELVILP++RPELFSHGKLLGPQKG
Sbjct  63   TNPYEDVIACDVVNPDHIDVEFNSIGGLESIKQALCELVILPMRRPELFSHGKLLGPQKG  122

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAI
Sbjct  123  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAI  182

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  183  IFIDEVDSFLGQRKATDHEALTNMKTEFMALWDGFTTD  220



>gb|KHG23355.1| ATPase family AAA domain-containing protein 1-A [Gossypium arboreum]
Length=392

 Score =   422 bits (1086),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G  SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKA E+KKEIAKRLGRPLI
Sbjct  2    GSSSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKAQEHKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             TN YEDVIACDVINPDHIDVEF SIGGLEAIKQALYELVILPL+RPELFSHGKLLGPQK
Sbjct  62   HTNPYEDVIACDVINPDHIDVEFESIGGLEAIKQALYELVILPLRRPELFSHGKLLGPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIAKESDAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRNTDHEAMTNMKTEFMALWDGFTTD  220



>ref|XP_007039157.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY23658.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=392

 Score =   422 bits (1085),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G  SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE KKEIAKRLGRPLI
Sbjct  2    GSSSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEQKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             TN YEDVIACDVINPDHIDVEF SIGGLE+IKQALYELVILPL+RPELF+HGKLLGPQK
Sbjct  62   HTNPYEDVIACDVINPDHIDVEFESIGGLESIKQALYELVILPLRRPELFAHGKLLGPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRNTDHEAMTNMKTEFMALWDGFTTD  220



>ref|XP_008456001.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Cucumis melo]
Length=384

 Score =   422 bits (1084),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GVSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEFNSIGGLE IKQALYELVILPL+RPELFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFNSIGGLETIKQALYELVILPLRRPELFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQP+I
Sbjct  122  VLLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPSI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFL QR+S+DHEAL+NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLSQRRSSDHEALSNMKTEFMALWDGFTTD  219



>ref|XP_011651304.1| PREDICTED: ATPase family AAA domain-containing protein 1-B [Cucumis 
sativus]
 gb|KGN57645.1| hypothetical protein Csa_3G238110 [Cucumis sativus]
Length=384

 Score =   421 bits (1082),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GVSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEFNSIGGLE IKQALYELVILPL+RPELFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFNSIGGLETIKQALYELVILPLRRPELFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQP+I
Sbjct  122  VLLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPSI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFL QR+S+DHEAL+NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLSQRRSSDHEALSNMKTEFMALWDGFTTD  219



>gb|KJB23967.1| hypothetical protein B456_004G122900 [Gossypium raimondii]
Length=392

 Score =   421 bits (1083),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G  SSETK LQEL+LYAASAA SCLVLF GLRHLDPNREASKKA E+KKEIAKRLGRPLI
Sbjct  2    GSSSSETKFLQELILYAASAAFSCLVLFAGLRHLDPNREASKKAQEHKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             TN YEDVIACDVINPDHIDVEF+SIGGLEAIKQALYELVILPL+RPELFSHGKLLGPQK
Sbjct  62   HTNPYEDVIACDVINPDHIDVEFDSIGGLEAIKQALYELVILPLRRPELFSHGKLLGPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFIN++ISNLMSKWFGDAQKLVAAVFSLAYKLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIAKESGAVFINIRISNLMSKWFGDAQKLVAAVFSLAYKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRNTDHEAMTNMKTEFMALWDGFTTD  220



>ref|XP_009775966.1| PREDICTED: ATPase family AAA domain-containing protein 1 [Nicotiana 
sylvestris]
Length=392

 Score =   420 bits (1080),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 212/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
              SSETK +QEL+LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  3    SNSSETKFVQELILYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIQ  62

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDV+NPDHIDVEF+SIGGLE+IKQALYELVILP++RPELFSHGKLLGPQKG
Sbjct  63   TNPYEDVIACDVVNPDHIDVEFDSIGGLESIKQALYELVILPMRRPELFSHGKLLGPQKG  122

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLAYKLQPAI
Sbjct  123  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAYKLQPAI  182

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQRK++DHEALTNMKTEFMALWDGFTTD
Sbjct  183  IFIDEVDSFLGQRKTSDHEALTNMKTEFMALWDGFTTD  220



>ref|XP_010448091.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Camelina sativa]
Length=399

 Score =   419 bits (1077),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPLIQ
Sbjct  2    GGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINP+HIDVEF SIGGLEAIKQ+LYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPNHIDVEFGSIGGLEAIKQSLYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINVK+SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVKVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+S+DHEA++NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSSDHEAMSNMKTEFMALWDGFSTD  219



>ref|XP_006282639.1| hypothetical protein CARUB_v10004969mg [Capsella rubella]
 gb|EOA15537.1| hypothetical protein CARUB_v10004969mg [Capsella rubella]
Length=398

 Score =   419 bits (1077),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 212/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPLIQ
Sbjct  2    GGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLEAIK +LYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFGSIGGLEAIKHSLYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STDHEA++NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSTDHEAMSNMKTEFMALWDGFSTD  219



>ref|XP_010322233.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X3 [Solanum lycopersicum]
Length=393

 Score =   419 bits (1076),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 213/219 (97%), Gaps = 1/219 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
             GSSETK+LQEL+LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  3    SGSSETKLLQELILYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIQ  62

Query  237  TNTYE-DVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
            TN YE DVIACDV+NPDHIDVEFNSIGGLE+IKQAL ELVILP++RPELFSHGKLLGPQK
Sbjct  63   TNPYEQDVIACDVVNPDHIDVEFNSIGGLESIKQALCELVILPMRRPELFSHGKLLGPQK  122

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPA
Sbjct  123  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPA  182

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  183  IIFIDEVDSFLGQRKATDHEALTNMKTEFMALWDGFTTD  221



>ref|XP_010322230.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010322231.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Solanum lycopersicum]
Length=394

 Score =   419 bits (1076),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 213/219 (97%), Gaps = 1/219 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
             GSSETK+LQEL+LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  3    SGSSETKLLQELILYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIQ  62

Query  237  TNTYE-DVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
            TN YE DVIACDV+NPDHIDVEFNSIGGLE+IKQAL ELVILP++RPELFSHGKLLGPQK
Sbjct  63   TNPYEQDVIACDVVNPDHIDVEFNSIGGLESIKQALCELVILPMRRPELFSHGKLLGPQK  122

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPA
Sbjct  123  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPA  182

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  183  IIFIDEVDSFLGQRKATDHEALTNMKTEFMALWDGFTTD  221



>ref|XP_009361314.1| PREDICTED: ATPase family AAA domain-containing protein 1-B [Pyrus 
x bretschneideri]
Length=394

 Score =   419 bits (1076),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M G G  ETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKA+E+KKEI+KRLGRP
Sbjct  1    MGGSGERETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKAMEHKKEISKRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            LI TN+YEDVIACDVINPDHI+VEF SIGGL+AIK+ALYELVILPLQRP LFSHGKLLGP
Sbjct  61   LINTNSYEDVIACDVINPDHIEVEFGSIGGLDAIKEALYELVILPLQRPNLFSHGKLLGP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQ
Sbjct  121  QKGVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEALTNMKTEFMALWDGFTTD
Sbjct  181  PAIIFIDEVDSFLGQRRNTDHEALTNMKTEFMALWDGFTTD  221



>ref|XP_009590015.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=392

 Score =   418 bits (1074),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
              SSETK +QEL+LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLI 
Sbjct  3    SNSSETKFVQELILYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIH  62

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDV+NPDHIDVEF+SIGGLE+IKQALYELVILP++RPELFSHGKLLGPQKG
Sbjct  63   TNPYEDVIACDVVNPDHIDVEFDSIGGLESIKQALYELVILPMRRPELFSHGKLLGPQKG  122

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLAYKLQPAI
Sbjct  123  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAYKLQPAI  182

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQRK++DHEALTNMKTEFMALWDGFTTD
Sbjct  183  IFIDEVDSFLGQRKTSDHEALTNMKTEFMALWDGFTTD  220



>emb|CDX92836.1| BnaC07g40940D [Brassica napus]
Length=391

 Score =   418 bits (1074),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA+SCLVLF GL+HLDPNREASKKALENKKEI+KRLGRPLI 
Sbjct  2    GGSSETKILQELILYAASAALSCLVLFAGLKHLDPNREASKKALENKKEISKRLGRPLIH  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLE IKQ+LYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFGSIGGLETIKQSLYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>emb|CDY29857.1| BnaA03g48780D [Brassica napus]
Length=391

 Score =   417 bits (1073),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA+SCLVLF GL+HLDPNREASKKALENKKEI+KRLGRPLI 
Sbjct  2    GGSSETKILQELILYAASAALSCLVLFAGLKHLDPNREASKKALENKKEISKRLGRPLIH  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLE IKQ+LYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFGSIGGLETIKQSLYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>emb|CDY71574.1| BnaAnng37990D [Brassica napus]
Length=392

 Score =   416 bits (1070),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 212/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA+SCLVLF GL+HLDPNREASKKALE+KKEI+KRLGRPLI 
Sbjct  2    GGSSETKILQELILYAASAALSCLVLFAGLKHLDPNREASKKALEHKKEISKRLGRPLIH  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN+YEDVIACDVINPDHIDVEF SIGGLE IKQ+LYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNSYEDVIACDVINPDHIDVEFGSIGGLETIKQSLYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>ref|XP_010433328.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Camelina sativa]
Length=399

 Score =   417 bits (1071),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 212/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPLIQ
Sbjct  2    GGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINP+HIDVEF SIGGLEAIK +LYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPNHIDVEFGSIGGLEAIKHSLYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINVK+SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVKVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+S+DHEA++NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSSDHEAMSNMKTEFMALWDGFSTD  219



>emb|CDY19035.1| BnaC01g20330D [Brassica napus]
Length=392

 Score =   416 bits (1069),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            GGGSSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPLI
Sbjct  2    GGGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             T  YEDVIACDVINPDHIDVEF SIGGLEAIK+ALYELVILPL+RPELF++GKLLGPQK
Sbjct  62   HTTPYEDVIACDVINPDHIDVEFGSIGGLEAIKEALYELVILPLKRPELFAYGKLLGPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLV+AVFSLAYKLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVSAVFSLAYKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IIFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  220



>ref|NP_194498.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 emb|CAB38280.1| putative protein [Arabidopsis thaliana]
 emb|CAB81418.1| putative protein [Arabidopsis thaliana]
 gb|AAM13062.1| putative protein [Arabidopsis thaliana]
 gb|AAM62497.1| 26S proteasome regulatory particle chain RPT6-like protein [Arabidopsis 
thaliana]
 gb|AAN15445.1| putative protein [Arabidopsis thaliana]
 dbj|BAE98483.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85380.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=398

 Score =   416 bits (1069),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPL+Q
Sbjct  2    GGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLVQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLE IKQALYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFGSIGGLETIKQALYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLV+AVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVSAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEV+SFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVESFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>ref|XP_008234684.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Prunus mume]
Length=396

 Score =   416 bits (1068),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M G    ETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKA+E+KKEIAKRLGRP
Sbjct  1    MGGSSDRETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKAMEHKKEIAKRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            LI TN+YEDVIACDVINPDHI+VEF SIGGLE+IKQ+L+ELVILPL+RP+LFSHGKLLGP
Sbjct  61   LIHTNSYEDVIACDVINPDHIEVEFESIGGLESIKQSLFELVILPLRRPDLFSHGKLLGP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQ
Sbjct  121  QKGVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEALTNMKTEFMALWDGFTTD
Sbjct  181  PAIIFIDEVDSFLGQRRTTDHEALTNMKTEFMALWDGFTTD  221



>ref|XP_010438567.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Camelina sativa]
Length=399

 Score =   416 bits (1068),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 212/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKE++KRLGRPLIQ
Sbjct  2    GGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKELSKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINP+HIDVEF SIGGLEAIK +LYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPNHIDVEFGSIGGLEAIKHSLYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINVK+SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVKVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+S+DHEA++NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSSDHEAMSNMKTEFMALWDGFSTD  219



>ref|XP_009137686.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Brassica rapa]
Length=392

 Score =   415 bits (1067),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA+SCLVLF GL+HLDPNREASKKALE+KKEI+KRLGRPLI 
Sbjct  2    GGSSETKILQELILYAASAALSCLVLFAGLKHLDPNREASKKALEHKKEISKRLGRPLIH  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLE IKQ+LYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFGSIGGLETIKQSLYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>ref|XP_007218110.1| hypothetical protein PRUPE_ppa006767mg [Prunus persica]
 gb|EMJ19309.1| hypothetical protein PRUPE_ppa006767mg [Prunus persica]
Length=396

 Score =   416 bits (1068),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M G    ETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKA+E+KKEIAKRLGRP
Sbjct  1    MGGSSDRETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKAMEHKKEIAKRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            LI TN+YEDVIACDVINPDHI+VEF SIGGLE+IKQ+L+ELVILPL+RP+LFSHGKLLGP
Sbjct  61   LIHTNSYEDVIACDVINPDHIEVEFESIGGLESIKQSLFELVILPLRRPDLFSHGKLLGP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQ
Sbjct  121  QKGVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEALTNMKTEFMALWDGFTTD
Sbjct  181  PAIIFIDEVDSFLGQRRTTDHEALTNMKTEFMALWDGFTTD  221



>gb|KFK29291.1| hypothetical protein AALP_AA7G114300 [Arabis alpina]
Length=386

 Score =   415 bits (1066),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA+SCLVLF GL+HLDPNREASKKALE+KKEI+KRLGRPLI 
Sbjct  2    GGSSETKILQELILYAASAALSCLVLFAGLKHLDPNREASKKALEHKKEISKRLGRPLIH  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLE IK+ALYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFGSIGGLETIKEALYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>ref|XP_012081080.1| PREDICTED: ATPase family AAA domain-containing protein 1-B [Jatropha 
curcas]
 gb|KDP30316.1| hypothetical protein JCGZ_18153 [Jatropha curcas]
Length=394

 Score =   415 bits (1067),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 199/215 (93%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            SETK LQELVLYAASAA+SCLVLF GLRHLDPNREASKKALE KKEIAKRLGRPLIQTN 
Sbjct  3    SETKFLQELVLYAASAALSCLVLFAGLRHLDPNREASKKALEQKKEIAKRLGRPLIQTNP  62

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINP+ IDVEF+SIGGLE IKQALYELVILPL+RPELFSHGKLLGPQKGVLL
Sbjct  63   YEDVIACDVINPESIDVEFDSIGGLETIKQALYELVILPLRRPELFSHGKLLGPQKGVLL  122

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVF+LAYKLQPAIIFI
Sbjct  123  YGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFTLAYKLQPAIIFI  182

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQR+++DHEALTNMKTEFMALWDGFTTD
Sbjct  183  DEVDSFLGQRRTSDHEALTNMKTEFMALWDGFTTD  217



>ref|XP_008376772.1| PREDICTED: ATPase family AAA domain-containing protein 1-B [Malus 
domestica]
Length=394

 Score =   415 bits (1067),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M G G  ETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKA+E+KKEI+KRLGRP
Sbjct  1    MGGSGERETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKAMEHKKEISKRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            LI TN+YEDVIACDVINPDHI+VEF SIGGL+ IK ALYELVILPLQRP LFSHGKLLGP
Sbjct  61   LINTNSYEDVIACDVINPDHIEVEFGSIGGLDDIKDALYELVILPLQRPNLFSHGKLLGP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQ
Sbjct  121  QKGVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEALTNMKTEFMALWDGFTTD
Sbjct  181  PAIIFIDEVDSFLGQRRNTDHEALTNMKTEFMALWDGFTTD  221



>ref|XP_010520944.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Tarenaya hassleriana]
Length=399

 Score =   415 bits (1067),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            GG SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREA+KKALE+KKEIAKRLGRPLI
Sbjct  2    GGSSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREAAKKALEHKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
            QTN YEDVIACDVINPD IDVEF SIGGLE IKQALYELVILPL+RPELFSHGKLLGPQK
Sbjct  62   QTNPYEDVIACDVINPDDIDVEFGSIGGLETIKQALYELVILPLKRPELFSHGKLLGPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV AVFSLA KLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVTAVFSLASKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFTTD  220



>ref|XP_006413042.1| hypothetical protein EUTSA_v10025375mg [Eutrema salsugineum]
 gb|ESQ54495.1| hypothetical protein EUTSA_v10025375mg [Eutrema salsugineum]
Length=399

 Score =   415 bits (1066),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 209/218 (96%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPLI 
Sbjct  2    GGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLIH  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF SIGGLE IKQ+LYELVILPL+RPELF+ GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFGSIGGLETIKQSLYELVILPLKRPELFAFGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>ref|XP_009143884.1| PREDICTED: ATPase family AAA domain-containing protein 1 [Brassica 
rapa]
 ref|XP_009143891.1| PREDICTED: ATPase family AAA domain-containing protein 1 [Brassica 
rapa]
 emb|CDY55344.1| BnaAnng13810D [Brassica napus]
 emb|CDY30236.1| BnaA03g49340D [Brassica napus]
Length=392

 Score =   414 bits (1065),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            GGGSSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPLI
Sbjct  2    GGGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             T  YEDVIACDVINPDHIDVEF SIGGLE IK+ALYELVILPL+RPELF++GKLLGPQK
Sbjct  62   HTTPYEDVIACDVINPDHIDVEFGSIGGLETIKEALYELVILPLKRPELFAYGKLLGPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLV+AVFSLAYKLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVSAVFSLAYKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IIFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  220



>ref|XP_010555747.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Tarenaya hassleriana]
Length=392

 Score =   413 bits (1061),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 210/218 (96%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREA+KKALE+ KEIAKRLGRPLIQ
Sbjct  2    GRSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREAAKKALEHNKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEF+ IGGLE+IKQ+LYELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFDLIGGLESIKQSLYELVILPLRRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES A+FINV++SNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAIFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVDSFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>gb|AFP55582.1| AAA domain-containing protein [Rosa rugosa]
Length=394

 Score =   413 bits (1061),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            ETK LQEL+LYAASAA+SCLVLFVGLRHLDPNREASKKA+E+KKEIAKRLGRPLI TN Y
Sbjct  6    ETKFLQELILYAASAAMSCLVLFVGLRHLDPNREASKKAMEHKKEIAKRLGRPLIHTNPY  65

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDVINPDHIDVEFNSIGGLEAIK+AL+ELVILPL+RP+LF+HGKLLGPQKGVLLY
Sbjct  66   EDVIACDVINPDHIDVEFNSIGGLEAIKEALFELVILPLKRPDLFNHGKLLGPQKGVLLY  125

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA+KLQPAIIFID
Sbjct  126  GPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAHKLQPAIIFID  185

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVDSFLGQR++T+HEALTNMKTEFMALWDGFTTD
Sbjct  186  EVDSFLGQRRTTEHEALTNMKTEFMALWDGFTTD  219



>gb|KCW89108.1| hypothetical protein EUGRSUZ_A01431 [Eucalyptus grandis]
Length=326

 Score =   410 bits (1054),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 210/215 (98%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            SE + L++LVLYAASAA+SCLV+F GLRHLDPNREASKKALE+KKEIAKRLGRPLIQTN 
Sbjct  4    SEARFLEKLVLYAASAALSCLVMFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQTNP  63

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPD+IDVEF+SIGGLEAIK+AL+ELVILPL+RP+LFSHGKLLGPQKGVLL
Sbjct  64   YEDVIACDVINPDNIDVEFDSIGGLEAIKEALFELVILPLRRPDLFSHGKLLGPQKGVLL  123

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI
Sbjct  124  YGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  183

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  184  DEVDSFLGQRKTTDHEALTNMKTEFMALWDGFTTD  218



>ref|XP_002869548.1| hypothetical protein ARALYDRAFT_492017 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45807.1| hypothetical protein ARALYDRAFT_492017 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   412 bits (1059),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G SSETKILQEL+LYAASAA SCLVLF GLRHLDPNREASKKALE+KKEI+KRLGRPL+Q
Sbjct  2    GRSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLVQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHI+VEF+SIGGLE IKQALYELVILPL+RPELF++GKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHINVEFDSIGGLETIKQALYELVILPLKRPELFAYGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLV+AVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVSAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEV+SFLGQR+STDHEA+ NMKTEFMALWDGF+TD
Sbjct  182  IFIDEVESFLGQRRSTDHEAMANMKTEFMALWDGFSTD  219



>ref|XP_010662912.1| PREDICTED: ATPase family AAA domain-containing protein 1-A-like 
[Vitis vinifera]
Length=388

 Score =   411 bits (1057),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            ET+ LQELVLYAASAA+SCLVLF GLRHLDPNRE+SKKALE++KEIAKRLGRPLIQTN+Y
Sbjct  3    ETRFLQELVLYAASAALSCLVLFAGLRHLDPNRESSKKALEHRKEIAKRLGRPLIQTNSY  62

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDVINPDHIDVEF+SIGGLE IKQAL ELVILPL+RPELFSHGKLLGPQKGVLLY
Sbjct  63   EDVIACDVINPDHIDVEFDSIGGLETIKQALVELVILPLRRPELFSHGKLLGPQKGVLLY  122

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID
Sbjct  123  GPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  182

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVD+FLGQR++TDHEA+ NMKTEFMALWDGFTTD
Sbjct  183  EVDTFLGQRRTTDHEAMANMKTEFMALWDGFTTD  216



>ref|XP_010048785.1| PREDICTED: ATPase family AAA domain-containing protein 1-B [Eucalyptus 
grandis]
 gb|KCW89107.1| hypothetical protein EUGRSUZ_A01431 [Eucalyptus grandis]
Length=390

 Score =   411 bits (1057),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 210/215 (98%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            SE + L++LVLYAASAA+SCLV+F GLRHLDPNREASKKALE+KKEIAKRLGRPLIQTN 
Sbjct  4    SEARFLEKLVLYAASAALSCLVMFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQTNP  63

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPD+IDVEF+SIGGLEAIK+AL+ELVILPL+RP+LFSHGKLLGPQKGVLL
Sbjct  64   YEDVIACDVINPDNIDVEFDSIGGLEAIKEALFELVILPLRRPDLFSHGKLLGPQKGVLL  123

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI
Sbjct  124  YGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  183

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  184  DEVDSFLGQRKTTDHEALTNMKTEFMALWDGFTTD  218



>gb|KCW89106.1| hypothetical protein EUGRSUZ_A01431 [Eucalyptus grandis]
Length=382

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 210/215 (98%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            SE + L++LVLYAASAA+SCLV+F GLRHLDPNREASKKALE+KKEIAKRLGRPLIQTN 
Sbjct  4    SEARFLEKLVLYAASAALSCLVMFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQTNP  63

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPD+IDVEF+SIGGLEAIK+AL+ELVILPL+RP+LFSHGKLLGPQKGVLL
Sbjct  64   YEDVIACDVINPDNIDVEFDSIGGLEAIKEALFELVILPLRRPDLFSHGKLLGPQKGVLL  123

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI
Sbjct  124  YGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  183

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  184  DEVDSFLGQRKTTDHEALTNMKTEFMALWDGFTTD  218



>ref|XP_010919328.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010919329.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X2 [Elaeis guineensis]
Length=386

 Score =   410 bits (1053),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 193/217 (89%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G+SET+ +QELVLYAASAA+SCLVLF GLR LDPNR ASKKALE KKEIAKRLGRP+IQT
Sbjct  2    GASETRFIQELVLYAASAALSCLVLFAGLRQLDPNRAASKKALEQKKEIAKRLGRPMIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF SIGGLE IKQAL+ELVILPL+RPELF+HGKLL PQKGV
Sbjct  62   NQYEDVIACDVINPDHIDVEFESIGGLENIKQALFELVILPLRRPELFAHGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVF+LAYKLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFTLAYKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            F+DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  182  FVDEVDSFLGQRRTTDHEALTNMKTEFMSLWDGFTTD  218



>ref|XP_010919330.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X3 [Elaeis guineensis]
Length=363

 Score =   409 bits (1051),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 193/217 (89%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G+SET+ +QELVLYAASAA+SCLVLF GLR LDPNR ASKKALE KKEIAKRLGRP+IQT
Sbjct  2    GASETRFIQELVLYAASAALSCLVLFAGLRQLDPNRAASKKALEQKKEIAKRLGRPMIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF SIGGLE IKQAL+ELVILPL+RPELF+HGKLL PQKGV
Sbjct  62   NQYEDVIACDVINPDHIDVEFESIGGLENIKQALFELVILPLRRPELFAHGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVF+LAYKLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFTLAYKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            F+DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  182  FVDEVDSFLGQRRTTDHEALTNMKTEFMSLWDGFTTD  218



>ref|XP_011075925.1| PREDICTED: LOW QUALITY PROTEIN: ATPase family AAA domain-containing 
protein 1 [Sesamum indicum]
Length=367

 Score =   409 bits (1051),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 195/217 (90%), Positives = 210/217 (97%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G SETK +QEL+LYAASAA+SCLVLFVGL+HLDPNR+ASKKALE+KKEIAKRLGRPLIQT
Sbjct  4    GRSETKFVQELILYAASAALSCLVLFVGLKHLDPNRDASKKALEHKKEIAKRLGRPLIQT  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDV+F+S+GGL+A+KQALYELVILPL+RPELFSHGKLL PQKGV
Sbjct  64   NPYEDVIACDVINPDHIDVKFDSVGGLDAVKQALYELVILPLRRPELFSHGKLLCPQKGV  123

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSK FGDAQKLV AVF+LAYKLQPAII
Sbjct  124  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKXFGDAQKLVTAVFTLAYKLQPAII  183

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  184  FIDEVDSFLGQRKTTDHEALTNMKTEFMALWDGFTTD  220



>ref|XP_008803940.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X3 [Phoenix dactylifera]
 ref|XP_008803941.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X3 [Phoenix dactylifera]
Length=363

 Score =   408 bits (1049),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 192/217 (88%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G+SET+ +QELVLYAASAA+SCLVLF GLR LDPNR ASKKALE KKEIAKRLGRP+IQT
Sbjct  2    GASETRFVQELVLYAASAALSCLVLFAGLRQLDPNRAASKKALEQKKEIAKRLGRPMIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF SIGGLE IKQAL+ELVILPL+RPELF+HGKLL PQKGV
Sbjct  62   NQYEDVIACDVINPDHIDVEFESIGGLENIKQALFELVILPLRRPELFAHGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVF+LAYKLQPAI+
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFTLAYKLQPAIV  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            F+DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  182  FVDEVDSFLGQRRTTDHEALTNMKTEFMSLWDGFTTD  218



>ref|XP_008803936.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008803937.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008803938.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008803939.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
isoform X2 [Phoenix dactylifera]
Length=386

 Score =   409 bits (1051),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 192/217 (88%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G+SET+ +QELVLYAASAA+SCLVLF GLR LDPNR ASKKALE KKEIAKRLGRP+IQT
Sbjct  2    GASETRFVQELVLYAASAALSCLVLFAGLRQLDPNRAASKKALEQKKEIAKRLGRPMIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF SIGGLE IKQAL+ELVILPL+RPELF+HGKLL PQKGV
Sbjct  62   NQYEDVIACDVINPDHIDVEFESIGGLENIKQALFELVILPLRRPELFAHGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVF+LAYKLQPAI+
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFTLAYKLQPAIV  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            F+DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  182  FVDEVDSFLGQRRTTDHEALTNMKTEFMSLWDGFTTD  218



>ref|XP_009382660.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009382661.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009382662.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009382663.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=388

 Score =   408 bits (1049),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 206/215 (96%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            SE++ LQELVLYAASAA+SCLVLF GLR LDPNR ASKKALENKKEIAKRLGRPL+QTN 
Sbjct  4    SESRFLQELVLYAASAALSCLVLFAGLRQLDPNRAASKKALENKKEIAKRLGRPLVQTNQ  63

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPDHIDVEF SIGGLE +KQAL+ELVILPL+RPELFSHGKLL PQKGVLL
Sbjct  64   YEDVIACDVINPDHIDVEFESIGGLEHVKQALFELVILPLRRPELFSHGKLLSPQKGVLL  123

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKA+AKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI
Sbjct  124  YGPPGTGKTMLAKALAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  183

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  184  DEVDSFLGQRRNTDHEAMTNMKTEFMSLWDGFTTD  218



>ref|XP_010933793.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Elaeis guineensis]
Length=387

 Score =   407 bits (1046),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 192/217 (88%), Positives = 206/217 (95%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G+SET+ +Q+LVLYAASAA+SCLVLF GLR LDPNR ASKKALE KKEIAKRLGRP+IQT
Sbjct  2    GASETRFIQQLVLYAASAALSCLVLFAGLRQLDPNRAASKKALEQKKEIAKRLGRPMIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF SIGGLE IKQAL+ELVILPL+RPELF+ GKLL PQKGV
Sbjct  62   NQYEDVIACDVINPDHIDVEFESIGGLENIKQALFELVILPLRRPELFAQGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            F+DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  182  FVDEVDSFLGQRRTTDHEALTNMKTEFMSLWDGFTTD  218



>ref|XP_008790557.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X3 [Phoenix dactylifera]
Length=364

 Score =   405 bits (1041),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 191/217 (88%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G+SET+ +QELVLYAASAA+SCLVLF GLR LDPNR ASKKALE KKEIAKRLGRP+IQT
Sbjct  2    GASETRFIQELVLYAASAALSCLVLFAGLRQLDPNRAASKKALEQKKEIAKRLGRPMIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINP+HIDVEF SIGGLE IK+AL+ELVILPL+RP+LF+HGKLL PQKGV
Sbjct  62   NQYEDVIACDVINPEHIDVEFESIGGLENIKEALFELVILPLRRPDLFTHGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            F+DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  182  FVDEVDSFLGQRRTTDHEALTNMKTEFMSLWDGFTTD  218



>ref|XP_008790555.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008790556.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X2 [Phoenix dactylifera]
Length=387

 Score =   406 bits (1043),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 191/217 (88%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G+SET+ +QELVLYAASAA+SCLVLF GLR LDPNR ASKKALE KKEIAKRLGRP+IQT
Sbjct  2    GASETRFIQELVLYAASAALSCLVLFAGLRQLDPNRAASKKALEQKKEIAKRLGRPMIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINP+HIDVEF SIGGLE IK+AL+ELVILPL+RP+LF+HGKLL PQKGV
Sbjct  62   NQYEDVIACDVINPEHIDVEFESIGGLENIKEALFELVILPLRRPDLFTHGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            F+DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  182  FVDEVDSFLGQRRTTDHEALTNMKTEFMSLWDGFTTD  218



>ref|XP_009351939.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Pyrus x bretschneideri]
Length=395

 Score =   406 bits (1043),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M G    ETK LQELVLYAASAA+S LVLFVGLR+LDPNRE SKKA+E+KKEIAKRLGRP
Sbjct  1    MGGSRERETKFLQELVLYAASAALSSLVLFVGLRYLDPNRETSKKAMEHKKEIAKRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            LI TNTYEDVIA DVINPDHI+VEF SIGGL+AIK+ALYELVILPL+RP+LFSHGKLLGP
Sbjct  61   LINTNTYEDVIAGDVINPDHIEVEFGSIGGLDAIKEALYELVILPLRRPDLFSHGKLLGP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIAKES AVFIN++ISNLMSKWFGDAQKLVAAVFSLAYKLQ
Sbjct  121  QKGVLLYGPPGTGKTMLAKAIAKESGAVFINLRISNLMSKWFGDAQKLVAAVFSLAYKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEALTNMKTEFMALWDGFTTD
Sbjct  181  PAIIFIDEVDSFLGQRRTTDHEALTNMKTEFMALWDGFTTD  221



>gb|EYU45294.1| hypothetical protein MIMGU_mgv1a008723mg [Erythranthe guttata]
Length=364

 Score =   405 bits (1040),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 211/218 (97%), Gaps = 1/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSS+T+ LQ+L+LYAASAA+SCLVLFVGLR LDPNR++SKKALE+KKEIAKRLGRPLIQ
Sbjct  3    GGSSDTR-LQDLILYAASAALSCLVLFVGLRQLDPNRDSSKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDV+ACDV+NPDHIDV+F+SIGGL+A+KQALYELVILPL+RPELFS GKLL PQKG
Sbjct  62   TNPYEDVVACDVVNPDHIDVKFDSIGGLDAVKQALYELVILPLRRPELFSRGKLLCPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINVK+SNLMSKWFGDAQKLV AVF+LAYKLQP+I
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVKVSNLMSKWFGDAQKLVTAVFTLAYKLQPSI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRKTTDHEALTNMKTEFMALWDGFTTD  219



>emb|CDP05016.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   405 bits (1041),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 194/216 (90%), Positives = 209/216 (97%), Gaps = 0/216 (0%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTN  242
            S+E K +Q+L+LYAASAA+SCLVLF GLR LDPNREASKKALE+KKEI+KRLGRPLIQTN
Sbjct  5    STEMKFVQDLILYAASAALSCLVLFTGLRLLDPNREASKKALEHKKEISKRLGRPLIQTN  64

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVL  422
             YEDVIACDVINP+HIDVEF+SIGGLEAIK+AL+ELVILPL+RPELF+ GKLLGPQKGVL
Sbjct  65   PYEDVIACDVINPNHIDVEFDSIGGLEAIKEALFELVILPLRRPELFARGKLLGPQKGVL  124

Query  423  LYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF  602
            LYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF
Sbjct  125  LYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF  184

Query  603  IDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IDEVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  185  IDEVDSFLGQRKTTDHEALTNMKTEFMALWDGFTTD  220



>ref|XP_009395395.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395396.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=388

 Score =   405 bits (1040),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 206/215 (96%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            +E++ LQELVLYAASAA+SCLVLF GLRHLDPNR A+KKALE+KKEIAKRLGRPL+QTN 
Sbjct  4    AESRFLQELVLYAASAALSCLVLFAGLRHLDPNRAATKKALEHKKEIAKRLGRPLVQTNQ  63

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPDHIDVEF SIGGLE +KQAL+ELVILPL RPELFSHGKLL PQKGVLL
Sbjct  64   YEDVIACDVINPDHIDVEFESIGGLEHVKQALFELVILPLSRPELFSHGKLLSPQKGVLL  123

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKA+AKES AVFINV+ISNLMSKWFGDAQKLVAAVF+LAYKLQPAIIFI
Sbjct  124  YGPPGTGKTMLAKALAKESGAVFINVRISNLMSKWFGDAQKLVAAVFTLAYKLQPAIIFI  183

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  184  DEVDSFLGQRRNTDHEAMTNMKTEFMSLWDGFTTD  218



>ref|XP_008437619.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Cucumis melo]
Length=392

 Score =   404 bits (1039),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G GSSET+ +QEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLI
Sbjct  2    GSGSSETRFVQELLLYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
            QTN YEDVIACDVINPDHIDVEFNSIGGLE+IKQAL ELVILPL+RPELFSHGKLLGPQK
Sbjct  62   QTNPYEDVIACDVINPDHIDVEFNSIGGLESIKQALIELVILPLKRPELFSHGKLLGPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRTTDHEAMTNMKTEFMALWDGFTTD  220



>ref|XP_011044702.1| PREDICTED: ATPase family AAA domain-containing protein 1-B [Populus 
euphratica]
Length=390

 Score =   404 bits (1039),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/217 (94%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GSSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLIQT
Sbjct  3    GSSETKFLQELLLYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQT  62

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF SIGGLE+IKQALYELVILPL+RPELFSHGKLLGPQKGV
Sbjct  63   NPYEDVIACDVINPDHIDVEFGSIGGLESIKQALYELVILPLRRPELFSHGKLLGPQKGV  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAII
Sbjct  123  LLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++TDHEALTNMKTEFMALWDGFTTD
Sbjct  183  FIDEVDSFLGQRRTTDHEALTNMKTEFMALWDGFTTD  219



>ref|XP_011084744.1| PREDICTED: ATPase family AAA domain-containing protein 1 [Sesamum 
indicum]
Length=403

 Score =   404 bits (1038),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            E K   ++ LYAASAA+SCLVLFVGL+HLDPNREA+KKA+E+KKEIAKRLGRPLIQTN Y
Sbjct  17   EHKNFGKIQLYAASAALSCLVLFVGLKHLDPNREAAKKAIEHKKEIAKRLGRPLIQTNPY  76

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDV+NPDHIDV+F+SIGGL+AIKQALYELVILPL+RPELF+HGKLLGPQKGVLLY
Sbjct  77   EDVIACDVVNPDHIDVKFDSIGGLDAIKQALYELVILPLRRPELFAHGKLLGPQKGVLLY  136

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID
Sbjct  137  GPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  196

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD
Sbjct  197  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  230



>ref|XP_009588602.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Nicotiana tomentosiformis]
Length=391

 Score =   403 bits (1035),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/217 (91%), Positives = 209/217 (96%), Gaps = 1/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GS ETK+LQELVLYAASAA+S LVLFVGLR LDPNR ASKKALE+KKEIAKRLGRPL+QT
Sbjct  4    GSWETKLLQELVLYAASAALSSLVLFVGLRQLDPNRHASKKALEHKKEIAKRLGRPLVQT  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YED+IACDVINPDHIDVEF+SIGGLE+IKQALYELVILPL+RPELFS GKLLGPQKGV
Sbjct  64   NPYEDIIACDVINPDHIDVEFDSIGGLESIKQALYELVILPLRRPELFS-GKLLGPQKGV  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINVKISNLMSKWFGDAQKLV+A+FSLAYKLQPAII
Sbjct  123  LLYGPPGTGKTMLAKAIAKESGAVFINVKISNLMSKWFGDAQKLVSALFSLAYKLQPAII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQRK+TD+EAL NMKTEFMALWDGFTTD
Sbjct  183  FIDEVDSFLGQRKATDNEALANMKTEFMALWDGFTTD  219



>gb|EYU19675.1| hypothetical protein MIMGU_mgv1a008066mg [Erythranthe guttata]
Length=386

 Score =   402 bits (1034),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 186/217 (86%), Positives = 210/217 (97%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GS ETK++QEL+LYAASAA+SCLV+FVGL+ LDPNR+A+KKALE+KKEIAKRLGRPL+QT
Sbjct  4    GSGETKLVQELILYAASAALSCLVMFVGLKQLDPNRDAAKKALEHKKEIAKRLGRPLVQT  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N+YED++ACDV+NPDHIDV F++IGGL+ IK+ALYELVILPLQRPELFS GKLLGPQKGV
Sbjct  64   NSYEDIVACDVVNPDHIDVRFDTIGGLDGIKEALYELVILPLQRPELFSRGKLLGPQKGV  123

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+++NLMSKWFGDAQKLV+AVF+LA KLQPAII
Sbjct  124  LLYGPPGTGKTMLAKAIAKESGAVFINVRVANLMSKWFGDAQKLVSAVFTLAQKLQPAII  183

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQRKSTDHEALTNMKTEFM+LWDGFTTD
Sbjct  184  FIDEVDSFLGQRKSTDHEALTNMKTEFMSLWDGFTTD  220



>ref|XP_002321379.1| MSP1 family protein [Populus trichocarpa]
 gb|EEF05506.1| MSP1 family protein [Populus trichocarpa]
Length=390

 Score =   402 bits (1034),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/217 (94%), Positives = 211/217 (97%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GSSETK LQEL+LYAASAA+SCLVLF GLR LDPNREASKKALE+KKEIAKRLGRPLIQT
Sbjct  3    GSSETKFLQELLLYAASAALSCLVLFAGLRQLDPNREASKKALEHKKEIAKRLGRPLIQT  62

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF SIGGLEAIKQALYELVILPL+RPELFSHGKLLGPQKGV
Sbjct  63   NPYEDVIACDVINPDHIDVEFGSIGGLEAIKQALYELVILPLRRPELFSHGKLLGPQKGV  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAII
Sbjct  123  LLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++TDHEALTNMKTEFMALWDGFTTD
Sbjct  183  FIDEVDSFLGQRRTTDHEALTNMKTEFMALWDGFTTD  219



>ref|XP_007161509.1| hypothetical protein PHAVU_001G075200g [Phaseolus vulgaris]
 gb|ESW33503.1| hypothetical protein PHAVU_001G075200g [Phaseolus vulgaris]
Length=392

 Score =   402 bits (1034),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G  SE+K++QELVLYAASAA+SCLVLFVGLR LDPNREASKKAL +KKEIAKRLGRPL+ 
Sbjct  2    GRLSESKLVQELVLYAASAALSCLVLFVGLRQLDPNREASKKALHHKKEIAKRLGRPLVN  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHI VEFNSIGGL+  KQALYELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIHVEFNSIGGLKTTKQALYELVILPLRRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV A+FSLA+KLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVTAIFSLAHKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR++TDHEAL NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRTTDHEALLNMKTEFMALWDGFTTD  219



>emb|CBI23057.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   412 bits (1060),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            ET+ LQELVLYAASAA+SCLVLF GLRHLDPNRE+SKKALE++KEIAKRLGRPLIQTN+Y
Sbjct  3    ETRFLQELVLYAASAALSCLVLFAGLRHLDPNRESSKKALEHRKEIAKRLGRPLIQTNSY  62

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDVINPDHIDVEF+SIGGLE IKQAL ELVILPL+RPELFSHGKLLGPQKGVLLY
Sbjct  63   EDVIACDVINPDHIDVEFDSIGGLETIKQALVELVILPLRRPELFSHGKLLGPQKGVLLY  122

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID
Sbjct  123  GPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  182

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVD+FLGQR++TDHEA+ NMKTEFMALWDGFTTD
Sbjct  183  EVDTFLGQRRTTDHEAMANMKTEFMALWDGFTTD  216



>ref|XP_006581002.1| PREDICTED: uncharacterized protein LOC100788677 isoform X4 [Glycine 
max]
Length=360

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSS+TK+LQ+L+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSDTKLLQDLLLYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHI+VEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHINVEFNSIGGLETIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKESRAVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESRAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+ TDHEA+ NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRGTDHEAMLNMKTEFMALWDGFTTD  219



>ref|NP_001242680.1| uncharacterized protein LOC100788677 [Glycine max]
 gb|ACU21282.1| unknown [Glycine max]
Length=363

 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSS+TK+LQ+L+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSDTKLLQDLLLYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHI+VEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHINVEFNSIGGLEPIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKESRAVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESRAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+ TDHEA+ NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRGTDHEAMLNMKTEFMALWDGFTTD  219



>ref|XP_003544721.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Glycine max]
 gb|KHN30405.1| ATPase family AAA domain-containing protein 1 [Glycine soja]
Length=390

 Score =   400 bits (1028),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 191/218 (88%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G  +E+K++QELVLYAASAA+SCLVLFVGLR LDPNREASKKA ++KKEIAKRLGRPL+Q
Sbjct  2    GRLAESKLVQELVLYAASAALSCLVLFVGLRQLDPNREASKKAFQHKKEIAKRLGRPLVQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPD+IDVEFNSIGGLE IK AL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDNIDVEFNSIGGLETIKLALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV A+FSLA+KLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVTAIFSLAHKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR++TDHEAL NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRTTDHEALLNMKTEFMALWDGFTTD  219



>ref|XP_006580999.1| PREDICTED: uncharacterized protein LOC100788677 isoform X1 [Glycine 
max]
 gb|KHN23330.1| ATPase family AAA domain-containing protein 1-A [Glycine soja]
Length=392

 Score =   400 bits (1028),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSS+TK+LQ+L+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSDTKLLQDLLLYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHI+VEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHINVEFNSIGGLETIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKESRAVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESRAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+ TDHEA+ NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRGTDHEAMLNMKTEFMALWDGFTTD  219



>ref|XP_006581001.1| PREDICTED: uncharacterized protein LOC100788677 isoform X3 [Glycine 
max]
Length=367

 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSS+TK+LQ+L+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSDTKLLQDLLLYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHI+VEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHINVEFNSIGGLETIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKESRAVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESRAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+ TDHEA+ NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRGTDHEAMLNMKTEFMALWDGFTTD  219



>ref|XP_006581000.1| PREDICTED: uncharacterized protein LOC100788677 isoform X2 [Glycine 
max]
Length=370

 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSS+TK+LQ+L+LYAASAA+SCLVLF GLRHLDPNREASKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSDTKLLQDLLLYAASAALSCLVLFAGLRHLDPNREASKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHI+VEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHINVEFNSIGGLETIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKESRAVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESRAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+ TDHEA+ NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRGTDHEAMLNMKTEFMALWDGFTTD  219



>ref|NP_001242817.1| uncharacterized protein LOC100796908 [Glycine max]
 gb|ACU17813.1| unknown [Glycine max]
Length=392

 Score =   400 bits (1027),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETK++Q+L+LYAASAA+SCLVLF GLRHLDPNRE+SKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSETKLMQDLLLYAASAALSCLVLFAGLRHLDPNRESSKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACD+INPDHIDVEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDIINPDHIDVEFNSIGGLETIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR++TDHEAL NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRTTDHEALLNMKTEFMALWDGFTTD  219



>ref|XP_007136479.1| hypothetical protein PHAVU_009G048700g [Phaseolus vulgaris]
 gb|ESW08473.1| hypothetical protein PHAVU_009G048700g [Phaseolus vulgaris]
Length=363

 Score =   399 bits (1024),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETK LQ+L+LYAASAA+SCLVLF GLRHLDPNREASKK LE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSETKFLQDLLLYAASAALSCLVLFAGLRHLDPNREASKKVLEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFNSIGGLETIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR++TDHEAL NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRTTDHEALLNMKTEFMALWDGFTTD  219



>ref|XP_007136480.1| hypothetical protein PHAVU_009G048700g [Phaseolus vulgaris]
 gb|ESW08474.1| hypothetical protein PHAVU_009G048700g [Phaseolus vulgaris]
Length=392

 Score =   399 bits (1026),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETK LQ+L+LYAASAA+SCLVLF GLRHLDPNREASKK LE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSETKFLQDLLLYAASAALSCLVLFAGLRHLDPNREASKKVLEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFNSIGGLETIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR++TDHEAL NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRTTDHEALLNMKTEFMALWDGFTTD  219



>gb|KHN19528.1| ATPase family AAA domain-containing protein 1-A [Glycine soja]
Length=392

 Score =   397 bits (1021),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 212/218 (97%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GGSSETK++Q+L+LYAASAA+SCLVLF GLRHLDPNRE+SKKALE+KKEIAKRLGRPLIQ
Sbjct  2    GGSSETKLMQDLLLYAASAALSCLVLFAGLRHLDPNRESSKKALEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACD+INPDHIDVEFNSIGGLE IKQAL+ELVILPL+RP+LFSHGKLLGPQKG
Sbjct  62   TNPYEDVIACDIINPDHIDVEFNSIGGLETIKQALFELVILPLKRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+IS LMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISTLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR++TDHEAL NMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRTTDHEALLNMKTEFMALWDGFTTD  219



>ref|XP_006849184.1| PREDICTED: ATPase family AAA domain-containing protein 1 isoform 
X2 [Amborella trichopoda]
 gb|ERN10765.1| hypothetical protein AMTR_s00027p00200690 [Amborella trichopoda]
Length=365

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 190/217 (88%), Positives = 204/217 (94%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G S+ + LQ+LVLYAASAA+SCLVL  GLRHLDPN+ A KKALE KKEIAKRLGRPLIQT
Sbjct  2    GVSDARFLQDLVLYAASAALSCLVLVAGLRHLDPNKAAGKKALEQKKEIAKRLGRPLIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            + YEDVIACDVINPDHIDVEF+SIGGLE IKQALYELVILPL+RPELF+ GKLL PQKGV
Sbjct  62   SPYEDVIACDVINPDHIDVEFDSIGGLEHIKQALYELVILPLRRPELFACGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  182  FIDEVDSFLGQRRTTDHEAMTNMKTEFMALWDGFTTD  218



>ref|XP_011625168.1| PREDICTED: ATPase family AAA domain-containing protein 1 isoform 
X1 [Amborella trichopoda]
 ref|XP_011625169.1| PREDICTED: ATPase family AAA domain-containing protein 1 isoform 
X1 [Amborella trichopoda]
Length=387

 Score =   396 bits (1018),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/217 (88%), Positives = 204/217 (94%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G S+ + LQ+LVLYAASAA+SCLVL  GLRHLDPN+ A KKALE KKEIAKRLGRPLIQT
Sbjct  2    GVSDARFLQDLVLYAASAALSCLVLVAGLRHLDPNKAAGKKALEQKKEIAKRLGRPLIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            + YEDVIACDVINPDHIDVEF+SIGGLE IKQALYELVILPL+RPELF+ GKLL PQKGV
Sbjct  62   SPYEDVIACDVINPDHIDVEFDSIGGLEHIKQALYELVILPLRRPELFACGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  182  FIDEVDSFLGQRRTTDHEAMTNMKTEFMALWDGFTTD  218



>ref|XP_010671370.1| PREDICTED: ATPase family AAA domain-containing protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=391

 Score =   395 bits (1014),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 190/217 (88%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G S+TK LQELVLYAASAA SCLVLF GL+HLDPNRE+SKKALE KKEIAKRLGRPLI T
Sbjct  2    GLSDTKFLQELVLYAASAAFSCLVLFAGLKHLDPNRESSKKALELKKEIAKRLGRPLIHT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHI+ +F SIGGL++IKQAL ELVILPL+RPELFS+GKLLGPQKGV
Sbjct  62   NPYEDVIACDVINPDHIECKFESIGGLDSIKQALVELVILPLRRPELFSYGKLLGPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA KLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVSAVFSLANKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR+++DHEALTNMKTEFMALWDGFTTD
Sbjct  182  FIDEVDSFLGQRRNSDHEALTNMKTEFMALWDGFTTD  218



>gb|AFK49593.1| unknown [Lotus japonicus]
Length=374

 Score =   394 bits (1012),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = +3

Query  90   LVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACD  269
            ++LYAASAA+SCLVLFVGLR LDPNREASKKALE+KKEIAKRLGRPLIQTN YEDVIACD
Sbjct  1    MLLYAASAALSCLVLFVGLRQLDPNREASKKALEHKKEIAKRLGRPLIQTNPYEDVIACD  60

Query  270  VINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGK  449
            VINPDHIDVEF SIGGLE+IK+AL+ELVILPL+RP+LFSHGKLLGPQKGVLLYGPPGTGK
Sbjct  61   VINPDHIDVEFGSIGGLESIKEALFELVILPLKRPDLFSHGKLLGPQKGVLLYGPPGTGK  120

Query  450  TMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLG  629
            TMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAI FIDEVDSFLG
Sbjct  121  TMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAITFIDEVDSFLG  180

Query  630  QRKSTDHEALTNMKTEFMALWDGFTTD  710
            QR++TDHEAL NMKTEFMALWDGFTTD
Sbjct  181  QRRTTDHEALLNMKTEFMALWDGFTTD  207



>ref|XP_004502708.1| PREDICTED: ATPase family AAA domain-containing protein 1-A-like 
isoform X1 [Cicer arietinum]
Length=393

 Score =   394 bits (1011),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GSS+TK+LQ+ +LYAASAA+SCLVLF G ++LDPNRE SKKALE+KK IAKRLGRPLIQT
Sbjct  3    GSSDTKLLQDFLLYAASAALSCLVLFTGFQYLDPNRETSKKALEHKKAIAKRLGRPLIQT  62

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIA DVINPD IDVEF+SIGGLE+IK+AL+ELVILPL+RP+LFSHGKLLGPQKG 
Sbjct  63   NPYEDVIAGDVINPDQIDVEFDSIGGLESIKEALFELVILPLKRPDLFSHGKLLGPQKGA  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV AVFSLAYKLQPAII
Sbjct  123  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVCAVFSLAYKLQPAII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR+++DHEAL NMKTEFMALWDGFTTD
Sbjct  183  FIDEVDSFLGQRRTSDHEALLNMKTEFMALWDGFTTD  219



>ref|XP_004502711.1| PREDICTED: ATPase family AAA domain-containing protein 1-A-like 
isoform X4 [Cicer arietinum]
Length=361

 Score =   392 bits (1007),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GSS+TK+LQ+ +LYAASAA+SCLVLF G ++LDPNRE SKKALE+KK IAKRLGRPLIQT
Sbjct  3    GSSDTKLLQDFLLYAASAALSCLVLFTGFQYLDPNRETSKKALEHKKAIAKRLGRPLIQT  62

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIA DVINPD IDVEF+SIGGLE+IK+AL+ELVILPL+RP+LFSHGKLLGPQKG 
Sbjct  63   NPYEDVIAGDVINPDQIDVEFDSIGGLESIKEALFELVILPLKRPDLFSHGKLLGPQKGA  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV AVFSLAYKLQPAII
Sbjct  123  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVCAVFSLAYKLQPAII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR+++DHEAL NMKTEFMALWDGFTTD
Sbjct  183  FIDEVDSFLGQRRTSDHEALLNMKTEFMALWDGFTTD  219



>ref|XP_004502710.1| PREDICTED: ATPase family AAA domain-containing protein 1-A-like 
isoform X3 [Cicer arietinum]
Length=364

 Score =   392 bits (1007),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GSS+TK+LQ+ +LYAASAA+SCLVLF G ++LDPNRE SKKALE+KK IAKRLGRPLIQT
Sbjct  3    GSSDTKLLQDFLLYAASAALSCLVLFTGFQYLDPNRETSKKALEHKKAIAKRLGRPLIQT  62

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIA DVINPD IDVEF+SIGGLE+IK+AL+ELVILPL+RP+LFSHGKLLGPQKG 
Sbjct  63   NPYEDVIAGDVINPDQIDVEFDSIGGLESIKEALFELVILPLKRPDLFSHGKLLGPQKGA  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV AVFSLAYKLQPAII
Sbjct  123  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVCAVFSLAYKLQPAII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR+++DHEAL NMKTEFMALWDGFTTD
Sbjct  183  FIDEVDSFLGQRRTSDHEALLNMKTEFMALWDGFTTD  219



>ref|NP_200166.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 dbj|BAB09730.1| 26S proteasome regulatory particle chain RPT6-like protein [Arabidopsis 
thaliana]
 gb|AAL24245.1| AT5g53540/MNC6_8 [Arabidopsis thaliana]
 gb|AAO11560.1| At5g53540/MNC6_8 [Arabidopsis thaliana]
 gb|AED96374.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=403

 Score =   391 bits (1004),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 207/220 (94%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            +  G  ++  +++L+LY ASAA+S LVL+VGLR LDPNR+A+KK+LE+K+EIAKRLGRPL
Sbjct  3    RSSGRKDSNFIEQLILYVASAALSSLVLYVGLRQLDPNRDAAKKSLEHKREIAKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            IQTN YEDVIACDVINP HIDVEF SIGGLE+IKQALYELVILPL+RPELF++GKLLGPQ
Sbjct  63   IQTNQYEDVIACDVINPLHIDVEFGSIGGLESIKQALYELVILPLKRPELFAYGKLLGPQ  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIA+ES AVFINVK+SNLMSKWFGDAQKLV+AVFSLAYKLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIARESEAVFINVKVSNLMSKWFGDAQKLVSAVFSLAYKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            AIIFIDEVDSFLGQR+STD+EA++NMKTEFMALWDGFTTD
Sbjct  183  AIIFIDEVDSFLGQRRSTDNEAMSNMKTEFMALWDGFTTD  222



>dbj|BAJ95139.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95696.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   390 bits (1003),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            S ++ +QELVLYAASAA+SCLVLF GLR LDPNRE+SKKAL+ KKEIAKRLGRPLI T  
Sbjct  6    SSSRFVQELVLYAASAALSCLVLFAGLRQLDPNRESSKKALQQKKEIAKRLGRPLISTTP  65

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPD IDVEF S+GGL+ +KQALYELVILPL+RPELF++GKLL PQKGVLL
Sbjct  66   YEDVIACDVINPDEIDVEFESVGGLDEVKQALYELVILPLRRPELFAYGKLLSPQKGVLL  125

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA KLQPAIIFI
Sbjct  126  YGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLANKLQPAIIFI  185

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  186  DEVDSFLGQRRNTDHEALTNMKTEFMSLWDGFTTD  220



>ref|NP_001058575.1| Os06g0714500 [Oryza sativa Japonica Group]
 dbj|BAD53565.1| putative spastin protein [Oryza sativa Japonica Group]
 dbj|BAF20489.1| Os06g0714500 [Oryza sativa Japonica Group]
 gb|EAZ02349.1| hypothetical protein OsI_24453 [Oryza sativa Indica Group]
 gb|EAZ38273.1| hypothetical protein OsJ_22651 [Oryza sativa Japonica Group]
 dbj|BAG94415.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   390 bits (1002),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTN  242
            S  ++ +QELVLYAASAA+SCLVLF GLR LDPNR AS+KAL++KKEIAKRLGRPL+ T 
Sbjct  4    SESSRFVQELVLYAASAALSCLVLFAGLRQLDPNRAASQKALQHKKEIAKRLGRPLVSTT  63

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVL  422
             YEDVIACDVINPDHIDVEF+SIGGL+ +KQALYELVILPL+RPELF+ GKLL PQKGVL
Sbjct  64   PYEDVIACDVINPDHIDVEFDSIGGLDHVKQALYELVILPLRRPELFTFGKLLSPQKGVL  123

Query  423  LYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF  602
            LYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA+KLQPAIIF
Sbjct  124  LYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAHKLQPAIIF  183

Query  603  IDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  184  IDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  219



>gb|EMS48070.1| ATPase family AAA domain-containing protein 1 [Triticum urartu]
Length=394

 Score =   389 bits (999),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            S ++ +QELVLYAASAA+SCLVLF GLR LDPNRE+SKKAL++KKEIAKRLGRPLI T  
Sbjct  6    SSSRFVQELVLYAASAALSCLVLFAGLRQLDPNRESSKKALQHKKEIAKRLGRPLISTTP  65

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPD IDVEF S+GGL+ +KQALYELVILPL+RPELF +GKLL PQKGVLL
Sbjct  66   YEDVIACDVINPDEIDVEFESVGGLDEVKQALYELVILPLRRPELFVYGKLLSPQKGVLL  125

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA KLQPAIIFI
Sbjct  126  YGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLANKLQPAIIFI  185

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  186  DEVDSFLGQRRNTDHEALTNMKTEFMSLWDGFTTD  220



>ref|XP_008643762.1| PREDICTED: ATPase family AAA domain-containing protein 1 isoform 
X1 [Zea mays]
 gb|ACN34987.1| unknown [Zea mays]
 gb|AFW69486.1| AAA domain-containing protein 1, ATPase family [Zea mays]
Length=391

 Score =   389 bits (998),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            + ++++QELVLYAASAA+SCLVLF GLRHLDPNR AS+KA + KKEIAKRLGRPL+ T  
Sbjct  6    ASSRLVQELVLYAASAALSCLVLFAGLRHLDPNRAASQKAQQQKKEIAKRLGRPLVSTTP  65

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPD IDVEF+SIGGL+ IKQALYELVILPL+RPELF+ GKLL PQKGVLL
Sbjct  66   YEDVIACDVINPDSIDVEFDSIGGLDQIKQALYELVILPLRRPELFTFGKLLSPQKGVLL  125

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAIIFI
Sbjct  126  YGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFI  185

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  186  DEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  220



>ref|NP_001150200.1| ATPase family AAA domain-containing protein 1 [Zea mays]
 gb|ACG38226.1| ATPase family AAA domain-containing protein 1 [Zea mays]
Length=364

 Score =   387 bits (995),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            + ++++QELVLYAASAA+SCLVLF GLRHLDPNR AS+KA + KKEIAKRLGRPL+ T  
Sbjct  6    ASSRLVQELVLYAASAALSCLVLFAGLRHLDPNRAASQKAQQQKKEIAKRLGRPLVSTTP  65

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIACDVINPD IDVEF+SIGGL+ IKQALYELVILPL+RPELF+ GKLL PQKGVLL
Sbjct  66   YEDVIACDVINPDSIDVEFDSIGGLDQIKQALYELVILPLRRPELFTFGKLLSPQKGVLL  125

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAIIFI
Sbjct  126  YGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFI  185

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  186  DEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  220



>ref|XP_006656486.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Oryza brachyantha]
Length=393

 Score =   388 bits (997),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTN  242
            S  ++ +QELVLYAASAA+SCLVLF GLR LDPNR AS+KAL++KKEIAKRLGRPL+ T 
Sbjct  4    SESSRFVQELVLYAASAALSCLVLFAGLRQLDPNRAASQKALQHKKEIAKRLGRPLVSTT  63

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVL  422
             YEDVIACDVINPDHIDVEF+ IGGL+ +KQALYELVILPL+RPELF+ GKLL PQKGVL
Sbjct  64   PYEDVIACDVINPDHIDVEFDCIGGLDHVKQALYELVILPLRRPELFTFGKLLSPQKGVL  123

Query  423  LYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF  602
            LYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA+KLQPAIIF
Sbjct  124  LYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAHKLQPAIIF  183

Query  603  IDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  184  IDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  219



>ref|XP_010442921.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Camelina sativa]
Length=380

 Score =   387 bits (995),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 207/220 (94%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            +  G  ++  +++L+LY ASAA+S LVL+VGLR +DPNR+A+KK+L++K+EIAKRLGRPL
Sbjct  3    RSSGRKDSNFVEQLILYVASAALSSLVLYVGLRAIDPNRDAAKKSLQHKREIAKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            IQTN YEDVIACDVINP HIDVEF SIGGLE++KQALYELVILPL+RPELF++GKLLGPQ
Sbjct  63   IQTNQYEDVIACDVINPLHIDVEFGSIGGLESMKQALYELVILPLKRPELFAYGKLLGPQ  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIA+ES AVFINVK+SNLMSKWFGDAQKLVAAVFSLAYKLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIARESEAVFINVKVSNLMSKWFGDAQKLVAAVFSLAYKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            AIIFIDEVDSFLGQR+STD+EA++NMKTEFMALWDGFTTD
Sbjct  183  AIIFIDEVDSFLGQRRSTDNEAMSNMKTEFMALWDGFTTD  222



>ref|XP_004966439.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Setaria italica]
Length=391

 Score =   387 bits (995),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 184/221 (83%), Positives = 203/221 (92%), Gaps = 1/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            MK   SS ++ +QELVLYAASAA SCLVLF GLRHLDPNR AS+KA + KKEIA+RLGRP
Sbjct  1    MKSSESS-SRFVQELVLYAASAAFSCLVLFAGLRHLDPNRAASQKAAQQKKEIARRLGRP  59

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            L+ T  YEDVIACDVINPD IDVEF+SIGGL+ +KQALYELVILPL+RPELF+ GKLL P
Sbjct  60   LVSTTPYEDVIACDVINPDSIDVEFDSIGGLDHVKQALYELVILPLRRPELFTFGKLLSP  119

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQ
Sbjct  120  QKGVLLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQ  179

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  180  PAIIFIDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  220



>ref|XP_004966440.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X2 [Setaria italica]
Length=364

 Score =   386 bits (992),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 184/221 (83%), Positives = 203/221 (92%), Gaps = 1/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            MK   SS ++ +QELVLYAASAA SCLVLF GLRHLDPNR AS+KA + KKEIA+RLGRP
Sbjct  1    MKSSESS-SRFVQELVLYAASAAFSCLVLFAGLRHLDPNRAASQKAAQQKKEIARRLGRP  59

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            L+ T  YEDVIACDVINPD IDVEF+SIGGL+ +KQALYELVILPL+RPELF+ GKLL P
Sbjct  60   LVSTTPYEDVIACDVINPDSIDVEFDSIGGLDHVKQALYELVILPLRRPELFTFGKLLSP  119

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQ
Sbjct  120  QKGVLLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQ  179

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  180  PAIIFIDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  220



>gb|EMT10747.1| ATPase family AAA domain-containing protein 1 [Aegilops tauschii]
Length=394

 Score =   387 bits (995),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 202/217 (93%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
             +  ++ +QELVLYAASAA+SCLVLF GLR LDPNRE+SKKAL++KKEIAKRLGRPLI T
Sbjct  3    STDSSRFVQELVLYAASAALSCLVLFAGLRQLDPNRESSKKALQHKKEIAKRLGRPLIST  62

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
              YEDVIACDVINPD IDVEF S+GGL+ +KQALYELVILPL+RPELF++GKLL PQKGV
Sbjct  63   TPYEDVIACDVINPDEIDVEFESVGGLDEVKQALYELVILPLRRPELFAYGKLLSPQKGV  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA KLQPAII
Sbjct  123  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLANKLQPAII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++TDHEALTNMKTEFM+LWDGFTTD
Sbjct  183  FIDEVDSFLGQRRNTDHEALTNMKTEFMSLWDGFTTD  219



>ref|NP_001141554.1| hypothetical protein [Zea mays]
 gb|ACF86611.1| unknown [Zea mays]
Length=260

 Score =   382 bits (981),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 202/219 (92%), Gaps = 2/219 (1%)
 Frame = +3

Query  60   GSSE--TKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            GSSE  ++ +Q LVLYAASAA+SCLVL  GLRHLDPNR AS+KA + KKEIAKRLGRPL+
Sbjct  2    GSSEPSSRSVQNLVLYAASAALSCLVLLAGLRHLDPNRAASQKAQQQKKEIAKRLGRPLV  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             T  YEDVIACDVINPD IDVEF+SIGGL+ +KQALYELVILPL+RPELF+ GKLL PQK
Sbjct  62   STTPYEDVIACDVINPDSIDVEFDSIGGLDKVKQALYELVILPLRRPELFASGKLLSPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA+KLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAHKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  220



>ref|XP_006280570.1| hypothetical protein CARUB_v10026523mg [Capsella rubella]
 gb|EOA13468.1| hypothetical protein CARUB_v10026523mg [Capsella rubella]
Length=402

 Score =   387 bits (995),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 207/220 (94%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            +  G  ++  +++L+LY ASAA+S LVL+VGLR +DPNR+A+KK+LE+K+EIAKRLGRPL
Sbjct  3    RSSGKKDSNFIEQLILYVASAALSSLVLYVGLRAIDPNRDAAKKSLEHKREIAKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            IQTN YEDVIACDVINP HIDVEF SIGGL+A+KQALYELVILPL+RPELF++GKLLGPQ
Sbjct  63   IQTNQYEDVIACDVINPLHIDVEFGSIGGLDAMKQALYELVILPLKRPELFAYGKLLGPQ  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIA+ES AVFINVK+SNLMSKWFGDAQKLVAAVFSLAYKLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIARESEAVFINVKVSNLMSKWFGDAQKLVAAVFSLAYKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            +IIFIDEVDSFLGQR+STD+EA++NMKTEFMALWDGFTTD
Sbjct  183  SIIFIDEVDSFLGQRRSTDNEAMSNMKTEFMALWDGFTTD  222



>ref|XP_002865978.1| hypothetical protein ARALYDRAFT_495431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42237.1| hypothetical protein ARALYDRAFT_495431 [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   387 bits (994),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 207/220 (94%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            +  G  ++  +++L+LY ASAA+S LVL+VGLR +DPNR+A+KK+LE+K+EIAKRLGRPL
Sbjct  3    RSSGKKDSNFIEQLILYVASAALSSLVLYVGLRAIDPNRDAAKKSLEHKREIAKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            IQTN YEDVIACDVINP HI+VEF SIGGLE+IKQALYELVILPL+RPELF++GKLLGPQ
Sbjct  63   IQTNQYEDVIACDVINPLHINVEFGSIGGLESIKQALYELVILPLKRPELFAYGKLLGPQ  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIA+ES AVFINVK+SNLMSKWFGDAQKLV+AVFSLAYKLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIARESEAVFINVKVSNLMSKWFGDAQKLVSAVFSLAYKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            AIIFIDEVDSFLGQR+STD+EA++NMKTEFMALWDGFTTD
Sbjct  183  AIIFIDEVDSFLGQRRSTDNEAMSNMKTEFMALWDGFTTD  222



>ref|XP_004502709.1| PREDICTED: ATPase family AAA domain-containing protein 1-A-like 
isoform X2 [Cicer arietinum]
Length=399

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 205/223 (92%), Gaps = 6/223 (3%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GSS+TK+LQ+ +LYAASAA+SCLVLF G ++LDPNRE SKKALE+KK IAKRLGRPLIQT
Sbjct  3    GSSDTKLLQDFLLYAASAALSCLVLFTGFQYLDPNRETSKKALEHKKAIAKRLGRPLIQT  62

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIA DVINPD IDVEF+SIGGLE+IK+AL+ELVILPL+RP+LFSHGKLLGPQKG 
Sbjct  63   NPYEDVIAGDVINPDQIDVEFDSIGGLESIKEALFELVILPLKRPDLFSHGKLLGPQKGA  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKL------VAAVFSLAYK  581
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKL      V AVFSLAYK
Sbjct  123  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLGNRVYIVCAVFSLAYK  182

Query  582  LQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            LQPAIIFIDEVDSFLGQR+++DHEAL NMKTEFMALWDGFTTD
Sbjct  183  LQPAIIFIDEVDSFLGQRRTSDHEALLNMKTEFMALWDGFTTD  225



>ref|XP_010227470.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Brachypodium distachyon]
Length=393

 Score =   386 bits (992),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYED  254
            + +QELVLYAASAA+SCLVLF GLR LDPNRE+SKKAL+ KKEIAKRLGRPL+QT  YED
Sbjct  8    RFVQELVLYAASAALSCLVLFAGLRQLDPNRESSKKALQQKKEIAKRLGRPLVQTTPYED  67

Query  255  VIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGP  434
            VIACDVINPD I+VEF+S+GGL+ +KQALYELVILPL+RPELF+ GKLL PQKGVLLYGP
Sbjct  68   VIACDVINPDEINVEFDSVGGLDEVKQALYELVILPLRRPELFAFGKLLSPQKGVLLYGP  127

Query  435  PGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEV  614
            PGTGKTMLAKAIAKES AVFIN+++SNLMSKWFGDAQKLVAAVFSLA+KLQPAIIFIDEV
Sbjct  128  PGTGKTMLAKAIAKESGAVFINLRVSNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFIDEV  187

Query  615  DSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  188  DSFLGQRRNTDHEAMTNMKTEFMSLWDGFTTD  219



>ref|XP_003563565.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X2 [Brachypodium distachyon]
Length=366

 Score =   385 bits (988),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYED  254
            + +QELVLYAASAA+SCLVLF GLR LDPNRE+SKKAL+ KKEIAKRLGRPL+QT  YED
Sbjct  8    RFVQELVLYAASAALSCLVLFAGLRQLDPNRESSKKALQQKKEIAKRLGRPLVQTTPYED  67

Query  255  VIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGP  434
            VIACDVINPD I+VEF+S+GGL+ +KQALYELVILPL+RPELF+ GKLL PQKGVLLYGP
Sbjct  68   VIACDVINPDEINVEFDSVGGLDEVKQALYELVILPLRRPELFAFGKLLSPQKGVLLYGP  127

Query  435  PGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEV  614
            PGTGKTMLAKAIAKES AVFIN+++SNLMSKWFGDAQKLVAAVFSLA+KLQPAIIFIDEV
Sbjct  128  PGTGKTMLAKAIAKESGAVFINLRVSNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFIDEV  187

Query  615  DSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  188  DSFLGQRRNTDHEAMTNMKTEFMSLWDGFTTD  219



>ref|XP_004307898.1| PREDICTED: ATPase family AAA domain-containing protein 1 [Fragaria 
vesca subsp. vesca]
Length=393

 Score =   385 bits (988),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G   ETK LQEL+LYAASAA+S L + VGLRHLDPNREASKKA+E+KKEIAKRLGRPLIQ
Sbjct  2    GSQRETKFLQELMLYAASAALSYLAIVVGLRHLDPNREASKKAMEHKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN YEDVIACDVINPDHIDVEFNSIGGLE IK+AL+ELVILPL+RP+LF+HGKLLGPQKG
Sbjct  62   TNPYEDVIACDVINPDHIDVEFNSIGGLEEIKEALFELVILPLKRPDLFNHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA+KLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAHKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR++T+HEALTNMKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRTTEHEALTNMKTEFMALWDGFTTD  219



>ref|XP_001766326.1| predicted protein [Physcomitrella patens]
 gb|EDQ68958.1| predicted protein [Physcomitrella patens]
Length=398

 Score =   385 bits (988),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G G+    + QEL LYA SAA+SCLVLFVGLRHLDPNR   KKA E KKEIAKRLGRPLI
Sbjct  2    GAGTRAASVGQELFLYAVSAAMSCLVLFVGLRHLDPNRAQIKKAQEQKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
            QTN+YED+IACDVINP+ IDV FNSIGGLE +KQ+L+ELVILPLQRP+LF+HGKLL PQK
Sbjct  62   QTNSYEDMIACDVINPEDIDVTFNSIGGLEYVKQSLHELVILPLQRPDLFAHGKLLRPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLL+GPPGTGKT+LAKAIAKESRAVFINV+ISNLMSKWFGDAQKLV AVF+LAYKLQP+
Sbjct  122  GVLLFGPPGTGKTLLAKAIAKESRAVFINVRISNLMSKWFGDAQKLVTAVFTLAYKLQPS  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR+ T+HEALTNMKTEFMALWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRVTEHEALTNMKTEFMALWDGFTTD  220



>ref|XP_010445896.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X1 [Camelina sativa]
 ref|XP_010445899.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X2 [Camelina sativa]
Length=398

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            ++  +++L+LY ASAA+S LVL+VGLR +DPNR+A+KK+L++K+EIAKRLGRPLIQTN Y
Sbjct  5    DSNFVEQLILYVASAALSSLVLYVGLRAIDPNRDAAKKSLQHKREIAKRLGRPLIQTNQY  64

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDVINP HIDVEF SIGGLE++KQALYELVILPL+RPELF++GKLLGPQKGVLLY
Sbjct  65   EDVIACDVINPLHIDVEFGSIGGLESMKQALYELVILPLKRPELFAYGKLLGPQKGVLLY  124

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIA+ES AVFINVK+SNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID
Sbjct  125  GPPGTGKTMLAKAIARESDAVFINVKVSNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  184

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVDSFLGQR+STD+EA++NMKTEFMALWDGFTTD
Sbjct  185  EVDSFLGQRRSTDNEAMSNMKTEFMALWDGFTTD  218



>ref|XP_008647557.1| PREDICTED: uncharacterized protein LOC100273669 isoform X1 [Zea 
mays]
 gb|ACR38449.1| unknown [Zea mays]
 gb|AFW75785.1| hypothetical protein ZEAMMB73_688286 [Zea mays]
Length=391

 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 202/219 (92%), Gaps = 2/219 (1%)
 Frame = +3

Query  60   GSSE--TKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            GSSE  ++ +Q LVLYAASAA+SCLVL  GLRHLDPNR AS+KA + KKEIAKRLGRPL+
Sbjct  2    GSSEPSSRSVQNLVLYAASAALSCLVLLAGLRHLDPNRAASQKAQQQKKEIAKRLGRPLV  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             T  YEDVIACDVINPD IDVEF+SIGGL+ +KQALYELVILPL+RPELF+ GKLL PQK
Sbjct  62   STTPYEDVIACDVINPDSIDVEFDSIGGLDKVKQALYELVILPLRRPELFASGKLLSPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA+KLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAHKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  220



>ref|XP_008647558.1| PREDICTED: uncharacterized protein LOC100273669 isoform X2 [Zea 
mays]
Length=364

 Score =   382 bits (981),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 202/219 (92%), Gaps = 2/219 (1%)
 Frame = +3

Query  60   GSSE--TKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            GSSE  ++ +Q LVLYAASAA+SCLVL  GLRHLDPNR AS+KA + KKEIAKRLGRPL+
Sbjct  2    GSSEPSSRSVQNLVLYAASAALSCLVLLAGLRHLDPNRAASQKAQQQKKEIAKRLGRPLV  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             T  YEDVIACDVINPD IDVEF+SIGGL+ +KQALYELVILPL+RPELF+ GKLL PQK
Sbjct  62   STTPYEDVIACDVINPDSIDVEFDSIGGLDKVKQALYELVILPLRRPELFASGKLLSPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLV+AVFSLA+KLQPA
Sbjct  122  GVLLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAHKLQPA  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  220



>gb|KFK26979.1| hypothetical protein AALP_AA8G318300 [Arabis alpina]
Length=402

 Score =   384 bits (985),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            +T +L++L+LY ASAA+S LVL+VG+R LDPNR+A+KKALE+K+E+AKRLGRPL++TN Y
Sbjct  9    DTTLLEQLILYVASAALSSLVLYVGIRQLDPNRDAAKKALEHKRELAKRLGRPLVKTNQY  68

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDVINP HIDVEF SIGGL++IK+ALYELVILPL+RPELF++GKLLGPQKGVLLY
Sbjct  69   EDVIACDVINPRHIDVEFGSIGGLDSIKEALYELVILPLKRPELFAYGKLLGPQKGVLLY  128

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLA+KLQPAIIFID
Sbjct  129  GPPGTGKTMLAKAIAKESEAVFINVQVSNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFID  188

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVDSFLGQR+STDHE + NMKTEFMALWDGF+TD
Sbjct  189  EVDSFLGQRRSTDHEGMANMKTEFMALWDGFSTD  222



>gb|ACJ86310.1| unknown [Medicago truncatula]
 gb|AFK35126.1| unknown [Medicago truncatula]
Length=284

 Score =   379 bits (973),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GG S+TK+LQ+L+LYAA AA+S  VL  GLR+LDPNRE+SKKALE KKEIAKRLGRPLIQ
Sbjct  2    GGFSDTKVLQDLLLYAARAALSYWVLVTGLRYLDPNRESSKKALEQKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN+YEDVIACDVINPDHIDVEF+SIGGLE IKQ L+ELVILPLQRP+LFSHGKLLGPQKG
Sbjct  62   TNSYEDVIACDVINPDHIDVEFDSIGGLETIKQTLFELVILPLQRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQP+I
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPSI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+S+DHEA+ NMKTEFMALWDGF TD
Sbjct  182  IFIDEVDSFLGQRRSSDHEAVLNMKTEFMALWDGFATD  219



>ref|XP_001757757.1| predicted protein [Physcomitrella patens]
 gb|EDQ77397.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   383 bits (983),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G G+    + QEL LYA SAA+SCLVLFVGLRHLDPNR   KKA E KKEIAKRLGRPLI
Sbjct  2    GAGTRAASVGQELFLYAVSAALSCLVLFVGLRHLDPNRAQIKKAQEQKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
            QTN+YED+IACDVINP+ IDV FNSIGGLE +KQ+L+ELVILPLQRP+LFSHGKLL PQK
Sbjct  62   QTNSYEDMIACDVINPEDIDVTFNSIGGLEYVKQSLHELVILPLQRPDLFSHGKLLRPQK  121

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLL+GPPGTGKT+LAKAIAKES AVFINV+I+NLMSKWFGDAQKLV AVF+LAYKLQP+
Sbjct  122  GVLLFGPPGTGKTLLAKAIAKESSAVFINVRIANLMSKWFGDAQKLVTAVFTLAYKLQPS  181

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR+ T+HEALTNMKTEFMALWDGFTTD
Sbjct  182  IIFIDEVDSFLGQRRVTEHEALTNMKTEFMALWDGFTTD  220



>ref|XP_003602312.1| ATPase family AAA domain-containing protein [Medicago truncatula]
 gb|AES72563.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=385

 Score =   381 bits (978),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GG S+TK+LQ+L+LYAA AA+S  VL  GLR+LDPNRE+SKKALE KKEIAKRLGRPLIQ
Sbjct  2    GGFSDTKVLQDLLLYAARAALSYWVLVTGLRYLDPNRESSKKALEQKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN+YEDVIACDVINPDHIDVEF+SIGGLE IKQ L+ELVILPLQRP+LFSHGKLLGPQKG
Sbjct  62   TNSYEDVIACDVINPDHIDVEFDSIGGLETIKQTLFELVILPLQRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQP+I
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPSI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+S+DHEA+ NMKTEFMALWDGF TD
Sbjct  182  IFIDEVDSFLGQRRSSDHEAVLNMKTEFMALWDGFATD  219



>ref|XP_006401692.1| hypothetical protein EUTSA_v10013746mg [Eutrema salsugineum]
 gb|ESQ43145.1| hypothetical protein EUTSA_v10013746mg [Eutrema salsugineum]
Length=395

 Score =   381 bits (979),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 202/217 (93%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G  +T  L++L+LY A AA++ L L+VGLR LDPNR+A+KKAL++K+E+AKRLGRPLIQT
Sbjct  6    GKKDTSFLEQLILYVAGAALTSLTLYVGLRQLDPNRDAAKKALKHKRELAKRLGRPLIQT  65

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINP +IDVEF SIGGLE+ KQALYELVILPL+RPELF++GKLLGPQKGV
Sbjct  66   NQYEDVIACDVINPQNIDVEFGSIGGLESTKQALYELVILPLKRPELFAYGKLLGPQKGV  125

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIA+ES AVFINVK+SNLMSKWFGDAQKLVAAVFSLA+KLQPAII
Sbjct  126  LLYGPPGTGKTMLAKAIARESEAVFINVKVSNLMSKWFGDAQKLVAAVFSLAHKLQPAII  185

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR+STD+EA+ NMKTEFMALWDGFTTD
Sbjct  186  FIDEVDSFLGQRRSTDNEAMGNMKTEFMALWDGFTTD  222



>ref|XP_003602313.1| ATPase family AAA domain-containing protein [Medicago truncatula]
 gb|AES72564.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=334

 Score =   378 bits (970),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            GG S+TK+LQ+L+LYAA AA+S  VL  GLR+LDPNRE+SKKALE KKEIAKRLGRPLIQ
Sbjct  2    GGFSDTKVLQDLLLYAARAALSYWVLVTGLRYLDPNRESSKKALEQKKEIAKRLGRPLIQ  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            TN+YEDVIACDVINPDHIDVEF+SIGGLE IKQ L+ELVILPLQRP+LFSHGKLLGPQKG
Sbjct  62   TNSYEDVIACDVINPDHIDVEFDSIGGLETIKQTLFELVILPLQRPDLFSHGKLLGPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQP+I
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPSI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+S+DHEA+ NMKTEFMALWDGF TD
Sbjct  182  IFIDEVDSFLGQRRSSDHEAVLNMKTEFMALWDGFATD  219



>ref|XP_002986862.1| hypothetical protein SELMODRAFT_182690 [Selaginella moellendorffii]
 gb|EFJ11944.1| hypothetical protein SELMODRAFT_182690 [Selaginella moellendorffii]
Length=385

 Score =   379 bits (974),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G  +T + QEL LYA SAA+SCLVLFVG+RHLDPNR  +KKA E KKEIAKRLGR L+QT
Sbjct  2    GGRDTSLGQELFLYAVSAALSCLVLFVGVRHLDPNRYQAKKAAERKKEIAKRLGRSLVQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N+YED+IACDVINP+ IDV F+SIGGLE +K +L+ELVILPLQRPELF+HGKLLGPQKGV
Sbjct  62   NSYEDMIACDVINPEDIDVTFDSIGGLEDVKSSLFELVILPLQRPELFAHGKLLGPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKT+LAKAIAKESRAVFINV+I+ LMSKWFGDAQKLV AVFSLAYKLQP+II
Sbjct  122  LLYGPPGTGKTLLAKAIAKESRAVFINVRIATLMSKWFGDAQKLVTAVFSLAYKLQPSII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++T+HE++T+MKTEFMALWDGFTTD
Sbjct  182  FIDEVDSFLGQRRATEHESMTHMKTEFMALWDGFTTD  218



>ref|XP_009761417.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Nicotiana sylvestris]
Length=391

 Score =   379 bits (974),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 197/217 (91%), Positives = 212/217 (98%), Gaps = 1/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GSSETK+LQEL+LYAASAA+S LVLFVGLR LDPNR ASKKALE+KKEIAKRLGRPL+QT
Sbjct  4    GSSETKLLQELLLYAASAALSSLVLFVGLRQLDPNRHASKKALEHKKEIAKRLGRPLVQT  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N+YED+IACDVINPDHIDV+F+SIGGLE+IKQALYELVILPL+RPELFS GKLLGPQKGV
Sbjct  64   NSYEDIIACDVINPDHIDVKFDSIGGLESIKQALYELVILPLRRPELFS-GKLLGPQKGV  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINVKISNLMSKWFGDAQKLV+A+FSLAYKLQPAII
Sbjct  123  LLYGPPGTGKTMLAKAIAKESGAVFINVKISNLMSKWFGDAQKLVSALFSLAYKLQPAII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQRK+TD+EALTNMKTEFMALWDGFTTD
Sbjct  183  FIDEVDSFLGQRKATDNEALTNMKTEFMALWDGFTTD  219



>ref|XP_002990044.1| hypothetical protein SELMODRAFT_130943 [Selaginella moellendorffii]
 gb|EFJ08867.1| hypothetical protein SELMODRAFT_130943 [Selaginella moellendorffii]
Length=403

 Score =   379 bits (973),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G  +T + QEL LYA SAA+SCLVLFVG+RHLDPNR  +KKA E KKEIAKRLGR L+QT
Sbjct  2    GGRDTSLGQELFLYAVSAALSCLVLFVGVRHLDPNRYQAKKAAERKKEIAKRLGRSLVQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N+YED+IACDVINP+ IDV F+SIGGLE +K +L+ELVILPLQRPELF+HGKLLGPQKGV
Sbjct  62   NSYEDMIACDVINPEDIDVTFDSIGGLEDVKSSLFELVILPLQRPELFAHGKLLGPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKT+LAKAIAKESRAVFINV+I+ LMSKWFGDAQKLV AVFSLAYKLQP+II
Sbjct  122  LLYGPPGTGKTLLAKAIAKESRAVFINVRIATLMSKWFGDAQKLVTAVFSLAYKLQPSII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++T+HE++T+MKTEFMALWDGFTTD
Sbjct  182  FIDEVDSFLGQRRATEHESMTHMKTEFMALWDGFTTD  218



>ref|XP_004502707.1| PREDICTED: LOW QUALITY PROTEIN: ATPase family AAA domain-containing 
protein 1-like [Cicer arietinum]
Length=391

 Score =   374 bits (961),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G S+TK LQEL+L+AA AA+S  VL  GLR+LDPNR+AS+KAL+ KKEIAKRLGRPLIQT
Sbjct  2    GLSDTKFLQELLLHAARAALSYWVLVTGLRYLDPNRKASQKALKQKKEIAKRLGRPLIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF+SIGGLE IKQ L ELVILPL+RP+LFSHGKLLGPQKGV
Sbjct  62   NPYEDVIACDVINPDHIDVEFDSIGGLETIKQTLIELVILPLKRPDLFSHGKLLGPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLAYKLQPAII
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAYKLQPAII  181

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR+S+DHEA+ NMKTEFMALWDGFTTD
Sbjct  182  FIDEVDSFLGQRRSSDHEAMLNMKTEFMALWDGFTTD  218



>ref|XP_010273365.1| PREDICTED: ATPase family AAA domain-containing protein 1 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010273370.1| PREDICTED: ATPase family AAA domain-containing protein 1 isoform 
X1 [Nelumbo nucifera]
Length=385

 Score =   374 bits (960),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 205/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G SET+  QEL LYAASAA+SCLVLFVGLR LDPNR ASKKA E+KKEI++RLGRPLIQT
Sbjct  2    GRSETRFFQELALYAASAALSCLVLFVGLRQLDPNRAASKKAQEHKKEISRRLGRPLIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF+SIGGLE IK++L+ELVILPL+RP+LFS GKLL PQKGV
Sbjct  62   NPYEDVIACDVINPDHIDVEFDSIGGLEDIKKSLFELVILPLRRPDLFS-GKLLRPQKGV  120

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAII
Sbjct  121  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  180

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  181  FIDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  217



>ref|XP_010273377.1| PREDICTED: ATPase family AAA domain-containing protein 1 isoform 
X2 [Nelumbo nucifera]
Length=365

 Score =   373 bits (958),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 205/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G SET+  QEL LYAASAA+SCLVLFVGLR LDPNR ASKKA E+KKEI++RLGRPLIQT
Sbjct  2    GRSETRFFQELALYAASAALSCLVLFVGLRQLDPNRAASKKAQEHKKEISRRLGRPLIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF+SIGGLE IK++L+ELVILPL+RP+LFS GKLL PQKGV
Sbjct  62   NPYEDVIACDVINPDHIDVEFDSIGGLEDIKKSLFELVILPLRRPDLFS-GKLLRPQKGV  120

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAII
Sbjct  121  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  180

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR++TDHEA+TNMKTEFM+LWDGFTTD
Sbjct  181  FIDEVDSFLGQRRTTDHEAMTNMKTEFMSLWDGFTTD  217



>ref|XP_006343793.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Solanum tuberosum]
Length=359

 Score =   371 bits (953),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
             GSS  K++Q+L+LYAASAA+S  VLFVGLRHLDPNREASKKA+E++K ++KRLGR LI 
Sbjct  2    AGSSSGKLIQDLILYAASAALSMAVLFVGLRHLDPNREASKKAIESRKHLSKRLGRTLIY  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            T  YED+I  DV+NPDHIDVEF+SIGGL+ IK+ L++L ILPL+RPELF HGKLLGP KG
Sbjct  62   TTPYEDMITGDVVNPDHIDVEFDSIGGLDGIKETLFQLAILPLRRPELFCHGKLLGPMKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINVK+S LMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVKVSTLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+STD E LT+MKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRSTDTEMLTSMKTEFMALWDGFTTD  219



>gb|EPS62159.1| hypothetical protein M569_12633, partial [Genlisea aurea]
Length=311

 Score =   368 bits (945),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            E +  ++L+  AA+ A+SCLVL +G R LDPNRE++KKA E+KK+IAKRLGRPLIQTN+Y
Sbjct  1    EQRFSEKLIRLAANTAVSCLVLVIGFRFLDPNRESAKKAQEHKKQIAKRLGRPLIQTNSY  60

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDV NPD +DV F SIGGL+ IK+AL+ELVILPL+RPELFSHGKLLGPQKGVLLY
Sbjct  61   EDVIACDVANPDDLDVRFESIGGLDGIKEALFELVILPLKRPELFSHGKLLGPQKGVLLY  120

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES +VFINV++SNLMSKWFGDAQKLVAA+FSLAYKLQPAI+FID
Sbjct  121  GPPGTGKTMLAKAIAKESGSVFINVRLSNLMSKWFGDAQKLVAAIFSLAYKLQPAIVFID  180

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVD FLGQRKS+DHEA+ NMKTEFMALWDGFTTD
Sbjct  181  EVDGFLGQRKSSDHEAMANMKTEFMALWDGFTTD  214



>ref|XP_009119902.1| PREDICTED: ATPase family AAA domain-containing protein 1 [Brassica 
rapa]
Length=397

 Score =   370 bits (951),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            +     +T  L++L+LY A AA + L L+V  RH DPNR+A+ KAL++K+E++KRLGRPL
Sbjct  3    RSSAKRDTSFLEQLILYVAGAAFTSLSLYVCARHFDPNRDAATKALKHKRELSKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            IQTN YEDVIACDVINP +IDVEF+SIGGLE+IKQALYELVILPL+RPELF++GKLLGPQ
Sbjct  63   IQTNQYEDVIACDVINPQNIDVEFDSIGGLESIKQALYELVILPLKRPELFAYGKLLGPQ  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIAKES AVFINVK+SNLMSKWFGDAQKLVAAVFSLA KLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIAKESGAVFINVKVSNLMSKWFGDAQKLVAAVFSLAEKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            AIIFIDEVDSFLGQR++TD+EA+ NMKTEFMALWDGFTTD
Sbjct  183  AIIFIDEVDSFLGQRRATDNEAMANMKTEFMALWDGFTTD  222



>emb|CDY20251.1| BnaC09g29880D [Brassica napus]
Length=402

 Score =   370 bits (951),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            +     +T  L++L+LY A AA + L L+V  RH DPNR+A+ KAL++K+E++KRLGRPL
Sbjct  3    RSSAKRDTSFLEQLILYVAGAAFTSLSLYVCARHFDPNRDAATKALKHKRELSKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            IQTN YEDVIACDVINP +IDVEF+SIGGLE+IKQALYELVILPL+RPELF++GKLLGPQ
Sbjct  63   IQTNQYEDVIACDVINPQNIDVEFDSIGGLESIKQALYELVILPLKRPELFAYGKLLGPQ  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIAKES AVFINVK+SNLMSKWFGDAQKLVAAVFSLA KLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIAKESGAVFINVKVSNLMSKWFGDAQKLVAAVFSLAEKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            AIIFIDEVDSFLGQR++TD+EA+ NMKTEFMALWDGFTTD
Sbjct  183  AIIFIDEVDSFLGQRRATDNEAMANMKTEFMALWDGFTTD  222



>emb|CDY14372.1| BnaA10g06830D [Brassica napus]
Length=397

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            +     +T  L++L+LY A AA + L L+V  RH DPNR+A+ KAL++K+E++KRLGRPL
Sbjct  3    RSSAKRDTSFLEQLILYVAGAAFTSLSLYVCARHFDPNRDAATKALKHKRELSKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            IQTN YEDVIACDVINP +IDVEF+SIGGLE+IKQALYELVILPL+RPELF++GKLLGPQ
Sbjct  63   IQTNQYEDVIACDVINPQNIDVEFDSIGGLESIKQALYELVILPLKRPELFAYGKLLGPQ  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLA KLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAEKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            AIIFIDEVDSFLGQR++TD+EA+ NMKTEFMALWDGFTTD
Sbjct  183  AIIFIDEVDSFLGQRRATDNEAMANMKTEFMALWDGFTTD  222



>ref|XP_004235000.1| PREDICTED: ATPase family AAA domain-containing protein 1-B [Solanum 
lycopersicum]
Length=377

 Score =   368 bits (944),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 187/192 (97%), Gaps = 1/192 (1%)
 Frame = +3

Query  135  FVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIG  314
            FVGLR LDPNR+ASKKALENKKE+AKRLGRP+IQTN+YEDVIACDVINPDHIDVEF+SIG
Sbjct  29   FVGLRQLDPNRQASKKALENKKELAKRLGRPIIQTNSYEDVIACDVINPDHIDVEFDSIG  88

Query  315  GLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVF  494
            GLE+IKQAL+ELVILPL+RPELF +GKLLGPQKGVLLYGPPGTGKTMLAKAIAKES AVF
Sbjct  89   GLESIKQALFELVILPLKRPELF-YGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESSAVF  147

Query  495  INVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKT  674
            INV+ SNLMSKWFGDAQKLVAAVFSLA+KLQPAIIFIDEVDSFLGQRKSTD+EA TNMKT
Sbjct  148  INVRTSNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFIDEVDSFLGQRKSTDNEASTNMKT  207

Query  675  EFMALWDGFTTD  710
            EFMALWDGFTTD
Sbjct  208  EFMALWDGFTTD  219



>ref|XP_006350497.1| PREDICTED: LOW QUALITY PROTEIN: ATPase family AAA domain-containing 
protein 1-B-like [Solanum tuberosum]
Length=381

 Score =   367 bits (942),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 187/192 (97%), Gaps = 1/192 (1%)
 Frame = +3

Query  135  FVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIG  314
            FVGLR LDPNR+ASKKALE+KKE+AKRLGRP+IQTN+YEDVIACDVINPDHIDVEF+SIG
Sbjct  30   FVGLRQLDPNRQASKKALEHKKELAKRLGRPIIQTNSYEDVIACDVINPDHIDVEFDSIG  89

Query  315  GLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVF  494
            GLE+IKQAL+ELVILPL+RPELF HGKLLGPQKGVLLYGPPGTGKTMLAKAIAKES AVF
Sbjct  90   GLESIKQALFELVILPLRRPELF-HGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESSAVF  148

Query  495  INVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKT  674
            INV+ SNLMSKWFGDAQKLVAAVFSLA+KLQPAIIFIDEVDSFLGQRKSTD+EA TNMKT
Sbjct  149  INVRTSNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFIDEVDSFLGQRKSTDNEASTNMKT  208

Query  675  EFMALWDGFTTD  710
            EFMALWDGFTTD
Sbjct  209  EFMALWDGFTTD  220



>gb|KJB52362.1| hypothetical protein B456_008G257900 [Gossypium raimondii]
Length=355

 Score =   365 bits (937),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 199/221 (90%), Gaps = 1/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M  G  S+  +LQ+L+LYAAS A SCLVL  GL+ L+PNR+ASKK++ NK  I+KRLGRP
Sbjct  1    MAPGRRSDRSLLQDLLLYAASIAFSCLVL-AGLKQLNPNRDASKKSIANKNAISKRLGRP  59

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            LI T+ YEDVI  DV+NPDHIDVEF+S+GGL+ IK+ALYELVILPL+RPELF++GKLLGP
Sbjct  60   LIHTDPYEDVIVGDVVNPDHIDVEFDSVGGLDRIKKALYELVILPLKRPELFAYGKLLGP  119

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQ
Sbjct  120  QKGVLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQ  179

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEA+  MKTEFMALWDGFTTD
Sbjct  180  PAIIFIDEVDSFLGQRRATDHEAMAIMKTEFMALWDGFTTD  220



>gb|KEH35474.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=358

 Score =   365 bits (938),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTN  242
            +SE+K + +L+L AASAA SCL+L+ G  +LDPNR++SKKALE+KK IA RLGRPLI+TN
Sbjct  7    ASESKFVTDLILLAASAAFSCLILYTGYSYLDPNRQSSKKALEHKKAIANRLGRPLIKTN  66

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVL  422
             YEDVIA DVINPDHIDVEF+SIGGLE IK+AL+EL ILPL+R ELF+HGKLLGPQKGVL
Sbjct  67   QYEDVIAGDVINPDHIDVEFDSIGGLETIKEALFELAILPLKRSELFTHGKLLGPQKGVL  126

Query  423  LYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF  602
            LYGPPGTGKTMLAKAIAKE  A FINV++SNLMS WFGDA KLVAA+FSLAYKLQPAIIF
Sbjct  127  LYGPPGTGKTMLAKAIAKECGAAFINVRMSNLMSMWFGDATKLVAAIFSLAYKLQPAIIF  186

Query  603  IDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IDEVDSFLGQR+S+DHEA  NMKTEFMALWDGF+TD
Sbjct  187  IDEVDSFLGQRRSSDHEASLNMKTEFMALWDGFSTD  222



>gb|AES72565.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=390

 Score =   366 bits (940),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTN  242
            +SE+K + +L+L AASAA SCL+L+ G  +LDPNR++SKKALE+KK IA RLGRPLI+TN
Sbjct  7    ASESKFVTDLILLAASAAFSCLILYTGYSYLDPNRQSSKKALEHKKAIANRLGRPLIKTN  66

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVL  422
             YEDVIA DVINPDHIDVEF+SIGGLE IK+AL+EL ILPL+R ELF+HGKLLGPQKGVL
Sbjct  67   QYEDVIAGDVINPDHIDVEFDSIGGLETIKEALFELAILPLKRSELFTHGKLLGPQKGVL  126

Query  423  LYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF  602
            LYGPPGTGKTMLAKAIAKE  A FINV++SNLMS WFGDA KLVAA+FSLAYKLQPAIIF
Sbjct  127  LYGPPGTGKTMLAKAIAKECGAAFINVRMSNLMSMWFGDATKLVAAIFSLAYKLQPAIIF  186

Query  603  IDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IDEVDSFLGQR+S+DHEA  NMKTEFMALWDGF+TD
Sbjct  187  IDEVDSFLGQRRSSDHEASLNMKTEFMALWDGFSTD  222



>gb|KJB52361.1| hypothetical protein B456_008G257900 [Gossypium raimondii]
Length=357

 Score =   365 bits (937),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 199/221 (90%), Gaps = 1/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M  G  S+  +LQ+L+LYAAS A SCLVL  GL+ L+PNR+ASKK++ NK  I+KRLGRP
Sbjct  1    MAPGRRSDRSLLQDLLLYAASIAFSCLVL-AGLKQLNPNRDASKKSIANKNAISKRLGRP  59

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            LI T+ YEDVI  DV+NPDHIDVEF+S+GGL+ IK+ALYELVILPL+RPELF++GKLLGP
Sbjct  60   LIHTDPYEDVIVGDVVNPDHIDVEFDSVGGLDRIKKALYELVILPLKRPELFAYGKLLGP  119

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
            QKGVLLYGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLAYKLQ
Sbjct  120  QKGVLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAYKLQ  179

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            PAIIFIDEVDSFLGQR++TDHEA+  MKTEFMALWDGFTTD
Sbjct  180  PAIIFIDEVDSFLGQRRATDHEAMAIMKTEFMALWDGFTTD  220



>ref|XP_004245465.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Solanum lycopersicum]
 ref|XP_010325327.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Solanum lycopersicum]
Length=359

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
             GSS  K++Q+L+L AASAA+S  V FVGLRHLDPNREASKKA+E++K ++KRLGR LI 
Sbjct  2    AGSSSGKLIQDLILCAASAALSMAVFFVGLRHLDPNREASKKAIESRKHLSKRLGRTLIY  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
            T  YED+I  DV+NPDHIDVEF+SIGGL+ IK+ L++L ILPL+RPELF HGKLLGP KG
Sbjct  62   TTPYEDMITGDVVNPDHIDVEFDSIGGLDGIKETLFQLAILPLRRPELFCHGKLLGPMKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKAIAKES AVFINVK+S LMSKWFGDAQKLVAAVFSLAYKLQPAI
Sbjct  122  VLLYGPPGTGKTMLAKAIAKESGAVFINVKVSTLMSKWFGDAQKLVAAVFSLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDSFLGQR+ST++E LT+MKTEFMALWDGFTTD
Sbjct  182  IFIDEVDSFLGQRRSTENEMLTSMKTEFMALWDGFTTD  219



>ref|XP_002515675.1| Protein MSP1, putative [Ricinus communis]
 gb|EEF46727.1| Protein MSP1, putative [Ricinus communis]
Length=387

 Score =   365 bits (937),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/217 (88%), Positives = 202/217 (93%), Gaps = 3/217 (1%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            GSSET  LQ+L LYAASAA+S LVL  GL+HLDPNRE SKK    KKEIAKRLGRPL+QT
Sbjct  2    GSSETTFLQKLALYAASAALSYLVLLAGLQHLDPNREVSKKK---KKEIAKRLGRPLVQT  58

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPD IDV+F+SIGGLE IKQALYELVILPL+RPELFSHGKLLGPQKGV
Sbjct  59   NPYEDVIACDVINPDQIDVKFDSIGGLETIKQALYELVILPLKRPELFSHGKLLGPQKGV  118

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPGTGKTMLAKAIA+ES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPAII
Sbjct  119  LLYGPPGTGKTMLAKAIARESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  178

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR+STDHEALTNMKTEFMALWDGFTTD
Sbjct  179  FIDEVDSFLGQRRSTDHEALTNMKTEFMALWDGFTTD  215



>ref|XP_007039413.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY23914.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=356

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            +ET  LQ+L+LYAASA++SCLVLF GL+HLD NRE+SKK++ENKK I+KRLGR  I TN 
Sbjct  7    TETTFLQDLLLYAASASLSCLVLFAGLKHLDLNRESSKKSIENKKAISKRLGRAFIHTNP  66

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDVIA DV+NPD I VEF S+GG + IK+ALYEL ILPL+RPELF++GKLLGP KGVLL
Sbjct  67   YEDVIAGDVVNPDDIKVEFQSVGGFDRIKEALYELAILPLRRPELFAYGKLLGPPKGVLL  126

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLV AVFSLAYKLQPAIIFI
Sbjct  127  YGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVTAVFSLAYKLQPAIIFI  186

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEV+SFLGQR++TD EA++ MKTEFMALWDGFTTD
Sbjct  187  DEVESFLGQRRATDQEAMSIMKTEFMALWDGFTTD  221



>gb|ADE77829.1| unknown [Picea sitchensis]
Length=388

 Score =   360 bits (924),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            +T   QEL+LYA SAA+SCLVL VGL+HLDPN+EA+KKA E KKEI+KR GRP + TN Y
Sbjct  5    QTSFAQELILYAISAAVSCLVLVVGLKHLDPNKEATKKAAERKKEISKRFGRPRVLTNPY  64

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDVINPD IDV F+SIGGLE +KQ LYELVILPLQRP LF H KLL P KGVLLY
Sbjct  65   EDVIACDVINPDDIDVTFDSIGGLEKVKQELYELVILPLQRPNLFGHCKLLSPPKGVLLY  124

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKT+LAKAIA+ES AVFINV+++NLMSKWFGD+QKLV AVF+LA KLQPAIIF+D
Sbjct  125  GPPGTGKTLLAKAIARESGAVFINVRVANLMSKWFGDSQKLVTAVFTLAQKLQPAIIFLD  184

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVDSFLGQR+S++ EA TNMKTEFMALWDGFTTD
Sbjct  185  EVDSFLGQRRSSEQEAFTNMKTEFMALWDGFTTD  218



>ref|XP_003602314.1| Spastin [Medicago truncatula]
Length=396

 Score =   360 bits (923),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 195/222 (88%), Gaps = 6/222 (3%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTN  242
            +SE+K + +L+L AASAA SCL+L+ G  +LDPNR++SKKALE+KK IA RLGRPLI+TN
Sbjct  7    ASESKFVTDLILLAASAAFSCLILYTGYSYLDPNRQSSKKALEHKKAIANRLGRPLIKTN  66

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVL  422
             YEDVIA DVINPDHIDVEF+SIGGLE IK+AL+EL ILPL+R ELF+HGKLLGPQKGVL
Sbjct  67   QYEDVIAGDVINPDHIDVEFDSIGGLETIKEALFELAILPLKRSELFTHGKLLGPQKGVL  126

Query  423  LYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKL------VAAVFSLAYKL  584
            LYGPPGTGKTMLAKAIAKE  A FINV++SNLMS WFGDA KL      VAA+FSLAYKL
Sbjct  127  LYGPPGTGKTMLAKAIAKECGAAFINVRMSNLMSMWFGDATKLAVRAHIVAAIFSLAYKL  186

Query  585  QPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            QPAIIFIDEVDSFLGQR+S+DHEA  NMKTEFMALWDGF+TD
Sbjct  187  QPAIIFIDEVDSFLGQRRSSDHEASLNMKTEFMALWDGFSTD  228



>ref|XP_007039158.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY23659.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=368

 Score =   358 bits (920),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 186/219 (85%), Gaps = 24/219 (11%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI  233
            G  SSETK LQEL+LYAASAA+SCLVLF GLRHLDPNREASKKALE KKEIAKRLGRPLI
Sbjct  2    GSSSSETKFLQELILYAASAALSCLVLFAGLRHLDPNREASKKALEQKKEIAKRLGRPLI  61

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQK  413
             TN YEDVIACDVINPDHIDVEF SIGGLE+IKQALYELVILPL+RPELF+H        
Sbjct  62   HTNPYEDVIACDVINPDHIDVEFESIGGLESIKQALYELVILPLRRPELFAH--------  113

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
                            KAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLAYKLQPA
Sbjct  114  ----------------KAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAYKLQPA  157

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IIFIDEVDSFLGQR++TDHEA+TNMKTEFMALWDGFTTD
Sbjct  158  IIFIDEVDSFLGQRRNTDHEAMTNMKTEFMALWDGFTTD  196



>ref|XP_009588539.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Nicotiana tomentosiformis]
Length=362

 Score =   358 bits (918),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            + G  ++TK++ ELVL AA+AA+  + +F GLRHLDPNREASK+ALE++K+++KRLGRPL
Sbjct  3    ESGTDAKTKLIVELVLSAATAALGMVFIFAGLRHLDPNREASKRALESRKQLSKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            I T  YED+IA DV+NPDHIDVEF+SIGGL+ IK  L++L ILPL+RPELF HGKLLGP 
Sbjct  63   IHTTPYEDMIAGDVVNPDHIDVEFDSIGGLDGIKDTLFQLAILPLRRPELFCHGKLLGPM  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIAKES AVFINVK+S LMSKWFGDAQKLVAA+F LAYKLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIAKESGAVFINVKVSTLMSKWFGDAQKLVAAIFGLAYKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            AIIFIDEVDSFLGQR++++ E LT+MKTEFMALWDGFTTD
Sbjct  183  AIIFIDEVDSFLGQRRASETEMLTSMKTEFMALWDGFTTD  222



>ref|XP_009787743.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Nicotiana sylvestris]
Length=362

 Score =   358 bits (918),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            + G  ++TK++ ELVL AA+AA+  + +F GLRHLDPNREASK+ALE++K+++KRLGRPL
Sbjct  3    ESGTDAKTKLIVELVLSAATAALGMVFIFAGLRHLDPNREASKRALESRKQLSKRLGRPL  62

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            I T  YED+IA DV+NPDHIDVEF+SIGGL+ IK  L++L ILPL+RPELF HGKLLGP 
Sbjct  63   IHTTPYEDMIAGDVVNPDHIDVEFDSIGGLDGIKDTLFQLAILPLRRPELFCHGKLLGPM  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKTMLAKAIAKES AVFINVK+S LMSKWFGDAQKLVAA+F LAYKLQP
Sbjct  123  KGVLLYGPPGTGKTMLAKAIAKESGAVFINVKVSTLMSKWFGDAQKLVAAIFGLAYKLQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            AIIFIDEVDSFLGQR++++ E LT+MKTEFMALWDGFTTD
Sbjct  183  AIIFIDEVDSFLGQRRASETEMLTSMKTEFMALWDGFTTD  222



>emb|CDY38752.1| BnaC03g14970D [Brassica napus]
Length=386

 Score =   348 bits (894),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            ++  L++L+LY A AA++ L L+V  RH DPNR+AS KAL+ K+EIAKRLGRPLIQTN Y
Sbjct  9    DSSFLEQLILYVAGAALASLSLYVCARHSDPNRDASDKALKRKREIAKRLGRPLIQTNQY  68

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIA DVIN   IDVEF+SIGGLE+ KQ+LYELVILPL+RPELF++GKLLGPQKGVLLY
Sbjct  69   EDVIAGDVINSRKIDVEFDSIGGLESKKQSLYELVILPLKRPELFAYGKLLGPQKGVLLY  128

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES AVFINV++SNLMSKWFGDAQKLVAAVFSLA KLQPAI+FID
Sbjct  129  GPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVAAVFSLAEKLQPAIVFID  188

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVDSFLGQR+ST +EA+  MKTEFMALWDG  TD
Sbjct  189  EVDSFLGQRRSTGNEAMAIMKTEFMALWDGVATD  222



>ref|XP_001416905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95198.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=408

 Score =   329 bits (844),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M    S +  +LQEL+L   SA +S +VL  GL+ LDPNR+ SK A+E KKE+A RLGRP
Sbjct  1    MSRAQSGQPSVLQELLLIGCSALLSMIVLNFGLKRLDPNRQTSKAAIERKKELASRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
             + TN YEDVIA DV NPDHIDV F+SIGGLE  KQ+LYELVILPL RPELF+ GKLL P
Sbjct  61   NLDTNVYEDVIAADVANPDHIDVRFDSIGGLEDTKQSLYELVILPLMRPELFARGKLLQP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPGTGKT+LAKA+AKESRA FINV+ S L SKWFGDAQKLV+AVF+LA+KLQ
Sbjct  121  AKGVLLYGPPGTGKTLLAKALAKESRACFINVRSSTLQSKWFGDAQKLVSAVFTLAWKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P+IIFIDE+DSFLG RKS +HEA + MKTEFM LWDGF TD
Sbjct  181  PSIIFIDEIDSFLGTRKSGEHEATSTMKTEFMTLWDGFNTD  221



>gb|EYU19674.1| hypothetical protein MIMGU_mgv1a009250mg [Erythranthe guttata]
Length=348

 Score =   327 bits (837),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            +  + LQEL+L AA+AA+S     + L+ LDPNR+A+K  +E +K IAKRLGRPL+QTN 
Sbjct  3    TNAECLQELLLCAAAAAVSYFGGSMLLKRLDPNRKAAKAGVEKRKAIAKRLGRPLVQTNC  62

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLL  425
            YEDV+ACDV+NPD IDV+F+SIGGL+  KQ LYELVILPL+RPELFS GKLLGPQ+GVLL
Sbjct  63   YEDVVACDVVNPDKIDVDFDSIGGLDGFKQELYELVILPLRRPELFSQGKLLGPQRGVLL  122

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPGTGKTMLAKAIAKES AVF N++ISNLM+KWFGDA+KLVAAVF+LA+KLQPAIIFI
Sbjct  123  YGPPGTGKTMLAKAIAKESGAVFFNLRISNLMAKWFGDAEKLVAAVFTLAHKLQPAIIFI  182

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            DEVDSFLGQRKS+DH  ++ MKTEF++LWDGF T+
Sbjct  183  DEVDSFLGQRKSSDHYVISMMKTEFLSLWDGFNTN  217



>emb|CDY47077.1| BnaA03g12210D [Brassica napus]
Length=389

 Score =   326 bits (835),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 183/217 (84%), Gaps = 3/217 (1%)
 Frame = +3

Query  69   ETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTY  248
            ++  L++L+LY A AA++ L L+   RH DPNREAS KAL+ K+E+AKRL RPLIQTN Y
Sbjct  9    DSSFLEQLILYVAGAALASLSLYFCARHSDPNREASDKALKRKRELAKRLDRPLIQTNQY  68

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIA DVIN   IDVEF+SIGGLE+ KQ+LYELVILPL+RPELF++GKLLGPQKGVLLY
Sbjct  69   EDVIAGDVINSRKIDVEFDSIGGLESKKQSLYELVILPLKRPELFAYGKLLGPQKGVLLY  128

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFG---DAQKLVAAVFSLAYKLQPAII  599
            GPPGTGKTMLAKAIAKES AVFINV++SNLMSKWF        LVAAVFSLA KLQPAI+
Sbjct  129  GPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFNVSCSVFSLVAAVFSLAEKLQPAIV  188

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FIDEVDSFLGQR+ST +EA+  MKTEFMALWDG  TD
Sbjct  189  FIDEVDSFLGQRRSTGNEAMAIMKTEFMALWDGVATD  225



>ref|XP_002985635.1| hypothetical protein SELMODRAFT_45400, partial [Selaginella moellendorffii]
 gb|EFJ13213.1| hypothetical protein SELMODRAFT_45400, partial [Selaginella moellendorffii]
Length=342

 Score =   322 bits (825),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   LQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVI  260
            L+++ LYA  AA+SCLV  +GLR++DP+R  +KKA   KKE++KRLGR L QTN YED+I
Sbjct  6    LEQVFLYAVYAAVSCLVQLIGLRYMDPHRIDTKKATACKKELSKRLGRDLKQTNMYEDII  65

Query  261  ACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPG  440
            A +V+NP  IDV F+SIGGLE +K +LYEL ILPLQRPELFS GKLL PQKGVLLYGPPG
Sbjct  66   AGNVVNPQGIDVTFSSIGGLEDVKDSLYELAILPLQRPELFSQGKLLRPQKGVLLYGPPG  125

Query  441  TGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDS  620
            TGKT+LAKA+AKE+RAVFINV+I++LMSKW GDAQKLV AVF+LA+KLQP+IIFIDEVDS
Sbjct  126  TGKTLLAKALAKEARAVFINVQIASLMSKWLGDAQKLVTAVFTLAHKLQPSIIFIDEVDS  185

Query  621  FLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FLG+R  T HE +T MKTEFMALWDG TTD
Sbjct  186  FLGRRGVTSHEVMTQMKTEFMALWDGLTTD  215



>ref|XP_007511046.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66606.1| predicted protein [Bathycoccus prasinos]
Length=419

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 176/220 (80%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            +GG +     LQE+   A SA  SCLVL  GL+ LDPNR+ SK A + KKEIAKRLGRP 
Sbjct  5    RGGPAEPPSFLQEVAFLAVSALFSCLVLSFGLKRLDPNRQTSKAAEQRKKEIAKRLGRPK  64

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            + TN YED IA DV NPDHI+V FNSIGGLE  K+AL ELVILPL RPELFS   LL P 
Sbjct  65   LVTNVYEDAIAADVANPDHINVTFNSIGGLEDTKEALQELVILPLVRPELFSKSNLLKPA  124

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPGTGKT+LAKA+AKES+A FINV+ S L SKWFGDAQKLV AVF+LA+KLQP
Sbjct  125  KGVLLYGPPGTGKTLLAKALAKESQACFINVRTSTLQSKWFGDAQKLVTAVFTLAWKLQP  184

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            +IIFIDE+DSFLG RK+++HEA+T MKTEFM LWDGF TD
Sbjct  185  SIIFIDEIDSFLGTRKNSEHEAVTQMKTEFMTLWDGFNTD  224



>emb|CEF97071.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=405

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 175/221 (79%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M      +  I QEL L   SA +S +VL  GL+ +DPNR+ SK A+E KKE+A RLGRP
Sbjct  1    MSRAQGGQPSIFQELFLVGCSAILSMIVLNFGLKRMDPNRQNSKAAIERKKELATRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
             + TN YEDVIA DV NPDHIDV FNSIGGLE  KQ+LYELVILPL RPELF+ GKLL P
Sbjct  61   NLDTNVYEDVIAMDVANPDHIDVTFNSIGGLEDTKQSLYELVILPLVRPELFARGKLLQP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPGTGKT+LAKA+AKES A FINV+ S L SKWFGDAQKLV+AVF+LA+KLQ
Sbjct  121  AKGVLLYGPPGTGKTLLAKALAKESGACFINVRSSTLQSKWFGDAQKLVSAVFTLAFKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P+IIFIDE+DSFLG RKS +HEA   MKTEFM LWDGF TD
Sbjct  181  PSIIFIDEIDSFLGTRKSGEHEATATMKTEFMTLWDGFNTD  221



>gb|ERM94739.1| hypothetical protein AMTR_s00011p00253490 [Amborella trichopoda]
Length=246

 Score =   311 bits (798),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G  S   + QEL+L A SAA+S  +L VGL+ LDPNRE++KKA E KKE++KRLGRP+  
Sbjct  2    GRRSRLPLGQELILCAISAALSYAILAVGLKQLDPNRESAKKAAEKKKELSKRLGRPIPS  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
             N+YED++ACDVINPD I V F ++GGLE +K+ L+EL+ILPLQRP LF  GKLL PQKG
Sbjct  62   MNSYEDMVACDVINPDEIKVTFEAVGGLEKVKEDLHELIILPLQRPLLFLRGKLLAPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKT+LAKAIA+ES +VFINV++SNLMSKWFGDAQKLV AVF+LAYKLQPAI
Sbjct  122  VLLYGPPGTGKTLLAKAIARESGSVFINVRVSNLMSKWFGDAQKLVTAVFTLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDS LGQR++T+ E LTNMKTEFM LWDG TTD
Sbjct  182  IFIDEVDSLLGQRRNTEQETLTNMKTEFMTLWDGLTTD  219



>ref|XP_011623829.1| PREDICTED: ATPase family AAA domain-containing protein 1-A [Amborella 
trichopoda]
Length=384

 Score =   313 bits (801),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            G  S   + QEL+L A SAA+S  +L VGL+ LDPNRE++KKA E KKE++KRLGRP+  
Sbjct  2    GRRSRLPLGQELILCAISAALSYAILAVGLKQLDPNRESAKKAAEKKKELSKRLGRPIPS  61

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
             N+YED++ACDVINPD I V F ++GGLE +K+ L+EL+ILPLQRP LF  GKLL PQKG
Sbjct  62   MNSYEDMVACDVINPDEIKVTFEAVGGLEKVKEDLHELIILPLQRPLLFLRGKLLAPQKG  121

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKT+LAKAIA+ES +VFINV++SNLMSKWFGDAQKLV AVF+LAYKLQPAI
Sbjct  122  VLLYGPPGTGKTLLAKAIARESGSVFINVRVSNLMSKWFGDAQKLVTAVFTLAYKLQPAI  181

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDEVDS LGQR++T+ E LTNMKTEFM LWDG TTD
Sbjct  182  IFIDEVDSLLGQRRNTEQETLTNMKTEFMTLWDGLTTD  219



>ref|XP_003078097.1| AAA+-type ATPase (ISS) [Ostreococcus tauri]
Length=711

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 175/221 (79%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M      +  I QEL L   SA +S +VL  GL+ +DPNR+ SK A+E KKE+A RLGRP
Sbjct  307  MSRAQGGQPSIFQELFLVGCSAILSMIVLNFGLKRMDPNRQNSKAAIERKKELATRLGRP  366

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
             + TN YEDVIA DV NPDHIDV FNSIGGLE  KQ+LYELVILPL RPELF+ GKLL P
Sbjct  367  NLDTNVYEDVIAMDVANPDHIDVTFNSIGGLEDTKQSLYELVILPLVRPELFARGKLLQP  426

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPGTGKT+LAKA+AKES A FINV+ S L SKWFGDAQKLV+AVF+LA+KLQ
Sbjct  427  AKGVLLYGPPGTGKTLLAKALAKESGACFINVRSSTLQSKWFGDAQKLVSAVFTLAFKLQ  486

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P+IIFIDE+DSFLG RKS +HEA   MKTEFM LWDGF TD
Sbjct  487  PSIIFIDEIDSFLGTRKSGEHEATATMKTEFMTLWDGFNTD  527



>ref|XP_009590016.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X2 [Nicotiana tomentosiformis]
Length=334

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +3

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            EDVIACDV+NPDHIDVEF+SIGGLE+IKQALYELVILP++RPELFSHGKLLGPQKGVLLY
Sbjct  9    EDVIACDVVNPDHIDVEFDSIGGLESIKQALYELVILPMRRPELFSHGKLLGPQKGVLLY  68

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLV+AVFSLAYKLQPAIIFID
Sbjct  69   GPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVSAVFSLAYKLQPAIIFID  128

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVDSFLGQRK++DHEALTNMKTEFMALWDGFTTD
Sbjct  129  EVDSFLGQRKTSDHEALTNMKTEFMALWDGFTTD  162



>ref|XP_010322234.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
isoform X5 [Solanum lycopersicum]
Length=341

 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +3

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLY  428
            +DVIACDV+NPDHIDVEFNSIGGLE+IKQAL ELVILP++RPELFSHGKLLGPQKGVLLY
Sbjct  15   QDVIACDVVNPDHIDVEFNSIGGLESIKQALCELVILPMRRPELFSHGKLLGPQKGVLLY  74

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKLVAAVFSLA+KLQPAIIFID
Sbjct  75   GPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFID  134

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            EVDSFLGQRK+TDHEALTNMKTEFMALWDGFTTD
Sbjct  135  EVDSFLGQRKATDHEALTNMKTEFMALWDGFTTD  168



>ref|XP_008343803.1| PREDICTED: ATPase family AAA domain-containing protein 1-A-like 
[Malus domestica]
Length=170

 Score =   296 bits (757),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M G    ETK  QELVLYAASAA+SCLVLFVGLR+LDPNREASKKA ENKKEIAKRLGRP
Sbjct  1    MGGSRERETKFXQELVLYAASAALSCLVLFVGLRYLDPNREASKKAXENKKEIAKRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            LI TNTYEDVIA DVINPD I+VEF SIGGL+AIK+AL ELVILPLQRP+LFSHGKLLGP
Sbjct  61   LISTNTYEDVIAGDVINPDDIEVEFGSIGGLDAIKEALCELVILPLQRPDLFSHGKLLGP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKL  551
            QKGVLLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKL
Sbjct  121  QKGVLLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKL  168



>ref|XP_010933794.1| PREDICTED: ATPase family AAA domain-containing protein 1-A-like 
isoform X2 [Elaeis guineensis]
Length=334

 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G+SET+ +Q+LVLYAASAA+SCLVLF GLR LDPNR ASKKALE KKEIAKRLGRP+IQT
Sbjct  2    GASETRFIQQLVLYAASAALSCLVLFAGLRQLDPNRAASKKALEQKKEIAKRLGRPMIQT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDVINPDHIDVEF SIGGLE IKQAL+ELVILPL+RPELF+ GKLL PQKGV
Sbjct  62   NQYEDVIACDVINPDHIDVEFESIGGLENIKQALFELVILPLRRPELFAQGKLLSPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLV-AAVFSLAYKLQPA  593
            LLYGPPGTGKTMLAKAIAKES AVFINV+ISNLMSKWFGDAQKL  A V  LA   +P+
Sbjct  122  LLYGPPGTGKTMLAKAIAKESGAVFINVRISNLMSKWFGDAQKLENARVMVLAATNRPS  180



>ref|XP_002974265.1| hypothetical protein SELMODRAFT_149735 [Selaginella moellendorffii]
 gb|EFJ24487.1| hypothetical protein SELMODRAFT_149735 [Selaginella moellendorffii]
Length=340

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +3

Query  153  LDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIK  332
            +DP+R  +KKA   KKE++KRLGR L QTN YED+IA +V+NP  IDV F+SIGGLE +K
Sbjct  1    MDPHRIDTKKATACKKELSKRLGRDLKQTNMYEDIIAGNVVNPQGIDVTFSSIGGLEDVK  60

Query  333  QALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKIS  512
             +LYEL ILPLQRPELFS GKLL PQKGVLLYGPPGTGKT+LAKA+AKE+RAVFINV+I+
Sbjct  61   DSLYELAILPLQRPELFSQGKLLRPQKGVLLYGPPGTGKTLLAKALAKEARAVFINVQIA  120

Query  513  NLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALW  692
            +LMSKW GDAQKLV AVF+LA+KLQP+IIFIDEVDSFLG+R  T HE +T MKTEFMALW
Sbjct  121  SLMSKWLGDAQKLVTAVFTLAHKLQPSIIFIDEVDSFLGRRGVTSHEVMTQMKTEFMALW  180

Query  693  DGFTTD  710
            DG TTD
Sbjct  181  DGLTTD  186



>ref|XP_003055969.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH59345.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=327

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 162/221 (73%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M G    E  +L +++   A  AIS + L   L+ LDP R   + A + KK IA+RLGRP
Sbjct  1    MAGQRQREPGMLPDIIFSLAMLAISVIPLHFFLKQLDPTRADREAAAKKKKLIARRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
             I TN +EDVIA DV+NPD I   F  IGGLE  K+AL E+VILPL RPELF  G LL P
Sbjct  61   DIVTNQFEDVIAGDVVNPDSITTTFAQIGGLEETKRALQEIVILPLLRPELFKSGNLLRP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KG +LYGPPGTGKTMLAKA+AKE  A FINV+ S L SKWFGDA KLVAAVFSLA+KLQ
Sbjct  121  VKGCMLYGPPGTGKTMLAKALAKECDACFINVRASTLQSKWFGDANKLVAAVFSLAWKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P+IIFIDEVDSFLG RK+ +HEA T+MKTEFM +WDGF T+
Sbjct  181  PSIIFIDEVDSFLGSRKTNEHEASTSMKTEFMTMWDGFQTN  221



>ref|XP_002500505.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61763.1| predicted protein, partial [Micromonas sp. RCC299]
Length=322

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 162/221 (73%), Gaps = 0/221 (0%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M G       I  E++     + ++ L   V ++ LDPNR A KKA   K++IA+RLGRP
Sbjct  1    MHGPRGPPPDIAVEILASLIVSTVALLAGTVAVKALDPNRGAKKKADAMKRDIARRLGRP  60

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
             I T  YED+IA DV NP+ I   F+ IGGL   K+AL E+VILPL RPELFS G LL P
Sbjct  61   NIVTTPYEDMIATDVANPNAISTTFDEIGGLGETKRALQEIVILPLLRPELFSGGSLLKP  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KG +LYGPPGTGKT+LAKA+AKE +A FINV+ S L SKWFGDA KLVAAVFSLA+KLQ
Sbjct  121  VKGCMLYGPPGTGKTLLAKALAKECQACFINVRSSTLQSKWFGDANKLVAAVFSLAWKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P+IIFIDEVDSFLG RK ++HEA T+MKTEFM +WDGF T+
Sbjct  181  PSIIFIDEVDSFLGARKGSEHEASTSMKTEFMTMWDGFQTN  221



>gb|ABR17208.1| unknown [Picea sitchensis]
Length=336

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   GSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT  239
            G  +T   QEL+LYA SAA+SCLVLF GL+ LDPNR A+KKA + KKEIAK+LGRPL++T
Sbjct  2    GHKQTTFTQELILYAISAAVSCLVLFAGLKQLDPNRAAAKKAADRKKEIAKKLGRPLVKT  61

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGV  419
            N YEDVIACDV+NPD IDV F SIGGL+ IKQAL+ELVILPLQRP LFSHG+LLGPQKGV
Sbjct  62   NQYEDVIACDVVNPDDIDVAFESIGGLDEIKQALHELVILPLQRPGLFSHGRLLGPQKGV  121

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLV-AAVFSLAYKLQP  590
            LLYGPPGTGKT+LAKAIAKES AVFINV+I+NLMSKWFGDAQKL  A V  LA   +P
Sbjct  122  LLYGPPGTGKTLLAKAIAKESGAVFINVRIANLMSKWFGDAQKLENARVMVLAATNRP  179



>ref|XP_005819543.1| hypothetical protein GUITHDRAFT_91001 [Guillardia theta CCMP2712]
 gb|EKX32563.1| hypothetical protein GUITHDRAFT_91001 [Guillardia theta CCMP2712]
Length=415

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 160/220 (73%), Gaps = 0/220 (0%)
 Frame = +3

Query  51   KGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL  230
            K  G  + ++ + ++    S  +S L     +  LDP  +  + A  ++KE+ +RLGR  
Sbjct  46   KALGRVDPRVWELIIKLGISFGLSLLATRWIITMLDPQHKQRQSAQRSRKELLRRLGRDD  105

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQ  410
            I+T+ +EDVIA + +NP  IDV F+ IGGLE  KQ + E+V+LP  RPELF+ GKLL P 
Sbjct  106  IKTDEHEDVIAKEAVNPASIDVTFDDIGGLEEQKQRIREIVVLPFCRPELFTRGKLLRPP  165

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            +GVL YGPPGTGKTMLAKAIAKE+RAVF+NV +S L  KWFG++QKLV AVF+LA+KLQP
Sbjct  166  RGVLFYGPPGTGKTMLAKAIAKETRAVFLNVSLSTLQDKWFGESQKLVRAVFTLAWKLQP  225

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
             IIFIDE+DSFL +RK  ++EA  NMK+EFMALWDG +T+
Sbjct  226  TIIFIDEIDSFLRERKDGEYEASCNMKSEFMALWDGLSTE  265



>gb|KDD73870.1| AAA+ ATPase, partial [Helicosporidium sp. ATCC 50920]
Length=257

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +3

Query  144  LRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLE  323
            ++ LDP ++  + A + KK ++KRLGR +     YEDVIA +V+NP+ I V    IGGL+
Sbjct  34   VKQLDPTKKNVETAKQKKKALSKRLGRVVNLDGQYEDVIAQEVVNPESISVSLADIGGLD  93

Query  324  AIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINV  503
             I   L   VI P++RPELF    LL  ++GVLLYGPPGTGKTMLAKA+A+E  A F+N+
Sbjct  94   HIIDDLQRNVITPMRRPELFCTS-LLRQKRGVLLYGPPGTGKTMLAKALARECGACFVNL  152

Query  504  KISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFM  683
            K S L+SKW+GD  KL+AAV++LAYK+QPAI+FIDEVD+ LG R+S +HEA T MKTEFM
Sbjct  153  KASTLLSKWYGDTNKLIAAVWTLAYKIQPAILFIDEVDALLGARRSQEHEATTAMKTEFM  212

Query  684  ALWDGFTT  707
             LWDGF T
Sbjct  213  QLWDGFET  220



>gb|KFH65278.1| hypothetical protein MVEG_08759 [Mortierella verticillata NRRL 
6337]
Length=358

 Score =   227 bits (578),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 147/212 (69%), Gaps = 1/212 (0%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYED  254
            K + +L L+A S A         +  +DP +   K A E   ++  RLG   I+ N YE 
Sbjct  7    KYIADLALFALSQAAFYYAFKYIISSMDPLKTKKKDAHEKSAKVLDRLGHRDIKLNEYEQ  66

Query  255  VIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKGVLLYG  431
            VIA +VI+P+ I V+F+ IGGL+ I ++L E VILPL  P LF+    LLG  KGVLLYG
Sbjct  67   VIASEVIHPEDIKVDFDQIGGLDPIIRSLRESVILPLNHPALFTSASGLLGAPKGVLLYG  126

Query  432  PPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDE  611
            PPG GKTMLAKA+AKES A FIN+ +S L  KWFG++ KLVAA+FSLA+K+QPAIIFIDE
Sbjct  127  PPGCGKTMLAKALAKESGATFINMHVSTLTDKWFGESNKLVAALFSLAHKMQPAIIFIDE  186

Query  612  VDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            +DSFL +R+S DHE  + MK EFM++WDG TT
Sbjct  187  IDSFLRERRSNDHEITSMMKAEFMSMWDGLTT  218



>ref|XP_005644664.1| AAA-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20120.1| AAA-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=342

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 149/222 (67%), Gaps = 2/222 (1%)
 Frame = +3

Query  42   VAMKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLG  221
            +A +   +   ++  EL+    S   S  ++   L HLDP +   ++A   ++ + +RLG
Sbjct  18   MAQRRAAAGGKQVAVELIYLGISLVGSAFLMRWVLSHLDPEKANKEQAKRRRQMVQRRLG  77

Query  222  RPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLL  401
              L +T  YED++A +V+NP  IDV  + IGG E IKQ L   VILPLQ+P  +  G+LL
Sbjct  78   IKL-ETTPYEDIVASEVVNPYEIDVTLSQIGGCERIKQDLVNRVILPLQKPHFYG-GRLL  135

Query  402  GPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYK  581
               KGVLLYGPPGTGKTMLAKA+AKES A FI VK S L SKW+G+ QKLV A F+LAYK
Sbjct  136  RQVKGVLLYGPPGTGKTMLAKALAKESGANFICVKPSLLQSKWYGETQKLVQATFTLAYK  195

Query  582  LQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            LQP IIF+DEVD+ LG RK+ +HEA T +KTEFM LWDG  T
Sbjct  196  LQPCIIFVDEVDALLGMRKAQEHEATTALKTEFMQLWDGMAT  237



>ref|XP_004365787.1| ATPase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89452.1| ATPase [Capsaspora owczarzaki ATCC 30864]
Length=352

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 148/204 (73%), Gaps = 5/204 (2%)
 Frame = +3

Query  114  AISCLVLFVGLRHL----DPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINP  281
             +S LV F+ +R+L    DP R+    A E  + + +RL R  I+   YE +IA D+++P
Sbjct  12   GLSQLVGFLAVRYLMHAMDPMRKKKDVARERGQSMLRRLNRNNIKLTEYEALIAADIVDP  71

Query  282  DHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHG-KLLGPQKGVLLYGPPGTGKTML  458
              IDV ++SIGGL+     L E ++LP +RP+LF+ G KLL    GVLL+GPPG GKTML
Sbjct  72   TDIDVTWSSIGGLDKTAAELKECLVLPFRRPDLFATGSKLLHAPTGVLLHGPPGCGKTML  131

Query  459  AKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRK  638
            AK +A+ES  VFIN++I++LM KW+G++QKLVAAVF+LA KLQPAI+FIDE+D+FL +R+
Sbjct  132  AKVVARESGCVFINLQIASLMEKWYGESQKLVAAVFTLAEKLQPAIVFIDEIDAFLRERQ  191

Query  639  STDHEALTNMKTEFMALWDGFTTD  710
            S+DHEA   +K++FM LWDG  TD
Sbjct  192  SSDHEATALIKSQFMTLWDGLGTD  215



>ref|XP_009516748.1| hypothetical protein PHYSODRAFT_473306 [Phytophthora sojae]
 gb|EGZ29473.1| hypothetical protein PHYSODRAFT_473306 [Phytophthora sojae]
Length=416

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 5/213 (2%)
 Frame = +3

Query  78   ILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRL---GRPLIQTNTY  248
            +L  L+LY      S  +     R L P  +  ++  +++ ++  RL   GR +  TN +
Sbjct  2    VLDGLMLYTMYQT-SKYLYKASHRQLKPMMDDWRQGQDSQAKLQNRLQRTGRRVFNTNYF  60

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLL  425
            E+VIA D+++P  IDV F+ IGGLE  K+ +Y+LV+LPL+ PE F S GKLL   KG+LL
Sbjct  61   ENVIAGDIVDPQDIDVSFDDIGGLERQKRDIYDLVVLPLKSPEFFASRGKLLTVPKGILL  120

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YG PGTGKTM+AKAIAKES A FI++KIS +MSKWFG++QKLV A FSLA KL P IIFI
Sbjct  121  YGKPGTGKTMMAKAIAKESGAFFIDLKISTIMSKWFGESQKLVRAAFSLARKLAPCIIFI  180

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFT  704
            DEVDSF+G+R        ++MKTEF+ALWDGFT
Sbjct  181  DEVDSFMGKRGGVSDPTFSSMKTEFLALWDGFT  213



>ref|XP_008913560.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI34757.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK75054.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL28475.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL81730.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM34936.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN01233.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETO63510.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP04608.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
 gb|ETP32745.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=390

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 134/178 (75%), Gaps = 4/178 (2%)
 Frame = +3

Query  174  SKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELV  353
            S+  L+N+    KR GR +  TN +E+VIA D+++P  IDV F  IGGLE  K+ +++LV
Sbjct  11   SQAKLQNR---LKRTGRRVFNTNYFENVIAGDIVDPQDIDVSFEDIGGLERQKRDIHDLV  67

Query  354  ILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKW  530
            +LPL+ PE F S GKLL   KG+LLYG PGTGKTMLAKAIAKES A FI++KIS +MSKW
Sbjct  68   VLPLKSPEFFASRGKLLTVPKGILLYGKPGTGKTMLAKAIAKESGAFFIDLKISTIMSKW  127

Query  531  FGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFT  704
            FG++QKLV A FSLA KL P IIFIDEVDSF+G+R        ++MKTEF+ALWDGFT
Sbjct  128  FGESQKLVRAAFSLARKLAPCIIFIDEVDSFMGKRGGVSDPTFSSMKTEFLALWDGFT  185



>ref|XP_002997321.1| ATPase [Phytophthora infestans T30-4]
 gb|EEY68893.1| ATPase [Phytophthora infestans T30-4]
Length=414

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = +3

Query  162  NREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQAL  341
            N + S+  L+++    KR GR +  TN +E+VIA D+++P  IDV F  IGGLE  K+ +
Sbjct  31   NGQDSQAKLQSR---LKRTGRRVFNTNYFENVIAGDIVDPQDIDVSFEDIGGLERQKRDI  87

Query  342  YELVILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNL  518
            ++LV+LPL+ PE F S GKLL   KG+LLYG PGTGKTMLAKAIAKES A FI++KIS +
Sbjct  88   HDLVVLPLKSPEFFASRGKLLTAPKGILLYGKPGTGKTMLAKAIAKESGAFFIDLKISTI  147

Query  519  MSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDG  698
            MSKWFG++QKLV A FSLA KL P IIFIDEVDSF+G+R        ++MKTEF+ALWDG
Sbjct  148  MSKWFGESQKLVRAAFSLARKLAPCIIFIDEVDSFMGKRGGVSDPTFSSMKTEFLALWDG  207

Query  699  FT  704
            FT
Sbjct  208  FT  209



>ref|XP_008913559.1| hypothetical protein PPTG_17635 [Phytophthora parasitica INRA-310]
 gb|ETI34756.1| hypothetical protein F443_18820 [Phytophthora parasitica P1569]
 gb|ETK75053.1| hypothetical protein L915_18288 [Phytophthora parasitica]
 gb|ETL28474.1| hypothetical protein L916_18197 [Phytophthora parasitica]
 gb|ETL81729.1| hypothetical protein L917_18012 [Phytophthora parasitica]
 gb|ETM34935.1| hypothetical protein L914_18095 [Phytophthora parasitica]
 gb|ETN01232.1| hypothetical protein PPTG_17635 [Phytophthora parasitica INRA-310]
 gb|ETO63509.1| hypothetical protein F444_18806 [Phytophthora parasitica P1976]
 gb|ETP04607.1| hypothetical protein F441_18672 [Phytophthora parasitica CJ01A1]
Length=444

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = +3

Query  168  EASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYE  347
            + S+  L+N+    KR GR +  TN +E+VIA D+++P  IDV F  IGGLE  K+ +++
Sbjct  63   QDSQAKLQNR---LKRTGRRVFNTNYFENVIAGDIVDPQDIDVSFEDIGGLERQKRDIHD  119

Query  348  LVILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMS  524
            LV+LPL+ PE F S GKLL   KG+LLYG PGTGKTMLAKAIAKES A FI++KIS +MS
Sbjct  120  LVVLPLKSPEFFASRGKLLTVPKGILLYGKPGTGKTMLAKAIAKESGAFFIDLKISTIMS  179

Query  525  KWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFT  704
            KWFG++QKLV A FSLA KL P IIFIDEVDSF+G+R        ++MKTEF+ALWDGFT
Sbjct  180  KWFGESQKLVRAAFSLARKLAPCIIFIDEVDSFMGKRGGVSDPTFSSMKTEFLALWDGFT  239



>gb|ETP32744.1| hypothetical protein F442_18631 [Phytophthora parasitica P10297]
Length=445

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = +3

Query  168  EASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYE  347
            + S+  L+N+    KR GR +  TN +E+VIA D+++P  IDV F  IGGLE  K+ +++
Sbjct  64   QDSQAKLQNR---LKRTGRRVFNTNYFENVIAGDIVDPQDIDVSFEDIGGLERQKRDIHD  120

Query  348  LVILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMS  524
            LV+LPL+ PE F S GKLL   KG+LLYG PGTGKTMLAKAIAKES A FI++KIS +MS
Sbjct  121  LVVLPLKSPEFFASRGKLLTVPKGILLYGKPGTGKTMLAKAIAKESGAFFIDLKISTIMS  180

Query  525  KWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFT  704
            KWFG++QKLV A FSLA KL P IIFIDEVDSF+G+R        ++MKTEF+ALWDGFT
Sbjct  181  KWFGESQKLVRAAFSLARKLAPCIIFIDEVDSFMGKRGGVSDPTFSSMKTEFLALWDGFT  240



>gb|KDN41754.1| hypothetical protein RSAG8_07285, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=364

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 137/203 (67%), Gaps = 5/203 (2%)
 Frame = +3

Query  114  AISCLVLFVGLRH----LDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINP  281
            A+S + L+   ++    LDP +E  K A     ++  RLG   +Q   YE++IA +VI+P
Sbjct  19   AVSNIALYYAFKYVMSSLDPQQEKRKSAKAKSAKVLDRLGVKELQLTEYEEIIAAEVIHP  78

Query  282  DHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTML  458
            + I   F  IGGL+ I  +L E VI PL  PELF S+  LLG  KGVLLYGPPG GKTML
Sbjct  79   NDITTGFEDIGGLDPIISSLRESVIYPLCYPELFASNAGLLGAPKGVLLYGPPGCGKTML  138

Query  459  AKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRK  638
            AKA+AKES A FIN+ +S L +KW+G++ KLVA +FSLA K+QPAIIFIDE+DSFLG+R 
Sbjct  139  AKALAKESSATFINIAVSVLTNKWYGESNKLVAGLFSLARKMQPAIIFIDEIDSFLGERG  198

Query  639  STDHEALTNMKTEFMALWDGFTT  707
              DHE    MK EFM LWDG  +
Sbjct  199  RGDHEVTGMMKAEFMTLWDGLAS  221



>ref|XP_009268805.1| hypothetical protein J056_000902 [Wallemia ichthyophaga EXF-994]
 gb|EOR00364.1| hypothetical protein J056_000902 [Wallemia ichthyophaga EXF-994]
Length=369

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 143/218 (66%), Gaps = 10/218 (5%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHL----DPNREASKKALENKKEIAKRLGRPLIQTN  242
            KI  +L+ +AA  A    V+F  LR+L    DP +   +       +I +RLGR  +  N
Sbjct  9    KIAVDLMAFAAGQA----VIFYTLRYLLNSNDPLKSKRQGTKSKSTQILERLGRNNVTLN  64

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHG--KLLGPQKG  416
             YE+VIAC+++ P+ I   F+ IGGL+ I   L E VI PL+ P LF+ G   LL P +G
Sbjct  65   EYEEVIACEIVLPEEISTTFDDIGGLQHIVSNLKENVIYPLKLPGLFTGGSKNLLSPPRG  124

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPG GKTMLAKA+A+ES A FIN+ +S L  KWFG++ KLVAA+FSLA K QP+I
Sbjct  125  VLLYGPPGCGKTMLAKALARESNATFINMHVSTLTDKWFGESNKLVAALFSLAKKCQPSI  184

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            IFIDE+DSFL +R   DHE    MK EFM  WDG +++
Sbjct  185  IFIDEIDSFLRERGKGDHEVTNMMKAEFMTFWDGLSSE  222



>ref|XP_007881898.1| hypothetical protein PFL1_06168 [Pseudozyma flocculosa PF-1]
 gb|EPQ26233.1| hypothetical protein PFL1_06168 [Pseudozyma flocculosa PF-1]
Length=402

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 151/220 (69%), Gaps = 13/220 (6%)
 Frame = +3

Query  78   ILQELVLYAASAAISCLVLFVGLRH----LDPN---REASKKALENKKEIAKRLG--RPL  230
            + +++V   A  A+S +  F   R+    LDPN   R+ SKK  + K +   +LG  R  
Sbjct  4    VTRKMVADVAILAVSQVAFFYAFRYILASLDPNKQKRQDSKKVSDAKLD---KLGLKRQD  60

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGP  407
            +Q N YE+ I+ ++I P+ I V+F SIGGL+ I  +L E VI PL  PELF++   LLG 
Sbjct  61   LQLNEYEEQISAELILPEDIPVDFASIGGLDGIISSLQESVIAPLCYPELFTNASGLLGA  120

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLV+A+FSLA KLQ
Sbjct  121  PKGVLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVSALFSLARKLQ  180

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            PAIIFIDE+DSFL +R + DHE    MK EFM LWDG T+
Sbjct  181  PAIIFIDEIDSFLRERATGDHEVTGMMKAEFMTLWDGLTS  220



>emb|CDS10722.1| hypothetical protein LRAMOSA11208 [Absidia idahoensis var. thermophila]
Length=375

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 141/211 (67%), Gaps = 8/211 (4%)
 Frame = +3

Query  99   YAASAAI---SCLVLFVGLR----HLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDV  257
            YAA  A+   S +  +   +     LDP +   ++A     ++  +LG   ++   YE +
Sbjct  14   YAADVAVFALSQVAFYFAFKWIVGSLDPTKAKKQEAKNKSSKVLGKLGVKDLKLTEYEQI  73

Query  258  IACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKGVLLYGP  434
            IA +V++PD I V F  IGGL+ I Q L E VI PL  PELF+    LLG  KGVLLYGP
Sbjct  74   IAAEVVHPDEIHVTFKQIGGLDHIVQDLRESVIYPLCYPELFTSASGLLGAPKGVLLYGP  133

Query  435  PGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEV  614
            PG GKTMLAKA+AKES A FIN+ +S L  K++G++ KLVAA+FSLA KLQPAI+FIDE+
Sbjct  134  PGCGKTMLAKALAKESNATFINLHVSTLTDKYYGESNKLVAALFSLARKLQPAIVFIDEI  193

Query  615  DSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            DSFL +R+STDHE    MK EFM+LWDG TT
Sbjct  194  DSFLRERRSTDHETTGMMKAEFMSLWDGLTT  224



>dbj|GAK62152.1| AAA-domain-containing protein [Pseudozyma antarctica]
Length=398

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 146/217 (67%), Gaps = 9/217 (4%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGR-----PLIQT  239
            K++ ++ L+A S           +  LDPNR+   K  + KK    +LGR       ++ 
Sbjct  7    KMMTDVALFAMSQVAFYYAFKYVMSSLDPNRQ---KRQDTKKVADAKLGRLGLRGKDLEL  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            N YE+ I+ ++I P+ I V+F SIGGL+ I  +L E VI PL  PELF++   LLG  KG
Sbjct  64   NEYEEQISAELILPEDIPVDFASIGGLDGIISSLQESVIAPLCYPELFANASGLLGAPKG  123

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVAA+FSLA KLQP+I
Sbjct  124  VLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVAALFSLARKLQPSI  183

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DSFL +R + DHE    MK EFM LWDG T+
Sbjct  184  IFIDEIDSFLRERATGDHEVTGMMKAEFMTLWDGLTS  220



>gb|EIE76521.1| hypothetical protein RO3G_01225 [Rhizopus delemar RA 99-880]
Length=369

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 143/211 (68%), Gaps = 9/211 (4%)
 Frame = +3

Query  99   YAASAAI---SCLVLFVGLRH----LDPNREASKKALENKKEIAKRLGRPLIQTNTYEDV  257
            YAA  A+   S +  +   ++    LDP R   ++A      +  +LG+  I+ + YE +
Sbjct  13   YAADVALFALSQVAFYFAFKYVASSLDPTRAKRQEAKAKSNRVLGKLGKD-IKLSEYEQI  71

Query  258  IACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLLYGP  434
            IA +VI+ D I V F  IGGL++I Q L E VI PL  P+LF S   LLG  KGVLLYGP
Sbjct  72   IAAEVIHSDEISVNFRQIGGLDSIIQELRESVIYPLCYPDLFTSASGLLGAPKGVLLYGP  131

Query  435  PGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEV  614
            PG GKTMLAKA+AKES A FINV +S L  K++G++ KLV+AVF+LA KLQP+I+FIDE+
Sbjct  132  PGCGKTMLAKALAKESGATFINVHVSTLTDKYYGESNKLVSAVFTLARKLQPSIVFIDEI  191

Query  615  DSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            DSFL +R+STDHE    MK EFM+LWDG TT
Sbjct  192  DSFLRERRSTDHETTGMMKAEFMSLWDGLTT  222



>emb|CEG77197.1| Putative ATPase, AAA-type domain containing protein [Rhizopus 
microsporus]
 emb|CEJ02226.1| Putative ATPase, AAA-type domain containing protein [Rhizopus 
microsporus]
 emb|CEJ01820.1| Putative ATPase, AAA-type domain containing protein [Rhizopus 
microsporus]
Length=370

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 142/212 (67%), Gaps = 2/212 (1%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYED  254
            K   ++ L+A S           L+ LDPN+   ++A      +  +LG+  I+ N YE 
Sbjct  12   KYAADVALFAISQVAFYFAFKYVLKSLDPNKAKRQEAKARSNRVLGKLGKD-IKLNEYEQ  70

Query  255  VIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKGVLLYG  431
            +IA ++I+ + I+V F  IGGL++I Q L E VI PL  P LF+    LLG  KGVLLYG
Sbjct  71   IIAAEIIHAEEINVTFKQIGGLDSIIQELRESVIYPLCYPGLFTSASGLLGAPKGVLLYG  130

Query  432  PPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDE  611
            PPG GKTMLAKA+A+ES A FINV +S L  K++G++ KL AAVF+LA KLQP+I+FIDE
Sbjct  131  PPGCGKTMLAKALARESGATFINVHVSTLTDKYYGESNKLAAAVFTLARKLQPSIVFIDE  190

Query  612  VDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            +DSFL +R+STDHE    MK EFM+LWDG TT
Sbjct  191  IDSFLRERRSTDHETTGMMKAEFMSLWDGLTT  222



>emb|CEL62644.1| putative AAA domain-containing protein C24B10,10c OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) GN=SPCC24B10.10c 
PE=3 SV=1 [Rhizoctonia solani AG-1 IB]
Length=364

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 145/219 (66%), Gaps = 5/219 (2%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRH----LDPNREASKKALENKKEIAKRLGRPLI  233
            S ++  +++ +  A  A+S + L+   ++    LDP +E  K A     ++  RLG   +
Sbjct  3    SASRDARKIAVDVAMFAVSNIALYYAFKYVMSSLDPQQEKRKAAKAKSAKVLDRLGVKEL  62

Query  234  QTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQ  410
            +   YE++IA +VI+P  I   F  IGGL+ I  +L E VI PL  PELF S+G LLG  
Sbjct  63   ELTEYEEIIAAEVIHPSDITTGFEDIGGLDPIISSLRESVIYPLCYPELFASNGGLLGAP  122

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYGPPG GKTMLAKA+AKES A FIN+ +S L +KW+G++ KLVA +FSLA K+QP
Sbjct  123  KGVLLYGPPGCGKTMLAKALAKESNATFINIAVSVLTNKWYGESNKLVAGLFSLARKMQP  182

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            AIIFIDE+DSFLG+R   DHE    MK EFM LWDG  +
Sbjct  183  AIIFIDEIDSFLGERGRGDHEVTGMMKAEFMTLWDGLAS  221



>gb|EIE82175.1| hypothetical protein RO3G_06880 [Rhizopus delemar RA 99-880]
Length=345

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 140/212 (66%), Gaps = 2/212 (1%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYED  254
            K   ++ L+A S           +  LDP R   ++A      +  +LG+  I+ + YE 
Sbjct  12   KYAADVALFALSQVAFYFAFKFVVSSLDPTRAKRQEAKAKSNRVMGKLGKD-IKLSEYEQ  70

Query  255  VIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKGVLLYG  431
            +IA ++I+ D I V F  IGGL+ I Q L E VI PL  PELF+    LLG  KGVLLYG
Sbjct  71   IIAAEIIHSDEISVTFKQIGGLDPIIQELRESVIYPLCYPELFTSASGLLGAPKGVLLYG  130

Query  432  PPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDE  611
            PPG GKTMLAKA+A+ES A FINV +S L  K++G++ KLV+AVF+LA KLQP+I+FIDE
Sbjct  131  PPGCGKTMLAKALARESGATFINVHVSTLTDKYYGESNKLVSAVFTLARKLQPSIVFIDE  190

Query  612  VDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            +DSFL +R+STDHE    MK EFM+LWDG TT
Sbjct  191  IDSFLRERRSTDHETTGMMKAEFMSLWDGLTT  222



>dbj|GAC93341.1| hypothetical protein PHSY_000906 [Pseudozyma hubeiensis SY62]
Length=398

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 147/217 (68%), Gaps = 9/217 (4%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLI-----QT  239
            K++ ++ ++A S           +  LDPNR+   K  ++KK    +LG+  I     Q 
Sbjct  7    KMMTDVAVFAMSQVAFYYAFKFVMTSLDPNRQ---KRQDSKKVADAKLGKLGIRGKDLQL  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            N YE+ I+ ++I P+ I V+F SIGGL+ I  +L E VI PL  PELF++   LLG  KG
Sbjct  64   NEYEEQISAELILPEDIPVDFASIGGLDGIISSLQESVIAPLCYPELFANASGLLGAPKG  123

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVAA+FSLA KLQP+I
Sbjct  124  VLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVAALFSLARKLQPSI  183

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            +FIDE+DSFL +R S DHE    MK EFM LWDG T+
Sbjct  184  VFIDEIDSFLRERASGDHEVTGMMKAEFMTLWDGLTS  220



>emb|CCF54256.1| probable MSP1-intra-mitochondrial sorting protein [Ustilago hordei]
Length=397

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 147/217 (68%), Gaps = 9/217 (4%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGR-----PLIQT  239
            K++ ++ ++A S           +  LDPNR+   K  ++KK    +LG+       ++ 
Sbjct  7    KMMTDVAVFAMSQVAFYYAFKYVMSSLDPNRQ---KRQDSKKISDAKLGKLGLRGKDLEL  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            N YE+ I+ ++I P+ I V+FNS+GGL+ I  +L E VI PL  PELF +   LLG  KG
Sbjct  64   NEYEEQISAELILPEDIPVDFNSVGGLDGIISSLQESVIAPLCYPELFDNASGLLGAPKG  123

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVAA+FSLA KLQP+I
Sbjct  124  VLLYGPPGTGKTMLAKALAKESDATFINMHVSTLTNKWFGESNKLVAALFSLARKLQPSI  183

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DSFL +R + DHE    MK EFM LWDG T+
Sbjct  184  IFIDEIDSFLRERATGDHEVTGMMKAEFMTLWDGLTS  220



>ref|XP_011345735.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Cerapachys biroi]
 gb|EZA50067.1| ATPase family AAA domain-containing protein 1-B [Cerapachys biroi]
Length=379

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 144/221 (65%), Gaps = 12/221 (5%)
 Frame = +3

Query  84   QELVLYAASAAISCLVLFVGLR----HLDPNR----EASKKALENKKEIAK--RLGRP--  227
            QE++L  A       + F  +R     LDP R     A KKA E  +++A+  R GR   
Sbjct  12   QEILLLMARLTCVAAIGFFSMRWIMNQLDPTRSTKQRAKKKAREQLRKLAEHDRYGRSFD  71

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            + Q   YE +IA  +++P+ I V +N+I GL+++ Q L E VILP+QR ELF   +L   
Sbjct  72   MDQLTDYEMIIANHLVDPNDIKVSWNNIAGLDSVIQELKETVILPIQRKELFEDSQLTQA  131

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPG GKTM+AKA A+E++  FIN+ +S L  KW+G++QKL AAVFSLA KLQ
Sbjct  132  PKGVLLYGPPGCGKTMIAKATAREAKTRFINLDVSILTDKWYGESQKLAAAVFSLAVKLQ  191

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P IIFIDE+DSFL  R S DHEA   MK +FM+LWDG  TD
Sbjct  192  PCIIFIDEIDSFLRSRNSQDHEATAMMKAQFMSLWDGLITD  232



>gb|KDE05272.1| hypothetical protein MVLG_04304 [Microbotryum violaceum p1A1 
Lamole]
Length=360

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 142/214 (66%), Gaps = 3/214 (1%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL--IQTNTY  248
            KI+Q++ L+A S  +        +  +DP     K+A +  K+   +LG  L  +    +
Sbjct  9    KIVQDVALFAVSQVLFYAAFKAVMSSMDPQSTKRKEAKDKSKKALSKLGLDLSTLDLTEH  68

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLL  425
            E++IA +V++P  I+V F  IGGLE I   L E VI PL   ++F S   L GP KGVLL
Sbjct  69   EEIIAGEVVHPSEINVTFKDIGGLEPIISQLREAVIFPLCYAQVFESAAGLFGPPKGVLL  128

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPG GKTMLAKA+AKES A FIN+ +S L  KWFG++ KLVAA+FSLA KLQP+IIFI
Sbjct  129  YGPPGCGKTMLAKALAKESGATFINMHVSTLTDKWFGESNKLVAALFSLAKKLQPSIIFI  188

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            DE+DSF+ +R+S+DHE    MK EFM++WDG  T
Sbjct  189  DEIDSFMRERRSSDHEVTGMMKAEFMSMWDGLAT  222



>ref|XP_011386356.1| putative intra-mitochondrial sorting protein [Ustilago maydis 
521]
 gb|KIS72088.1| putative intra-mitochondrial sorting protein [Ustilago maydis 
521]
Length=398

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 152/222 (68%), Gaps = 15/222 (7%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRH----LDPNREASKKALENKKEIAK-RLGR-----  224
            ++ ++++   A  AIS +  +   ++    LDPNR+      +N K++A  +LG+     
Sbjct  3    EVTRKMMTDVAVFAISQVAFYYAFKYVMSSLDPNRQKR----QNSKKVADAKLGKLGLRG  58

Query  225  PLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LL  401
              +Q N YE+ I+ ++I P+ I V+F SIGGL+ I  +L E VI PL  PELF++   LL
Sbjct  59   KELQLNEYEEQISAELILPEDIPVDFASIGGLDGIISSLQESVIAPLCYPELFANASGLL  118

Query  402  GPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYK  581
            G  KGVLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVAA+FSLA K
Sbjct  119  GAPKGVLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVAALFSLARK  178

Query  582  LQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            LQP+IIFIDE+DSFL +R + DHE    MK EFM LWDG T+
Sbjct  179  LQPSIIFIDEIDSFLRERATGDHEVTGMMKAEFMTLWDGLTS  220



>ref|XP_011400023.1| NAD(P) transhydrogenase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM27067.1| NAD(P) transhydrogenase, mitochondrial [Auxenochlorella protothecoides]
Length=1256

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 5/197 (3%)
 Frame = +3

Query  129   VLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDV----IACDVINPDHIDV  296
             +L   L+ +DP ++  + A + KK ++KRLGRP+     YEDV    IA +V+NP HI++
Sbjct  866   ILRWALKQMDPTKKNVETAKQRKKALSKRLGRPVNTDGQYEDVSKRVIAQEVVNPAHINI  925

Query  297   EFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAK  476
                 +GGL+ I + L   VI P++RPELF    LL  ++GVLLYGPPGTGKTMLAKA+A 
Sbjct  926   TLQDVGGLDHIIEDLQRNVITPMRRPELF-RTSLLRQKRGVLLYGPPGTGKTMLAKALAS  984

Query  477   ESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEA  656
             E  A FIN+K S L+SKW+GD  KL+AAV+SLA K+ P I+FIDEVDS LG R++ +HEA
Sbjct  985   ECNACFINLKASTLLSKWYGDTNKLIAAVWSLAAKIAPTILFIDEVDSLLGHRRAVEHEA  1044

Query  657   LTNMKTEFMALWDGFTT  707
              T MKTEFM LWDGF +
Sbjct  1045  TTAMKTEFMQLWDGFES  1061



>ref|XP_005851607.1| hypothetical protein CHLNCDRAFT_19045 [Chlorella variabilis]
 gb|EFN59505.1| hypothetical protein CHLNCDRAFT_19045 [Chlorella variabilis]
Length=328

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 132/188 (70%), Gaps = 1/188 (1%)
 Frame = +3

Query  120  SCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVE  299
            S L+L   L  +DPN+ A   A   KKE+AKRLGRP+     YEDV+A  VINP  IDV 
Sbjct  4    SWLILRWALNQMDPNKNAKAMAKLRKKELAKRLGRPVNLDGQYEDVVAQAVINPAAIDVT  63

Query  300  FNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKE  479
               +GGL+ I + +   VI P++ PE F    LL  ++GVLLYGPPGTGKTMLAKA+A+E
Sbjct  64   LEDVGGLDHIIEDVTRNVITPMRHPEHF-RSNLLRQKRGVLLYGPPGTGKTMLAKALARE  122

Query  480  SRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEAL  659
              A FI +K S ++SKW+GD+ KLVAAV+SLA KLQP I+FIDEVDS LGQR   +HEA 
Sbjct  123  CNACFILLKSSTILSKWYGDSNKLVAAVWSLASKLQPCILFIDEVDSLLGQRSHQEHEAT  182

Query  660  TNMKTEFM  683
            T +KTEFM
Sbjct  183  TAIKTEFM  190



>emb|CDI51431.1| probable MSP1-intra-mitochondrial sorting protein, partial [Melanopsichium 
pennsylvanicum 4]
Length=349

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 146/217 (67%), Gaps = 9/217 (4%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGR-----PLIQT  239
            K++ ++ ++A S           +  LDPNR+   K  ++KK    +LG+        + 
Sbjct  7    KMMTDVAVFAMSQVAFYYAFKYVMSSLDPNRQ---KRQDSKKIADAKLGKLGLRGKDFEL  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            N YE+ I+ ++I P+ I V+F SIGGL+ I  +L E VI PL  PELF++   LLG  KG
Sbjct  64   NEYEEQISAELILPEDIPVDFQSIGGLDGIISSLQESVIAPLCYPELFANASGLLGAPKG  123

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVAA+FSLA KLQP+I
Sbjct  124  VLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVAALFSLARKLQPSI  183

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DSFL +R + DHE    MK EFM LWDG T+
Sbjct  184  IFIDEIDSFLRERATGDHEVTGMMKAEFMTLWDGLTS  220



>gb|KIN99709.1| hypothetical protein M404DRAFT_1004432 [Pisolithus tinctorius 
Marx 270]
Length=379

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 142/210 (68%), Gaps = 5/210 (2%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYED  254
            +I+ ++ L+ AS A     +F  +R L       K A + + E+ K+LG   ++ + YE 
Sbjct  9    RIILDVALFVASQA----AVFYAIRWLMDRHPTDKDAEKRRTEVMKKLGHHNLKLDDYER  64

Query  255  VIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLLYG  431
             IA +V++PDHI V F  IGGL++I  +L E +I PL  P LF S   LLG  KGVLLYG
Sbjct  65   TIALEVVHPDHIVVGFEDIGGLDSIISSLRESIIYPLLYPTLFTSTSSLLGAPKGVLLYG  124

Query  432  PPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDE  611
            PPG GKTMLA+A+AKES A FINV  S L +KWFG++ KLVAA+FSLA K+QPAIIF+DE
Sbjct  125  PPGCGKTMLARALAKESGATFINVAASVLTNKWFGESNKLVAALFSLARKVQPAIIFVDE  184

Query  612  VDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            +D+FL +R+S DHE +  MK EFM  WDG 
Sbjct  185  IDTFLRERRSDDHEVMGMMKAEFMTSWDGL  214



>emb|CBQ67919.1| probable MSP1-intra-mitochondrial sorting protein [Sporisorium 
reilianum SRZ2]
Length=399

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 147/217 (68%), Gaps = 9/217 (4%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGR-----PLIQT  239
            K++ ++ ++A S           +  LDPNR+   K  ++KK    +LG+       +Q 
Sbjct  7    KMMTDVAVFAMSQVAFYYAFKYVMSSLDPNRQ---KRQDSKKVADAKLGKLGLRGKDLQL  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            N YE+ I+ ++I P+ I V+F S+GGL+ I  +L E VI PL  PELF++   LLG  KG
Sbjct  64   NEYEEQISAELILPEDIPVDFASVGGLDGIISSLQESVIAPLCYPELFANASGLLGAPKG  123

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVAA+FSLA KLQP+I
Sbjct  124  VLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVAALFSLARKLQPSI  183

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DSFL +R + DHE    MK EFM +WDG T+
Sbjct  184  IFIDEIDSFLRERATGDHEVTGMMKAEFMTMWDGLTS  220



>gb|EUC63346.1| AAA family ATPase [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP50386.1| AAA family ATPase [Rhizoctonia solani 123E]
Length=364

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 142/217 (65%), Gaps = 5/217 (2%)
 Frame = +3

Query  72   TKILQELVLYAASAAISCLVLFVGLRH----LDPNREASKKALENKKEIAKRLGRPLIQT  239
            ++ ++++ +  A  A+S + L+   ++    LDP  E  K A     ++  RLG   ++ 
Sbjct  5    SRDVRKIAVDVAMFAVSNIALYYAFKYVMSSLDPQSEKRKVAKAKSAKVLDRLGVKELEL  64

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKG  416
              YE++IA +VI+P  I   F  IGGL+ I  +L E VI PL  PELF S+  LLG  KG
Sbjct  65   TEYEEIIAAEVIHPSDITTGFEDIGGLDPIISSLRESVIYPLCYPELFASNAGLLGAPKG  124

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPG GKTMLAKA+AKES A FIN+ +S L +KW+G++ KLVA +F LA K+QPAI
Sbjct  125  VLLYGPPGCGKTMLAKALAKESSATFINIAVSVLTNKWYGESNKLVAGLFGLARKMQPAI  184

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DSFLG+R   DHE    MK EFM LWDG  +
Sbjct  185  IFIDEIDSFLGERGRGDHEVTGMMKAEFMTLWDGLAS  221



>gb|ESA21149.1| hypothetical protein GLOINDRAFT_17786 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX66292.1| Msp1p [Rhizophagus irregularis DAOM 197198w]
Length=364

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 144/204 (71%), Gaps = 5/204 (2%)
 Frame = +3

Query  114  AISCLVLFVGLRH----LDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINP  281
            AIS + L+  +++    LDP ++  K+A    +++  +LGR  ++ N YE+VI  +VI P
Sbjct  17   AISQVALYYAVKYVLSSLDPMKDKKKEAKAKSEQVLGKLGRKNMKLNEYEEVILSEVIFP  76

Query  282  DHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTML  458
            + I + F  IGGL+ I Q+L E VI PL  P LF S   LLG  KGVLL+GPPG GKTML
Sbjct  77   EEISINFKQIGGLDPIIQSLRESVIYPLTYPHLFTSPSGLLGVSKGVLLHGPPGCGKTML  136

Query  459  AKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRK  638
            AKA+A+ES A FIN+ +S L  KWFG++ KLV+AVFS+A KL+P IIFIDE+D+FL +R+
Sbjct  137  AKALARESGATFINLHVSTLTDKWFGESNKLVSAVFSVAKKLEPCIIFIDEIDAFLRERR  196

Query  639  STDHEALTNMKTEFMALWDGFTTD  710
            S+DHE    MK EFM+LWDG TTD
Sbjct  197  SSDHEVTGMMKAEFMSLWDGLTTD  220



>gb|EST06444.1| AAA+-type ATPase [Pseudozyma brasiliensis GHG001]
Length=397

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 146/217 (67%), Gaps = 9/217 (4%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGR-----PLIQT  239
            K++ ++ ++A S           +  LDPNR+   K  ++KK    +LG+       +Q 
Sbjct  7    KMMTDVAVFAMSQVAFYYAFKYVMSSLDPNRQ---KRQDSKKVADAKLGKLGLRGKDLQL  63

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            N YE+ I+ ++I P+ I V+F SIGGL+ I  +L E VI PL  PELF++   LLG  KG
Sbjct  64   NEYEEQISAELILPEDIPVDFASIGGLDGIISSLQESVIAPLCYPELFANASGLLGAPKG  123

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVA +FSLA KLQP+I
Sbjct  124  VLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVAGLFSLARKLQPSI  183

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DSFL +R S DHE    MK EFM +WDG T+
Sbjct  184  IFIDEIDSFLRERASGDHEVTGMMKAEFMTMWDGLTS  220



>emb|CCI50566.1| unnamed protein product [Albugo candida]
Length=425

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  213  RLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SH  389
            R GR   QT  +EDVIA D+++P  I V F+ IGGLE+ K+ +Y+LV+LPL+ P  F + 
Sbjct  81   RSGRATFQTTYHEDVIAGDIVDPFEIPVTFDDIGGLESQKRDIYDLVVLPLKCPHFFNTR  140

Query  390  GKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFS  569
            GKLL   KG+LLYG PGTGKTMLAKAIAKES A FI++KIS LMSKWFG++QKLV A FS
Sbjct  141  GKLLSIPKGILLYGKPGTGKTMLAKAIAKESGAFFIDLKISTLMSKWFGESQKLVRAAFS  200

Query  570  LAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFT  704
            LA KL P IIFIDEVD+F+G+R S      + MKTEF+ALWDGFT
Sbjct  201  LASKLAPCIIFIDEVDAFMGKRSSVLDPTYSTMKTEFLALWDGFT  245



>gb|EPB82322.1| hypothetical protein HMPREF1544_10917 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=373

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 140/211 (66%), Gaps = 8/211 (4%)
 Frame = +3

Query  99   YAASAAI---SCLVLFVGLR----HLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDV  257
            YAA  A+   S +  +   +     LDP +   ++A      +  +LG   ++   YE +
Sbjct  14   YAADVAVFALSQVAFYFAFKFVVGSLDPTKAKRQEAKAKSNRVLGKLGAKDLKLTEYEQI  73

Query  258  IACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKGVLLYGP  434
            IA +VI+ D I+V F  IGGL+ I Q L E VI PL  PELF+    LLG  +GVLLYGP
Sbjct  74   IAAEVIHSDEINVNFKQIGGLDHIIQDLRESVIYPLCYPELFTSASGLLGAPRGVLLYGP  133

Query  435  PGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEV  614
            PG GKTMLAKA+AKES A FIN+ +S L  K++G++ KLV+AVF+LA KLQP+I+FIDE+
Sbjct  134  PGCGKTMLAKALAKESGATFINIHVSTLTDKYYGESNKLVSAVFTLARKLQPSIVFIDEI  193

Query  615  DSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            DSFL +R+STDHE    MK EFM+LWDG TT
Sbjct  194  DSFLRERRSTDHETTGMMKAEFMSLWDGLTT  224



>emb|CEP18180.1| hypothetical protein [Parasitella parasitica]
Length=355

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 130/186 (70%), Gaps = 1/186 (1%)
 Frame = +3

Query  153  LDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIK  332
            LDP +   ++A      +  +LG   ++   YE +IA +VI+ D I V F  IGGL+ I 
Sbjct  21   LDPTKAKRQEAKAKSNRVLGKLGAKDLKLTEYEQIIAAEVIHSDEISVNFKQIGGLDHII  80

Query  333  QALYELVILPLQRPELFSHGK-LLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKI  509
            Q L E VI PL  PELF+    LLG  +GVLLYGPPG GKTMLAKA+AKES A FIN+ +
Sbjct  81   QDLRESVIYPLCYPELFTSASGLLGAPRGVLLYGPPGCGKTMLAKALAKESGATFINIHV  140

Query  510  SNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMAL  689
            S L  K++G++ KLV+AVFSLA KLQP+I+FIDE+DSFL +R+STDHE    MK EFM+L
Sbjct  141  STLTDKYYGESNKLVSAVFSLARKLQPSIVFIDEIDSFLRERRSTDHETTGMMKAEFMSL  200

Query  690  WDGFTT  707
            WDG TT
Sbjct  201  WDGLTT  206



>ref|XP_006682309.1| hypothetical protein BATDEDRAFT_91915 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77198.1| hypothetical protein BATDEDRAFT_91915 [Batrachochytrium dendrobatidis 
JAM81]
Length=377

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 147/215 (68%), Gaps = 9/215 (4%)
 Frame = +3

Query  84   QELVLYAASAAISCLVLFVGLR----HLDP--NREASKKALENKKEIAKRLGRPLIQTNT  245
            +++V      A+S + L+ G++     LDP  N+ A  K+  NK  I  +LG   ++ N 
Sbjct  30   KKIVFDVTLLALSQVALYYGVKWVISSLDPMRNKRADSKSKSNK--IMSKLGLHDMKLNE  87

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVL  422
            +E++I+ +++ P+ + V F  IGGLE I  +L E VI PL  PELF S   L GP KGVL
Sbjct  88   HEEIISGEIVWPEDLTVGFEDIGGLEPIIDSLKETVIYPLVYPELFESTSSLFGPPKGVL  147

Query  423  LYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF  602
            LYGPPG GKTMLAKA+AKES A FIN+ +S L  KWFG++QKLV A+FS+A KLQP I+F
Sbjct  148  LYGPPGCGKTMLAKALAKESGACFINLHVSTLTEKWFGESQKLVNALFSIAKKLQPTIVF  207

Query  603  IDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IDE+D+FL +R+S DHEA + MK+EFM LWDG  +
Sbjct  208  IDEIDAFLRERRSNDHEATSMMKSEFMTLWDGLAS  242



>ref|XP_002596223.1| hypothetical protein BRAFLDRAFT_202938 [Branchiostoma floridae]
 gb|EEN52235.1| hypothetical protein BRAFLDRAFT_202938, partial [Branchiostoma 
floridae]
Length=303

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 137/207 (66%), Gaps = 0/207 (0%)
 Frame = +3

Query  90   LVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACD  269
            L+  AASAAIS   L   +  +DP R+   +A +   +I K+LG   ++ N YE  IA  
Sbjct  10   LLKMAASAAISYYTLKWLMDQVDPTRKQKVEAKKKANQIMKKLGITGVRLNEYELTIAAH  69

Query  270  VINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGK  449
            +++P  + V +  I GLE     L E VI+P Q+  +F   +LL P KGVLLYGPPG GK
Sbjct  70   LVDPGSMTVSWTDIAGLEDTISELQETVIVPFQKHSMFEGSQLLQPPKGVLLYGPPGCGK  129

Query  450  TMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLG  629
            TM+AKA AKE+   FIN++ S L  KW+G++Q+L +AVF LA K+QPAIIFIDE+DSFL 
Sbjct  130  TMIAKATAKEAGCRFINLQPSVLTDKWYGESQRLASAVFHLATKIQPAIIFIDEIDSFLR  189

Query  630  QRKSTDHEALTNMKTEFMALWDGFTTD  710
            QR+S DHEA   MK EFM+LWDG  T+
Sbjct  190  QRQSQDHEATAMMKAEFMSLWDGLATN  216



>gb|KIM66696.1| hypothetical protein SCLCIDRAFT_1211084 [Scleroderma citrinum 
Foug A]
Length=391

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 141/210 (67%), Gaps = 5/210 (2%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYED  254
            +I+ ++ L+ AS A     +F  +R L       K   + + E+ K+LG   ++ + YE 
Sbjct  9    RIILDVALFVASQA----AVFYAIRWLMDRHTTDKDTDKRRAEVMKKLGHHNLKLDEYER  64

Query  255  VIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLLYG  431
             IA +V++PDHI+V F  IGGL++I  +L E +I PL  P LF S   LLG  KGVLLYG
Sbjct  65   TIASEVVHPDHINVGFEDIGGLDSIISSLRESIIYPLLYPALFTSTSSLLGAPKGVLLYG  124

Query  432  PPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDE  611
            PPG GKTMLA+A+AKES A FINV  S L +KWFG++ KLVA +FSLA K+QPAIIF+DE
Sbjct  125  PPGCGKTMLARALAKESGATFINVAASVLTNKWFGESNKLVAGLFSLARKVQPAIIFVDE  184

Query  612  VDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            +D+FL +R+S DHE +  MK EFM  WDG 
Sbjct  185  IDTFLRERRSDDHEVMGMMKAEFMTSWDGL  214



>emb|CCO30742.1| putative AAA domain-containing protein C24B10,10c [Rhizoctonia 
solani AG-1 IB]
Length=332

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 130/189 (69%), Gaps = 1/189 (1%)
 Frame = +3

Query  144  LRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLE  323
            +  LDP +E  K A     ++  RLG   ++   YE++IA +VI+P  I   F  IGGL+
Sbjct  1    MSSLDPQQEKRKAAKAKSAKVLDRLGVKELELTEYEEIIAAEVIHPSDITTGFEDIGGLD  60

Query  324  AIKQALYELVILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFIN  500
             I  +L E VI PL  PELF S+G LLG  KGVLLYGPPG GKTMLAKA+AKES A FIN
Sbjct  61   PIISSLRESVIYPLCYPELFASNGGLLGAPKGVLLYGPPGCGKTMLAKALAKESNATFIN  120

Query  501  VKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEF  680
            + +S L +KW+G++ KLVA +FSLA K+QPAIIFIDE+DSFLG+R   DHE    MK EF
Sbjct  121  IAVSVLTNKWYGESNKLVAGLFSLARKMQPAIIFIDEIDSFLGERGRGDHEVTGMMKAEF  180

Query  681  MALWDGFTT  707
            M LWDG  +
Sbjct  181  MTLWDGLAS  189



>ref|XP_006959407.1| AAA-domain-containing protein [Wallemia sebi CBS 633.66]
 gb|EIM20621.1| AAA-domain-containing protein [Wallemia sebi CBS 633.66]
Length=354

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 136/209 (65%), Gaps = 9/209 (4%)
 Frame = +3

Query  99   YAASAAISCLVLFVGLRHL----DPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIAC  266
            +AA  A    V+F  LR++    DP +   +       +I  RLGR  I  N YE++IAC
Sbjct  3    FAAGQA----VIFYTLRYILNSNDPLKSKRQGTKSKSAQILDRLGRNDITLNEYEEIIAC  58

Query  267  DVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKGVLLYGPPGT  443
            +++ P+ I+  F  IGGL+ I   L E VI PL+ P LFS  + LL P KGVLLYGPPG 
Sbjct  59   EIVLPEEINTTFEDIGGLQHIVSNLKENVIYPLKLPSLFSGSQNLLSPPKGVLLYGPPGC  118

Query  444  GKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSF  623
            GKTMLAKA+AKES A FIN+ +S L  KWFG++ KLVA +FSLA K QP+IIFIDE+DSF
Sbjct  119  GKTMLAKALAKESNATFINMHVSTLTDKWFGESNKLVAGLFSLAKKCQPSIIFIDEIDSF  178

Query  624  LGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            L +R   DHE    MK EFM  WDG +++
Sbjct  179  LRERGRGDHEVTNMMKAEFMTFWDGLSSE  207



>emb|CCA26236.1| ATPase putative [Albugo laibachii Nc14]
Length=424

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = +3

Query  213  RLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SH  389
            R GR   QT  +EDVIA D+++P  I V F+ IGGLE+ K+ +Y+LVILPL+ P  F + 
Sbjct  81   RSGRATFQTTFHEDVIAGDIVDPFDIPVTFDDIGGLESQKRDIYDLVILPLKCPRFFNTR  140

Query  390  GKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFS  569
            GKLL   KG+LLYG PGTGKTMLAKAIAKES A FI++KIS LMSKWFG++QKLV A FS
Sbjct  141  GKLLSVPKGILLYGKPGTGKTMLAKAIAKESGAFFIDLKISTLMSKWFGESQKLVRAAFS  200

Query  570  LAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            LA KL P IIFIDEVDSF+G+R        + MKTEF+ALWDGF
Sbjct  201  LASKLAPCIIFIDEVDSFMGKRGGASDPTYSTMKTEFLALWDGF  244



>dbj|GAN06580.1| AAA-domain-containing protein [Mucor ambiguus]
Length=373

 Score =   207 bits (527),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 139/211 (66%), Gaps = 8/211 (4%)
 Frame = +3

Query  99   YAASAAI---SCLVLFVGLR----HLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDV  257
            YAA  A+   S +  +   +     LDP +   ++A      +  +LG   ++   YE +
Sbjct  14   YAADVAVFALSQVAFYFAFKFVVGSLDPTKAKRQEAKAKSNRVLGKLGAKDLKLTEYEQI  73

Query  258  IACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKGVLLYGP  434
            IA +VI+ D I V F  IGGL+ I Q L E VI PL  PELF+    LLG  +GVLLYGP
Sbjct  74   IAAEVIHSDEITVNFKQIGGLDHIIQDLRESVIYPLCYPELFTSASGLLGAPRGVLLYGP  133

Query  435  PGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEV  614
            PG GKTMLAKA+AKES A FIN+ +S L  K++G++ KLV+AVF+LA KLQP+I+FIDE+
Sbjct  134  PGCGKTMLAKALAKESGATFINIHVSTLTDKYYGESNKLVSAVFTLARKLQPSIVFIDEI  193

Query  615  DSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            DSFL +R+STDHE    MK EFM+LWDG TT
Sbjct  194  DSFLRERRSTDHETTGMMKAEFMSLWDGLTT  224



>dbj|GAC73746.1| AAA+-type ATPase [Pseudozyma antarctica T-34]
Length=459

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 146/217 (67%), Gaps = 9/217 (4%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGR-----PLIQT  239
            K++ ++ L+A S           +  LDPNR+   K  + KK    +LG+       ++ 
Sbjct  72   KMMTDVALFAMSQVAFYYAFKYVMSSLDPNRQ---KRQDTKKVADAKLGKLGLRGKDLEL  128

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            N YE+ I+ ++I P+ I V+F SIGGL+ I  +L E VI PL  PELF++   LLG  KG
Sbjct  129  NEYEEQISAELILPEDIPVDFASIGGLDGIISSLQESVIAPLCYPELFANASGLLGAPKG  188

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVAA+FSLA KLQP+I
Sbjct  189  VLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVAALFSLARKLQPSI  248

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DSFL +R + DHE    MK EFM LWDG T+
Sbjct  249  IFIDEIDSFLRERATGDHEVTGMMKAEFMTLWDGLTS  285



>emb|CCU99686.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=333

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = +3

Query  153  LDPNREASKKALENKKEIAKRLG--RPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEA  326
            +DPN +    A +       +LG  R  ++ N YE+ IA ++I PD I V F SIGGL+ 
Sbjct  1    MDPNHQKKSDAKKVSDTKLGKLGINRKEVKLNEYEEQIAMELILPDDIPVTFESIGGLDG  60

Query  327  IKQALYELVILPLQRPELFSHGK-LLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINV  503
            I  +L E VI PL  PE+FS    LLG  KGVLLYGPPGTGKTMLAKA+AKES A FIN+
Sbjct  61   IIASLQESVIAPLIFPEIFSTTNGLLGAPKGVLLYGPPGTGKTMLAKALAKESGATFINM  120

Query  504  KISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFM  683
             +S L +KWFG++ KLVAA+F LA KLQP I+FIDE+DSFL +R S DHEA+  MK EFM
Sbjct  121  HVSTLTNKWFGESNKLVAALFGLARKLQPTIVFIDEIDSFLRERSSGDHEAMAMMKAEFM  180

Query  684  ALWDGFTT  707
             LWDG T+
Sbjct  181  TLWDGLTS  188



>gb|ETS63750.1| hypothetical protein PaG_02066 [Pseudozyma aphidis DSM 70725]
Length=459

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 146/217 (67%), Gaps = 9/217 (4%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGR-----PLIQT  239
            K++ ++ L+A S           +  LDPNR+   K  + KK    +LG+       ++ 
Sbjct  72   KMMTDVALFAMSQVAFYYAFKYVMSSLDPNRQ---KRQDTKKVADAKLGKLGLRGKDLEL  128

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            N YE+ I+ ++I P+ I V+F SIGGL+ I  +L E VI PL  PELF++   LLG  KG
Sbjct  129  NEYEEQISAELILPEDIPVDFASIGGLDGIISSLQESVIAPLCYPELFANASGLLGAPKG  188

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLVAA+FSLA KLQP+I
Sbjct  189  VLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVAALFSLARKLQPSI  248

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DSFL +R + DHE    MK EFM LWDG T+
Sbjct  249  IFIDEIDSFLRERATGDHEVTGMMKAEFMTLWDGLTS  285



>gb|KFM58058.1| ATPase family AAA domain-containing protein 1-B, partial [Stegodyphus 
mimosarum]
Length=339

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 134/189 (71%), Gaps = 0/189 (0%)
 Frame = +3

Query  144  LRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLE  323
            ++ +DP R+   +A +  + I  R+G   +Q + YE  IA  +++P  I++ +N I GL+
Sbjct  38   VKAIDPTRKQKLEAQKRAERILNRIGVKNVQLSEYELSIAAQLVDPTTINISWNDIAGLD  97

Query  324  AIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINV  503
             I Q + E VILP+QR ELFS   L+ P KGVLL+GPPG GKTM+AKA AKE+ A FIN+
Sbjct  98   DIIQEIRETVILPIQRRELFSGSMLIQPPKGVLLHGPPGCGKTMIAKATAKEAGARFINL  157

Query  504  KISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFM  683
            ++S+L  KW+G++QKL AAVF+LA K+QP IIFIDE+DSFL  R + DHEA   MK +FM
Sbjct  158  EVSSLTDKWYGESQKLAAAVFTLALKIQPCIIFIDEIDSFLRSRDTYDHEATAMMKAQFM  217

Query  684  ALWDGFTTD  710
            +LWDG  TD
Sbjct  218  SLWDGLITD  226



>ref|XP_007867103.1| AAA-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ54875.1| AAA-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=361

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 137/216 (63%), Gaps = 1/216 (0%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTN  242
            +S  + L ++ L+ AS A     L   +    P R+  K+     K+   RLG   ++ N
Sbjct  5    ASTKRTLVDVALFLASQAALYYTLTWAVERFLPERQTRKEVSAKSKDALDRLGHKDLELN  64

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGV  419
             YE  IA +VI+PD I+V F+ IGGLE I  +L E VI PL  P+LF S   LL   KGV
Sbjct  65   EYEKAIAAEVIHPDDINVRFSDIGGLEPIISSLRESVIYPLLYPKLFTSSSSLLTAPKGV  124

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPG GKTMLAKA+AKES A FIN+  S L +KW+G++ KLVA +F LA K QP+I+
Sbjct  125  LLYGPPGCGKTMLAKALAKESGATFINIAASVLTNKWYGESNKLVAGLFGLARKTQPSIV  184

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            FIDE+DSFL +R   DHE    MK EFM LWDG T+
Sbjct  185  FIDEIDSFLRERTKGDHEVTGMMKAEFMTLWDGLTS  220



>ref|XP_011059003.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Acromyrmex echinatior]
 gb|EGI62743.1| ATPase family AAA domain-containing protein 1 [Acromyrmex echinatior]
Length=378

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 142/221 (64%), Gaps = 12/221 (5%)
 Frame = +3

Query  84   QELVLYAASAAISCLVLFVGLR----HLDPNR----EASKKALENKKEIAK--RLGRP--  227
            QE+++  A       + F  +R     LDP R     A KKA E  +++A+  R  R   
Sbjct  12   QEVLMLVARLTCVAAIGFFSMRWLISQLDPTRSTKQRAKKKAREQLRKLAESDRYARSFD  71

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            L Q   YE +IA  +I+P  I V ++SI GL+++ Q L E VILP+QR ELF   +L   
Sbjct  72   LDQLTDYEMIIANHLIDPSDIKVSWSSIAGLDSVIQELKETVILPIQRKELFEDSQLTQA  131

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPG GKTM+AKA A+E++  FIN+ +S L  KW+G++QKL AAVFSLA KLQ
Sbjct  132  PKGVLLYGPPGCGKTMMAKATAREAKTRFINLDVSILTDKWYGESQKLAAAVFSLAVKLQ  191

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P IIFIDE+DSFL  R S DHEA   MK +FM+LWDG  TD
Sbjct  192  PCIIFIDEIDSFLRSRNSQDHEATAMMKAQFMSLWDGLITD  232



>ref|XP_012056822.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Atta cephalotes]
Length=378

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 142/221 (64%), Gaps = 12/221 (5%)
 Frame = +3

Query  84   QELVLYAASAAISCLVLFVGLR----HLDPNR----EASKKALENKKEIAK--RLGRP--  227
            QE+++  A       + F  +R     LDP R     A KKA E  +++A+  R  R   
Sbjct  12   QEVLMLVARLTCVAAIGFFSMRWLISQLDPTRSTKQRAKKKAREQLRKLAESDRYARSFD  71

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            L Q   YE +IA  +I+P  I V ++SI GL+++ Q L E VILP+QR ELF   +L   
Sbjct  72   LDQLTDYEMIIANHLIDPSDIKVSWSSIAGLDSVIQELKETVILPIQRKELFEDSQLTQA  131

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPG GKTM+AKA A+E++  FIN+ +S L  KW+G++QKL AAVFSLA KLQ
Sbjct  132  PKGVLLYGPPGCGKTMMAKATAREAKTRFINLDVSILTDKWYGESQKLAAAVFSLAVKLQ  191

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P IIFIDE+DSFL  R S DHEA   MK +FM+LWDG  TD
Sbjct  192  PCIIFIDEIDSFLRSRNSQDHEATAMMKAQFMSLWDGLITD  232



>gb|EKC24532.1| ATPase family AAA domain-containing protein 1 [Crassostrea gigas]
Length=352

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 133/189 (70%), Gaps = 0/189 (0%)
 Frame = +3

Query  144  LRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLE  323
            L  +DP R+  K A +  KE+ KR+G   ++   YE   A D+I P  +DV ++ IGG+E
Sbjct  60   LDMMDPTRKEKKSAEKRAKELMKRIGVSGVKLTDYELCFAADLIEPARLDVSWDDIGGME  119

Query  324  AIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINV  503
             + +++ E VI P +R +LF +  LL P KG+LL+GPPG GKTM+AKAIAK++ A FIN 
Sbjct  120  DVIRSIKETVIFPFKRRDLFQNSYLLQPPKGLLLHGPPGCGKTMVAKAIAKDAGARFINF  179

Query  504  KISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFM  683
            K+S+++ KW+G++QK   AVF+LA KLQPAIIFIDE+DSFL  R S DHEA   +K +FM
Sbjct  180  KVSSMVDKWYGESQKRAEAVFTLAIKLQPAIIFIDEIDSFLRSRSSQDHEATAMIKAQFM  239

Query  684  ALWDGFTTD  710
            ++WDG  TD
Sbjct  240  SMWDGIITD  248



>ref|XP_011695750.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Wasmannia auropunctata]
 ref|XP_011695751.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Wasmannia auropunctata]
 ref|XP_011695752.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Wasmannia auropunctata]
Length=378

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 143/221 (65%), Gaps = 12/221 (5%)
 Frame = +3

Query  84   QELVLYAASAAISCLVLFVGLR----HLDPNR----EASKKALENKKEIAK--RLGRP--  227
            QE+++  A       + F  +R     LDP R     A KKA E  +++A+  R  R   
Sbjct  12   QEVLMLVARLTCVAAIGFFSMRWLISQLDPTRSTKQRAKKKAREQLRKLAESDRYARSFD  71

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            + Q   YE +IA  +++P+ I V ++SI GL+++ Q L E VILP+QR ELF   +L   
Sbjct  72   MDQLTDYEMIIANHLVDPNDIKVSWSSIAGLDSVIQELKETVILPIQRKELFEDSQLTQA  131

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPG GKTM+AKA A+E++  FIN+ +S L  KW+G++QKL AAVFSLA KLQ
Sbjct  132  PKGVLLYGPPGCGKTMIAKATAREAKTRFINLDVSILTDKWYGESQKLAAAVFSLAVKLQ  191

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P IIFIDE+DSFL  R S DHEA   MK +FM+LWDG  TD
Sbjct  192  PCIIFIDEIDSFLRSRNSQDHEATAMMKAQFMSLWDGLITD  232



>gb|KIJ54509.1| hypothetical protein M422DRAFT_200318 [Sphaerobolus stellatus 
SS14]
Length=361

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = +3

Query  204  IAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF  383
            + KRLGR  IQ N YE +IA +VI+PD I V+F+ IGGLE+I  +L E VI PL  P LF
Sbjct  50   VMKRLGRDKIQLNEYEQIIAAEVIHPDDITVKFSDIGGLESIISSLRESVIYPLVYPTLF  109

Query  384  -SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAA  560
             S   LL   KGVLLYGPPG GKTMLAKA+AKES A FIN+ +S L +KW+G++ KLVA 
Sbjct  110  TSSSSLLAAPKGVLLYGPPGCGKTMLAKALAKESGATFINIAMSVLSNKWYGESNKLVAG  169

Query  561  VFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            +F LA K+QP+IIFIDE+DSFL +R   DHE    MK EFM LWDG 
Sbjct  170  LFGLARKMQPSIIFIDEIDSFLRERSKGDHEVTAMMKAEFMTLWDGL  216



>ref|XP_011413741.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Crassostrea gigas]
Length=384

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 133/189 (70%), Gaps = 0/189 (0%)
 Frame = +3

Query  144  LRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLE  323
            L  +DP R+  K A +  KE+ KR+G   ++   YE   A D+I P  +DV ++ IGG+E
Sbjct  60   LDMMDPTRKEKKSAEKRAKELMKRIGVSGVKLTDYELCFAADLIEPARLDVSWDDIGGME  119

Query  324  AIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINV  503
             + +++ E VI P +R +LF +  LL P KG+LL+GPPG GKTM+AKAIAK++ A FIN 
Sbjct  120  DVIRSIKETVIFPFKRRDLFQNSYLLQPPKGLLLHGPPGCGKTMVAKAIAKDAGARFINF  179

Query  504  KISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFM  683
            K+S+++ KW+G++QK   AVF+LA KLQPAIIFIDE+DSFL  R S DHEA   +K +FM
Sbjct  180  KVSSMVDKWYGESQKRAEAVFTLAIKLQPAIIFIDEIDSFLRSRSSQDHEATAMIKAQFM  239

Query  684  ALWDGFTTD  710
            ++WDG  TD
Sbjct  240  SMWDGIITD  248



>ref|XP_001634116.1| predicted protein [Nematostella vectensis]
 gb|EDO42053.1| predicted protein [Nematostella vectensis]
Length=315

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 143/209 (68%), Gaps = 8/209 (4%)
 Frame = +3

Query  108  SAAISCLVL----FVGLRHL----DPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIA  263
            SAAI  L+L    + G++ L    DP R++   A +  +++ K +G   +Q + YE  IA
Sbjct  10   SAAIQVLLLGAFTYYGVKWLMEAMDPTRKSRMAAQKQAEQLLKLIGADGVQLSEYELAIA  69

Query  264  CDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGT  443
             D+++P  + ++++ IGGL    Q + E +ILP+Q+  +FS  KLL P KGVLL+GPPG 
Sbjct  70   ADLVDPLSLPIQWSHIGGLHETIQDVKETIILPIQKSHIFSKSKLLSPPKGVLLHGPPGC  129

Query  444  GKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSF  623
            GKTM+AKA AKE+   F+N+++S+L  KW+G++QKL AAVFSLA KLQP IIFIDE+DSF
Sbjct  130  GKTMIAKATAKEAGCRFLNLQVSSLTDKWYGESQKLAAAVFSLALKLQPCIIFIDEIDSF  189

Query  624  LGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            L  R  +DHEA   MK +FM+LWDG  T+
Sbjct  190  LRARDKSDHEATAMMKAQFMSLWDGLVTE  218



>ref|XP_004994607.1| hypothetical protein PTSG_04511 [Salpingoeca rosetta]
 gb|EGD72784.1| hypothetical protein PTSG_04511 [Salpingoeca rosetta]
Length=375

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 144/214 (67%), Gaps = 2/214 (1%)
 Frame = +3

Query  72   TKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYE  251
            T++L  L+    S+ +  L++ V  + +DP+ + S++A +   +  +RL +  ++ N +E
Sbjct  7    TRLLTSLMAAGLSSIMFYLLMRVLYKQMDPSHKRSQEAKQAANKALRRL-KSKVKLNEHE  65

Query  252  DVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHG-KLLGPQKGVLLY  428
             +IA DV++P  +   F  +GGLE   Q L E ++LP  RPELF    +LL P KG+LL+
Sbjct  66   TIIAADVVDPADLPETFEDVGGLEKTVQMLTEEIVLPFTRPELFQQASQLLQPPKGLLLF  125

Query  429  GPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFID  608
            GPPG GKT+LA+A+AKE    FINV+ S  M KWFG++QKLV A+F+LA KLQP+IIFID
Sbjct  126  GPPGCGKTLLARALAKECGCCFINVRPSTFMDKWFGESQKLVEAIFTLAAKLQPSIIFID  185

Query  609  EVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            E+D+FL  R S DHE+   +K +FM LWDGF +D
Sbjct  186  EIDAFLRTRSSLDHESSAVIKAQFMTLWDGFASD  219



>ref|XP_011259169.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Camponotus floridanus]
 ref|XP_011259170.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Camponotus floridanus]
 ref|XP_011259171.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Camponotus floridanus]
 gb|EFN66468.1| ATPase family AAA domain-containing protein 1-B [Camponotus floridanus]
Length=378

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 143/221 (65%), Gaps = 12/221 (5%)
 Frame = +3

Query  84   QELVLYAASAAISCLVLFVGLR----HLDPNR----EASKKALENKKEIAK--RLGRP--  227
            Q++++  A       + F  +R     LDP R     A KKA E  +++A+  R  R   
Sbjct  12   QDMLMLVARLTCVAAIGFFSVRWLITQLDPTRSTKQRAKKKAREQLRKLAESDRYARSFD  71

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            + Q   YE +IA  +++P+ I + +N+I GL+++ Q L E VILP+QR ELF   +L   
Sbjct  72   MDQLTDYEMIIANHLVDPNDIKISWNNIAGLDSVIQELKETVILPIQRKELFEDSQLTQA  131

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPG GKTM+AKA A+E++  FIN+ +S L  KW+G++QKL AAVFSLA KLQ
Sbjct  132  PKGVLLYGPPGCGKTMIAKATAREAKTRFINLDVSILTDKWYGESQKLAAAVFSLAVKLQ  191

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P IIFIDE+DSFL  R S DHEA   MK +FM+LWDG  TD
Sbjct  192  PCIIFIDEIDSFLRARNSQDHEATAMMKAQFMSLWDGLITD  232



>gb|KIL67766.1| hypothetical protein M378DRAFT_9045 [Amanita muscaria Koide BX008]
Length=331

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTNT  245
            S+  +L   +  A+ AA+   + ++    L P R +  K  E ++E  KRLG   ++ + 
Sbjct  6    SKRAVLDVALFLASQAALYYTIRWIFDSTLSPERRSEVK--EKQQEALKRLGHANLKLDE  63

Query  246  YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVL  422
            YE  +A +VI+PD I+V F+ IGGL+ I + L E VI PL  P LF S   LL   KGVL
Sbjct  64   YERTVANEVIHPDDINVTFSDIGGLDPIVEHLREAVIYPLLYPNLFTSTSSLLSAPKGVL  123

Query  423  LYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIF  602
            LYGPPG GKTMLAKA+AKES A FIN+  S L +KW+G++ KLVA +FSLA K QP+IIF
Sbjct  124  LYGPPGCGKTMLAKALAKESGATFINIAASVLTNKWYGESNKLVAGLFSLARKTQPSIIF  183

Query  603  IDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IDE+DSFL +R   DHE    MK EFM LWDG T+
Sbjct  184  IDEIDSFLRERTKGDHEVTGMMKAEFMTLWDGLTS  218



>ref|XP_008604991.1| hypothetical protein SDRG_01252 [Saprolegnia diclina VS20]
 gb|EQC41277.1| hypothetical protein SDRG_01252 [Saprolegnia diclina VS20]
Length=419

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 130/181 (72%), Gaps = 5/181 (3%)
 Frame = +3

Query  171  ASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYEL  350
            ASK  L+ + + A+R   P+   N YE +IA D+++P  + V F+ IGGLE  K+ L++L
Sbjct  67   ASKAKLKRRLQKAQR---PVFSMNHYESIIAGDLVDPSELGVGFDDIGGLEDQKRELHDL  123

Query  351  VILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKW  530
            V+LPLQ PE F   KLL    G+LLYG PGTGKT+LAKAIAKES A FIN+KIS LMSKW
Sbjct  124  VVLPLQSPEYF-QSKLLSVPNGILLYGRPGTGKTLLAKAIAKESGAFFINLKISTLMSKW  182

Query  531  FGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTN-MKTEFMALWDGFTT  707
            FG++QKLV A FSLA KL P IIFIDEVDSF+G R S   +   N MKTEFMALWDGF  
Sbjct  183  FGESQKLVKAAFSLAQKLSPCIIFIDEVDSFMGARSSGASDPTYNSMKTEFMALWDGFVE  242

Query  708  D  710
            +
Sbjct  243  N  243



>ref|XP_011159910.1| PREDICTED: ATPase family AAA domain-containing protein 1-B-like 
[Solenopsis invicta]
 gb|EFZ18112.1| hypothetical protein SINV_08849, partial [Solenopsis invicta]
Length=378

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 143/227 (63%), Gaps = 8/227 (4%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNR----EASKKALENKKEIAK--R  215
              G +  ++L  L      AAI    +   +  LDP R     A KKA E  +++A+  R
Sbjct  6    SAGLTRQEVLMLLARLTCVAAIGFFSMRWLISQLDPTRSTKQRAKKKAQEQLRKLAESDR  65

Query  216  LGRP--LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSH  389
              R   + Q   YE +IA  +++P+ I V ++SI GL+ + Q L E VILP+Q+ ELF  
Sbjct  66   YARSFDMNQLTDYEMIIANHLVDPNDIKVSWSSIAGLDNVIQELKETVILPIQKKELFED  125

Query  390  GKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFS  569
             +L    KGVLLYGPPG GKTM+AKA A+E++  FIN+ +S L  KW+G++QKL AAVFS
Sbjct  126  SQLTQAPKGVLLYGPPGCGKTMIAKATAREAKTRFINLDVSILTDKWYGESQKLAAAVFS  185

Query  570  LAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            LA KLQP IIFIDE+DSFL  R S DHEA   MK +FM+LWDG  TD
Sbjct  186  LAVKLQPCIIFIDEIDSFLRSRNSQDHEATAMMKAQFMSLWDGLITD  232



>gb|KIR42926.1| ATPase [Cryptococcus gattii Ram5]
 gb|KIY55502.1| ATPase [Cryptococcus gattii 99/473]
Length=370

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 136/217 (63%), Gaps = 6/217 (3%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT-----  239
            ++L ++  +AAS       L   +  LDP   +SKKA E  K +  + G    Q      
Sbjct  8    RVLMDVAFFAASQVALYYTLRYVVSSLDPTSGSSKKAQEKSKNLLAQTGLSEAQLASLEL  67

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            + YE  IA +++ P  IDV F  IGGL+ I  +L E VI PL  PELF  G  LL   KG
Sbjct  68   DEYEQTIAAEIVPPSSIDVTFEGIGGLDDIIASLRETVIYPLTFPELFGSGNGLLSAPKG  127

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYG PG GKTMLAKA+AKES A FIN+ +S+L +KWFG++ KLVA +FSLA KLQP+I
Sbjct  128  VLLYGHPGCGKTMLAKALAKESGATFINLPLSSLTNKWFGESNKLVAGLFSLAKKLQPSI  187

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DS   +R + DHE    MK EFM LWDG TT
Sbjct  188  IFIDEIDSLFRERSAGDHEVTAMMKAEFMTLWDGLTT  224



>ref|XP_003033705.1| hypothetical protein SCHCODRAFT_81603 [Schizophyllum commune 
H4-8]
 gb|EFI98802.1| hypothetical protein SCHCODRAFT_81603 [Schizophyllum commune 
H4-8]
Length=326

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 122/172 (71%), Gaps = 1/172 (1%)
 Frame = +3

Query  195  KKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRP  374
            K E  KRLG   I+ + YE  IA ++I+PD IDV F+ IGGL+ I   L E VI PL  P
Sbjct  19   KIEALKRLGHHNIELDEYESTIANEIIHPDDIDVRFSDIGGLDPIVSTLRESVIYPLLYP  78

Query  375  ELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKL  551
            ELF S   LL   KGVLL+GPPG GKTMLAKA+AKESRA FIN+  S L SKW+G++ KL
Sbjct  79   ELFRSSNALLSAPKGVLLFGPPGCGKTMLAKALAKESRATFINIAASALASKWYGESNKL  138

Query  552  VAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            VA +FSLA K+QP+IIFIDE+DSFL +R   DHEA   +K EFM LWDG  +
Sbjct  139  VAGLFSLARKVQPSIIFIDEIDSFLRERSKNDHEATGMLKAEFMTLWDGLMS  190



>ref|XP_011636456.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Pogonomyrmex barbatus]
 ref|XP_011636457.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Pogonomyrmex barbatus]
Length=378

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 139/221 (63%), Gaps = 12/221 (5%)
 Frame = +3

Query  84   QELVLYAASAAISCLVLFVGLR----HLDPNREASKKALENKKEIAKRLGRP--------  227
            QE+++  A       + F  +R     LDP R   ++A +  +E  ++L           
Sbjct  12   QEVLMLVARLTCVAAIGFFSMRWLITQLDPTRSTKQRAKKKAREQLRKLAESDKYARSFD  71

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            + Q   YE +IA  +++P+ I + +++I GL+ I Q L E VILP+QR ELF   +L   
Sbjct  72   MDQLTDYEMIIANHLVDPNDIKISWSNIAGLDNIIQELKETVILPIQRKELFEDSQLTQA  131

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPG GKTM+AKA A+E++  FIN+ +S L  KW+G++QKL AAVFSLA KLQ
Sbjct  132  PKGVLLYGPPGCGKTMIAKATAREAKTRFINLDVSILTDKWYGESQKLAAAVFSLAMKLQ  191

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P IIFIDE+DSFL  R S DHEA   MK +FM+LWDG  TD
Sbjct  192  PCIIFIDEIDSFLRSRNSQDHEATAMMKAQFMSLWDGLITD  232



>gb|KIK14103.1| hypothetical protein PISMIDRAFT_688202 [Pisolithus microcarpus 
441]
Length=345

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 127/176 (72%), Gaps = 1/176 (1%)
 Frame = +3

Query  177  KKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVI  356
            K A + + E+ K+LG   ++ + YE  IA +V++PDHI V F  IGGL++I  +L E +I
Sbjct  8    KDAEKRRTEVMKKLGHHNLKLDDYERTIALEVVHPDHITVGFEDIGGLDSIISSLRESII  67

Query  357  LPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWF  533
             PL  P LF S   LLG  KGVLLYGPPG GKTMLA+A+AKES A FINV  S L +KWF
Sbjct  68   YPLLYPTLFTSTSSLLGAPKGVLLYGPPGCGKTMLARALAKESGATFINVAASVLTNKWF  127

Query  534  GDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            G++ KLVAA+FSLA K+QPAIIF+DE+D+FL +R+S DHE +  MK EFM  WDG 
Sbjct  128  GESNKLVAALFSLARKVQPAIIFVDEIDTFLRERRSDDHEVMGMMKAEFMTSWDGL  183



>gb|KIJ15034.1| hypothetical protein PAXINDRAFT_78055 [Paxillus involutus ATCC 
200175]
Length=369

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = +3

Query  171  ASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYEL  350
            A K+  + + E+ K++G   ++ + YE  IA +VI+PD+I V F+ IGGL+ I  +L E 
Sbjct  6    ADKETEKRRTEVMKKMGHKGLKLDEYERTIAKEVIHPDNISVRFDDIGGLDPIVSSLRES  65

Query  351  VILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSK  527
            VI PL  P +F S   LLG  KGVLLYGPPG GKTMLA+A+AKES A FIN+  S L +K
Sbjct  66   VIYPLMYPNIFTSTSSLLGAPKGVLLYGPPGCGKTMLARALAKESGATFINIAASALTNK  125

Query  528  WFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            WFG++ KLVA +FSLA K+QPAIIF+DE+D+FL +R+S DHE +  MK EFM  WDG T+
Sbjct  126  WFGESNKLVAGLFSLARKMQPAIIFVDEIDTFLRERRSDDHEVMGMMKAEFMTSWDGLTS  185



>gb|KIJ59043.1| hypothetical protein HYDPIDRAFT_101433 [Hydnomerulius pinastri 
MD-312]
Length=370

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = +3

Query  171  ASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYEL  350
            A K++ + + E+ K+LG   ++ + YE  I+ +VI+PD+I V F  IGGL+ I  +L E 
Sbjct  6    ADKESEKRRTEVMKKLGHKGLKLDEYERTISKEVIHPDNITVRFEDIGGLDPIISSLRES  65

Query  351  VILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSK  527
            +I PL  P LF S   LLG  KGVLLYGPPG GKTMLA+A+AKES A FIN+  S L +K
Sbjct  66   IIYPLMYPTLFTSTSSLLGAPKGVLLYGPPGCGKTMLARALAKESGATFINIAASALTNK  125

Query  528  WFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            WFG++ KLVA +FSLA K+QPAIIF+DE+D+FL +R+S DHE +  MK EFM  WDG TT
Sbjct  126  WFGESNKLVAGLFSLARKVQPAIIFVDEIDTFLRERRSDDHEVMGMMKAEFMTSWDGLTT  185



>gb|KDO34988.1| hypothetical protein SPRG_01051 [Saprolegnia parasitica CBS 223.65]
Length=418

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 129/178 (72%), Gaps = 5/178 (3%)
 Frame = +3

Query  171  ASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYEL  350
            ASK  L+ + + A+R   P+   N YE +IA D+++P  + V F+ IGGLE  K+ L++L
Sbjct  65   ASKAKLKRRLQKAQR---PVFTMNHYESIIAGDLVDPSDLGVGFDDIGGLEDQKRELHDL  121

Query  351  VILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKW  530
            V+LPLQ PE F   KLL    G+LLYG PGTGKT+LAKAIAKES A FIN+KIS LMSKW
Sbjct  122  VVLPLQSPEYF-QSKLLSVPNGILLYGRPGTGKTLLAKAIAKESGAFFINLKISTLMSKW  180

Query  531  FGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTN-MKTEFMALWDGF  701
            FG++QKLV A FSLA KL P IIFIDEVDSF+G R S   +   N MKTEFMALWDGF
Sbjct  181  FGESQKLVKAAFSLAQKLAPCIIFIDEVDSFMGARSSGASDPTYNSMKTEFMALWDGF  238



>gb|KIY63841.1| AAA-domain-containing protein [Cylindrobasidium torrendii FP15055 
ss-10]
Length=343

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 123/180 (68%), Gaps = 2/180 (1%)
 Frame = +3

Query  171  ASKKALENKKEIA-KRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYE  347
             +KK +  K   A ++LG   +  + YE  IA +VI+PD I V F  IGGLE I  +L E
Sbjct  38   GTKKTVTGKSLAALQKLGHEKLDLDDYETTIANEVIHPDDIAVHFADIGGLEPIVSSLRE  97

Query  348  LVILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMS  524
             VI PL  P LF S   LLGP KGVLLYGPPG GKTMLAKA+AKES A FIN+  S L S
Sbjct  98   SVIYPLLYPSLFASSSALLGPPKGVLLYGPPGCGKTMLAKAMAKESGATFINISASTLTS  157

Query  525  KWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFT  704
            KWFGD+ KLV  +FSLA K QP+I+FIDE+DSFL +R S+DHE    MK EFM LWDG T
Sbjct  158  KWFGDSNKLVNGLFSLARKTQPSIVFIDEIDSFLRERASSDHEVTAMMKAEFMTLWDGLT  217



>ref|XP_008879528.1| hypothetical protein H310_13690 [Aphanomyces invadans]
 gb|ETV91891.1| hypothetical protein H310_13690 [Aphanomyces invadans]
Length=441

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = +3

Query  201  EIAKRLG---RPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQR  371
            ++ KRL    R  I  N YE +IA D+++P  + V F  IGGL+A K+ L+ELV+LPLQ 
Sbjct  79   KLKKRLAESKRATITMNHYESIIAADLVDPADLHVTFADIGGLDAQKRDLHELVVLPLQC  138

Query  372  PELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKL  551
            P+ F+  KLL   KG+LLYG PGTGKT+LAKAIAKES A FIN+KIS LMSKWFG++QKL
Sbjct  139  PDFFAQSKLLAVPKGILLYGRPGTGKTLLAKAIAKESDAFFINLKISTLMSKWFGESQKL  198

Query  552  VAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTN-MKTEFMALWDGF  701
            V A FSLA KL P IIFIDEVDSF+G R     +   N MKTEF+ALWDGF
Sbjct  199  VKAAFSLAKKLAPCIIFIDEVDSFMGARNGGASDPTYNSMKTEFLALWDGF  249



>ref|XP_005704010.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME27490.1| AAA-type ATPase [Galdieria sulphuraria]
Length=438

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 134/192 (70%), Gaps = 6/192 (3%)
 Frame = +3

Query  153  LDPNREASKKALENKKEIAKRLGR------PLIQTNTYEDVIACDVINPDHIDVEFNSIG  314
            LDP  E  K   + ++E+++RL +       L    + E V+A +++ PD +D +F ++G
Sbjct  48   LDPLHEQKKALRKKRQELSQRLRKLNSKAYDLDDLTSLEAVVAQELVLPDQLDADFTAVG  107

Query  315  GLEAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVF  494
            GL+ IK++L E V+LPL RPELFS   LL P KGVLLYGPPGTGKT+L KA+AK SRA F
Sbjct  108  GLKEIKESLEETVLLPLLRPELFSSSFLLSPTKGVLLYGPPGTGKTLLVKALAKASRASF  167

Query  495  INVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKT  674
            I +  S ++SKW G+  +LV A+FSLAYK+QP I+FIDE+DS   +R + DHEA  +MK 
Sbjct  168  IPISPSTILSKWVGETNQLVHAIFSLAYKIQPCILFIDEIDSLFRERSAYDHEAYRDMKA  227

Query  675  EFMALWDGFTTD  710
            EFM+LWDG  +D
Sbjct  228  EFMSLWDGLLSD  239



>emb|CCG81226.1| putative Membrane-spanning ATPase [Taphrina deformans PYCC 5710]
Length=381

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 140/221 (63%), Gaps = 10/221 (5%)
 Frame = +3

Query  66   SETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRL-----GRPL  230
            S + IL+  ++ AAS   + +  F  L  LDPN    K     ++E  KRL     G  L
Sbjct  18   SRSDILR--IILAASTTYAAI--FYLLSSLDPNSAKRKGDSAKRREAVKRLQATTDGHKL  73

Query  231  IQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGP  407
               N YE  IA +V+    I V F SIGGL+ I   L E +ILPL  PELF+    LLG 
Sbjct  74   QDLNEYEQSIASEVVFATDIKVTFESIGGLDDIINDLKESIILPLTYPELFASATGLLGA  133

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPG GKTMLAKA+A  S A FIN+ IS L  KWFG++ KLV A+FSLA KLQ
Sbjct  134  PKGVLLYGPPGCGKTMLAKALASSSGATFINMHISTLTDKWFGESNKLVNALFSLARKLQ  193

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P+IIFIDE+D+FL +R+  DHEA+  +K EFM+LWDG  T+
Sbjct  194  PSIIFIDEIDAFLREREKNDHEAMAMIKAEFMSLWDGLATE  234



>ref|XP_007415396.1| hypothetical protein MELLADRAFT_92596 [Melampsora larici-populina 
98AG31]
 gb|EGG01295.1| hypothetical protein MELLADRAFT_92596 [Melampsora larici-populina 
98AG31]
Length=366

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 139/205 (68%), Gaps = 7/205 (3%)
 Frame = +3

Query  114  AISCLVLFVGLRHL----DPNREASKKALENKKEIAKRLG--RPLIQTNTYEDVIACDVI  275
            AIS + LF G+R++    DP +    + L+  K++ ++LG  + L+  + +E ++  +VI
Sbjct  27   AISQIFLFYGVRYIISRNDPTKLNKDQILKKSKKVIQKLGLDKTLLDLDEHEVMLIGEVI  86

Query  276  NPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLLYGPPGTGKT  452
             PD I+V F+ IGGL+ I   L E VI PL  P  F S   L    KGVLLYGPPG GKT
Sbjct  87   QPDEIEVGFDDIGGLDPIISDLKESVIFPLCYPSTFKSSAGLFSSPKGVLLYGPPGCGKT  146

Query  453  MLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQ  632
            MLAK +AKES A+FIN+K S+L SKWFG++ KLVAA+FSL+ KLQP+IIFIDE+DSF+ +
Sbjct  147  MLAKTLAKESGAMFINIKPSDLNSKWFGESSKLVAALFSLSRKLQPSIIFIDEIDSFMRE  206

Query  633  RKSTDHEALTNMKTEFMALWDGFTT  707
            R  TDHE    MK EFM LWDG  T
Sbjct  207  RSKTDHEVSGMMKAEFMTLWDGLAT  231



>ref|XP_002414347.1| 26S proteasome regulatory subunit, putative [Ixodes scapularis]
 gb|EEC17655.1| 26S proteasome regulatory subunit, putative, partial [Ixodes 
scapularis]
Length=365

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 130/186 (70%), Gaps = 0/186 (0%)
 Frame = +3

Query  153  LDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIK  332
            +DP R+   +A +    I KR+G   +    YE  IA  +I+P  I++ ++SI GLE I 
Sbjct  48   IDPTRKQKVEAKKRADRILKRIGVTNVNLTEYELSIAAQLIDPRDINICWDSIAGLEEIT  107

Query  333  QALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKIS  512
            Q L E VILP+Q+ +LF+  +L+ P KGVLL+GPPG GKTM+AKA A+E+ A FIN++++
Sbjct  108  QELRETVILPIQKRDLFTGSQLIQPPKGVLLHGPPGCGKTMIAKATAREAGARFINLEVA  167

Query  513  NLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALW  692
             L  KW+G++QKL AAVF+LA K+QP I+FIDE+DSFL  R S DHEA   MK +FM LW
Sbjct  168  ALTDKWYGESQKLAAAVFTLAVKIQPCIVFIDEIDSFLRSRDSQDHEATAMMKAQFMCLW  227

Query  693  DGFTTD  710
            DG  TD
Sbjct  228  DGLITD  233



>ref|XP_009841758.1| hypothetical protein H257_15364 [Aphanomyces astaci]
 gb|ETV68804.1| hypothetical protein H257_15364 [Aphanomyces astaci]
Length=456

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = +3

Query  189  ENKKEIAKRLG---RPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVIL  359
            +   ++ KRL    R  I  N YE +IA D+++P  + V F  IGGL+A K+ L+ELV+L
Sbjct  86   DTAAKLKKRLAESKRATITMNHYESIIAADLVDPADLHVTFTDIGGLDAQKRDLHELVVL  145

Query  360  PLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGD  539
            PLQ P+ F+  KLL   KG+LLYG PGTGKT+LAKAIAKES A FIN+KIS LMSKWFG+
Sbjct  146  PLQCPDFFATSKLLSVPKGILLYGRPGTGKTLLAKAIAKESGAFFINLKISTLMSKWFGE  205

Query  540  AQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTN-MKTEFMALWDGF  701
            +QKLV A FSLA KL P IIFIDEVDSF+G R     +   N MKTEF+ALWDGF
Sbjct  206  SQKLVKAAFSLAKKLSPCIIFIDEVDSFMGARSGGASDPTYNSMKTEFLALWDGF  260



>ref|XP_011135055.1| PREDICTED: ATPase family AAA domain-containing protein 1-B isoform 
X2 [Harpegnathos saltator]
Length=372

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 141/226 (62%), Gaps = 8/226 (4%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP---  227
            GG + +++L  +       AI    +   +  LDP     K+A +  +E  ++L      
Sbjct  7    GGLTRSEVLMLVARLTCVTAIGFFSMKWIMSQLDPTNSNKKRAKQKAREQLRKLTESGGQ  66

Query  228  -----LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHG  392
                 L Q   YE +IA  +++P+ + V +N+I GLE + Q L E V+LP++R ELF   
Sbjct  67   IQAFDLEQLTDYEVIIATHLVDPNDMKVSWNNIAGLEHVIQELKETVMLPIERKELFEDS  126

Query  393  KLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSL  572
            +L+   KG+LL+GPPG GKTM+AKA AKE++  FIN+ +S L  KW+G++QKL AAVFSL
Sbjct  127  QLMQAPKGILLHGPPGCGKTMIAKATAKETKTCFINLDVSILTDKWYGESQKLTAAVFSL  186

Query  573  AYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            A KLQP IIFIDE+DSFL  R + DHEA   MK +FM+LWDG  TD
Sbjct  187  AVKLQPCIIFIDEIDSFLRARNTQDHEATAMMKAQFMSLWDGLITD  232



>gb|KGB75016.1| ATPase [Cryptococcus gattii R265]
 gb|KIR24983.1| ATPase [Cryptococcus gattii LA55]
 gb|KIR36116.1| ATPase [Cryptococcus gattii MMRL2647]
 gb|KIR75549.1| ATPase [Cryptococcus gattii CA1014]
 gb|KIR95489.1| ATPase [Cryptococcus gattii CBS 10090]
 gb|KIS01985.1| ATPase [Cryptococcus gattii 2001/935-1]
Length=370

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 136/217 (63%), Gaps = 6/217 (3%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT-----  239
            ++L ++  +AAS       L   +  LDP   +SKKA E  K +  + G    Q      
Sbjct  8    RVLMDVAFFAASQVALYYTLRYVVSSLDPTSGSSKKAQEKSKNLLAQTGLSEAQLASLEL  67

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKG  416
            + YE  IA +++ P  IDV F  IGGL+ I  +L E VI PL  PELF S   LL   KG
Sbjct  68   DEYEQTIAAEIVPPSSIDVTFEGIGGLDDIIASLRETVIYPLTFPELFGSDNGLLSAPKG  127

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYG PG GKTMLAKA+AKES A FIN+ +S+L +KWFG++ KLVA +FSLA KLQP+I
Sbjct  128  VLLYGHPGCGKTMLAKALAKESGATFINLPLSSLTNKWFGESNKLVAGLFSLAKKLQPSI  187

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DS   +R + DHE    MK EFM LWDG TT
Sbjct  188  IFIDEIDSLFRERSAGDHEVTAMMKAEFMTLWDGLTT  224



>ref|XP_011134806.1| PREDICTED: ATPase family AAA domain-containing protein 1-B isoform 
X1 [Harpegnathos saltator]
 ref|XP_011134886.1| PREDICTED: ATPase family AAA domain-containing protein 1-B isoform 
X1 [Harpegnathos saltator]
 ref|XP_011134970.1| PREDICTED: ATPase family AAA domain-containing protein 1-B isoform 
X1 [Harpegnathos saltator]
Length=376

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 141/226 (62%), Gaps = 8/226 (4%)
 Frame = +3

Query  57   GGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP---  227
            GG + +++L  +       AI    +   +  LDP     K+A +  +E  ++L      
Sbjct  7    GGLTRSEVLMLVARLTCVTAIGFFSMKWIMSQLDPTNSNKKRAKQKAREQLRKLTESGGQ  66

Query  228  -----LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHG  392
                 L Q   YE +IA  +++P+ + V +N+I GLE + Q L E V+LP++R ELF   
Sbjct  67   IQAFDLEQLTDYEVIIATHLVDPNDMKVSWNNIAGLEHVIQELKETVMLPIERKELFEDS  126

Query  393  KLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSL  572
            +L+   KG+LL+GPPG GKTM+AKA AKE++  FIN+ +S L  KW+G++QKL AAVFSL
Sbjct  127  QLMQAPKGILLHGPPGCGKTMIAKATAKETKTCFINLDVSILTDKWYGESQKLTAAVFSL  186

Query  573  AYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            A KLQP IIFIDE+DSFL  R + DHEA   MK +FM+LWDG  TD
Sbjct  187  AVKLQPCIIFIDEIDSFLRARNTQDHEATAMMKAQFMSLWDGLITD  232



>dbj|BAN21555.1| ATPase family AAA domain-containing protein, partial [Riptortus 
pedestris]
Length=315

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 131/190 (69%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  LRHLDPNREASKKALENKKEIAKRLGRPL-IQTNTYEDVIACDVINPDHIDVEFNSIGGL  320
            ++HLDP  +    A +   E+  RLG  +  + + YE +IA  +++P  I V ++SIGGL
Sbjct  32   MKHLDPTNKRKANAAKTATELLDRLGLKVGKELSEYELMIASHLVDPSSIPVTWSSIGGL  91

Query  321  EAIKQALYELVILPLQRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFIN  500
             ++ Q + E VILP++R ELFS+ +L  P KGVLL+GPPG GKTM+AKA A+E+   FIN
Sbjct  92   GSVIQEIQETVILPIKRRELFSNSQLTQPPKGVLLHGPPGCGKTMIAKATAREAGCNFIN  151

Query  501  VKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEF  680
            + +S L  KW+G++QKL AAVFSLA K+QP IIFIDE+DSFL  R   DHEA   MK +F
Sbjct  152  LDLSILTDKWYGESQKLAAAVFSLAEKIQPCIIFIDEIDSFLRSRNVQDHEATAMMKAQF  211

Query  681  MALWDGFTTD  710
            M LWDG  TD
Sbjct  212  MTLWDGINTD  221



>gb|EMS22937.1| ATPase, AAA-type domain containing protein [Rhodosporidium toruloides 
NP11]
 emb|CDR44339.1| RHTO0S09e02828g1_1 [Rhodosporidium toruloides]
Length=362

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 139/214 (65%), Gaps = 3/214 (1%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPL--IQTNTY  248
            K+L +  L+  S         V +  +DP +   K++    KE   +LG  L  ++ + +
Sbjct  9    KLLLDGSLFILSQVAFYYAFKVVMNQMDPQKSKRKESKAKSKEALGKLGVDLSTLELSEH  68

Query  249  EDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQKGVLL  425
            E++IA +V+ P+ I V F+ +GGL+ I   L E VI PL  P+LF S   L G  KGVLL
Sbjct  69   EEIIAGEVVAPEDIHVTFSDVGGLDPIISQLREAVIFPLCYPQLFESSAGLFGAPKGVLL  128

Query  426  YGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFI  605
            YGPPG GKTMLAKA+A+ES A FIN+ +S L  KWFG++ KLVAA+FSLA KLQP+IIFI
Sbjct  129  YGPPGCGKTMLAKALARESGATFINMHVSTLTDKWFGESNKLVAALFSLARKLQPSIIFI  188

Query  606  DEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            DE+DSFL +R   DHE    MK EFM++WDG TT
Sbjct  189  DEIDSFLRERSRADHEVTGMMKAEFMSMWDGLTT  222



>gb|KDN37536.1| putative MSP1-intra-mitochondrial sorting protein [Tilletiaria 
anomala UBC 951]
Length=400

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 143/218 (66%), Gaps = 7/218 (3%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREA---SKKALENKKE---IAKRLGRPLIQ  236
            KI  ++ L+AAS           +  LDPNR+    SKKA ++K     ++      L Q
Sbjct  7    KIATDVALFAASQVAFYYAFKYVMHSLDPNRQKRIDSKKAADSKLSSLGLSPATHPHLAQ  66

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQK  413
             + +E+ I+ ++I P  I   F+SIGGL+ I  +L E VI PL  PELFS    LLG  K
Sbjct  67   LSEHEEQISSELILPRDITETFDSIGGLDGIIGSLQESVIAPLCFPELFSSSNGLLGAPK  126

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLLYGPPGTGKTMLAKA+AKES A FIN+ +S L +KWFG++ KLV+A+FSLA KLQP 
Sbjct  127  GVLLYGPPGTGKTMLAKALAKESGATFINMHVSTLTNKWFGESNKLVSALFSLARKLQPT  186

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IIFIDE+DSFL +R + DHE    MK EFM LWDG T+
Sbjct  187  IIFIDEIDSFLRERGTGDHEVTGMMKAEFMTLWDGLTS  224



>ref|NP_001239116.1| ATPase family AAA domain-containing protein 1-A-like [Nasonia 
vitripennis]
Length=372

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 141/229 (62%), Gaps = 10/229 (4%)
 Frame = +3

Query  54   GGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP--  227
            G G S T+I   +   +   AI    +   +  LDPN +  +KA +  +E  ++L R   
Sbjct  6    GSGFSRTEIFMLVARLSFVTAIGFFSMKYIMNQLDPNNKQKRKAKKKAEEQLRKLARTDA  65

Query  228  --------LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF  383
                    L Q   YE +IA  +++P  I V + +I GLE + Q L E VILP+QR ELF
Sbjct  66   VALTRTIDLEQLTDYEMMIASHLVDPKDIRVSWENIAGLEHVIQELQETVILPIQRKELF  125

Query  384  SHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAV  563
               +L    KGVLL+GPPG GKTM+AKA AKE++  FIN+ +S L  KW+G++QKL AAV
Sbjct  126  EDSQLTQAPKGVLLHGPPGCGKTMIAKATAKEAKTCFINLDLSILTDKWYGESQKLTAAV  185

Query  564  FSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            FSLA KLQP IIFIDE+DSFL  R S DHEA   MK +FM+LWDG  TD
Sbjct  186  FSLAVKLQPCIIFIDEIDSFLRARNSQDHEATAMMKAQFMSLWDGLITD  234



>ref|XP_007768861.1| ATPase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW81550.1| ATPase [Coniophora puteana RWD-64-598 SS2]
Length=376

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 141/221 (64%), Gaps = 4/221 (2%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRP  227
            M    S++  IL   + +A+ AA+   + ++   ++ P   A K+    + E+ KRLG  
Sbjct  1    MSSAQSTKRIILDAALFFASQAAVYYTIRWIWDAYVHP---ADKEGDVKRAEVLKRLGAK  57

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSH-GKLLG  404
             ++ + YE  I+ +VI+PD+I V F  IGGL+ I  +L E +I PL  P LFS    LLG
Sbjct  58   GLKLDEYEKAISKEVIHPDNISVRFADIGGLDPIVNSLRESIIYPLLYPNLFSSTSSLLG  117

Query  405  PQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKL  584
              KGVLLYGPPG GKTMLA+A+AKES A FINV  S L +KWFG++ KLVA +FSLA K+
Sbjct  118  APKGVLLYGPPGCGKTMLARALAKESGAAFINVPASALANKWFGESNKLVAGLFSLARKM  177

Query  585  QPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            QP IIFIDE+DSFL +R   DHE    MK EFM  WDG  +
Sbjct  178  QPCIIFIDEIDSFLRERSREDHEVTGMMKAEFMTSWDGLLS  218



>gb|KDQ62132.1| hypothetical protein JAAARDRAFT_700353 [Jaapia argillacea MUCL 
33604]
Length=361

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 137/215 (64%), Gaps = 4/215 (2%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENK-KEIAKRLGRPLIQT  239
            S+  + L ++ L+ AS A     L   +    P RE  KK L  K K+I +RLG   +  
Sbjct  5    SATKRTLLDVALFLASQAALYYTLHWAIESFMPERE--KKKLSTKSKDILERLGHKDLDL  62

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFS-HGKLLGPQKG  416
            N YE  IA +VI+PD I ++F  +GGLE I  +L E VI PL  P LF+ +  LL   KG
Sbjct  63   NEYEKAIASEVIHPDDIHIKFADVGGLEPIISSLRESVIYPLVYPTLFAANSSLLTAPKG  122

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYGPPG GKTMLAKA+AKES A FIN+  S L +KW+G++ KLVA +F LA K QP+I
Sbjct  123  VLLYGPPGCGKTMLAKALAKESGATFINIAASVLTNKWYGESNKLVAGLFGLARKTQPSI  182

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            +FIDE+DSFL +R   DHE    MK EFM LWDG 
Sbjct  183  VFIDEIDSFLRERTKGDHEVTGMMKAEFMTLWDGL  217



>gb|EPT00249.1| hypothetical protein FOMPIDRAFT_1146685 [Fomitopsis pinicola 
FP-58527 SS1]
Length=353

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 143/221 (65%), Gaps = 5/221 (2%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIA-KRLGR  224
            M    S++  IL   +  A+ AA+   + +V    +D      KK ++ K   A ++LG 
Sbjct  1    MAVSASTKRAILDVALFVASQAALYYTIRWV----MDGTISGEKKEVKAKSLKALEKLGH  56

Query  225  PLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLG  404
              ++ + YE  IA +VI+PD IDV F+ IGGLE I  +L E VI PL  P LF+   LLG
Sbjct  57   RDLKLDEYEKQIASEVIHPDDIDVRFSDIGGLEPIISSLRESVIYPLVFPHLFNSSSLLG  116

Query  405  PQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKL  584
              KGVLL+GPPG GKTMLAKA+AKES A+FIN+  S L +KW+G++ KLVAA+FSLA K 
Sbjct  117  APKGVLLFGPPGCGKTMLAKALAKESGAIFINIAASVLTNKWYGESNKLVAALFSLARKT  176

Query  585  QPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            QP+I+FIDE+DSFL +R   DHE    MK EFM LWDG  +
Sbjct  177  QPSIVFIDEIDSFLRERTKGDHEVTGMMKAEFMTLWDGLLS  217



>gb|KIM74814.1| hypothetical protein PILCRDRAFT_827872 [Piloderma croceum F 1598]
Length=329

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = +3

Query  171  ASKKALENKK-EIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYE  347
             SKK ++ KK E  KRLG   ++ + YE  IA +VI+PD I+V+F+ +GGLE I  +L E
Sbjct  4    GSKKEVQAKKTEALKRLGHKNLKLDEYEKTIANEVIHPDDIEVKFSDVGGLEPIIASLRE  63

Query  348  LVILPLQRPELFS-HGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMS  524
             +I PL  P LFS    L+G  KGVLLYGPPG GKTMLAKA+AKES A FIN+  S L +
Sbjct  64   SIIYPLLYPNLFSASSSLIGAPKGVLLYGPPGCGKTMLAKALAKESGATFINIAASVLTN  123

Query  525  KWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            KW+G++ KLVAA+FSLA K QP+IIFIDE+DSFL +R   DHE    MK EFM LWDG 
Sbjct  124  KWYGESNKLVAALFSLARKCQPSIIFIDEIDSFLRERAKDDHEVTGMMKAEFMTLWDGL  182



>ref|XP_011861696.1| PREDICTED: ATPase family AAA domain-containing protein 1-like 
[Vollenhovia emeryi]
Length=378

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 138/221 (62%), Gaps = 12/221 (5%)
 Frame = +3

Query  84   QELVLYAASAAISCLVLFVGLR----HLDPNREASKKALENKKEIAKRLGRP--------  227
            QE+++  A       + F  +R     LDP R   ++A +  +E  ++L           
Sbjct  12   QEVLMLVARLTCVAAIGFFSMRWLISQLDPTRSTKQRAKKKAREQLRKLAESDTYARSFD  71

Query  228  LIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGP  407
            + Q   YE +IA  +++P  I V ++SI GL+ + Q L E VILP+QR ELF   +L   
Sbjct  72   MDQLTDYEMIIANHLVDPSDIKVSWSSIAGLDNVIQELKETVILPIQRKELFEDSQLTQA  131

Query  408  QKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQ  587
             KGVLLYGPPG GKTM+AKA A++++  FIN+ +S L  KW+G++QKL +AVFSLA KLQ
Sbjct  132  PKGVLLYGPPGCGKTMIAKATARDAKTRFINLDVSILTDKWYGESQKLASAVFSLAVKLQ  191

Query  588  PAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTTD  710
            P IIF+DE+DSFL  R S DHEA   MK +FM++WDG  TD
Sbjct  192  PCIIFVDEIDSFLRSRNSQDHEATAMMKAQFMSMWDGLITD  232



>ref|XP_007001751.1| hypothetical protein TREMEDRAFT_59618 [Tremella mesenterica DSM 
1558]
 gb|EIW73450.1| hypothetical protein TREMEDRAFT_59618 [Tremella mesenterica DSM 
1558]
Length=369

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 143/219 (65%), Gaps = 11/219 (5%)
 Frame = +3

Query  81   LQELVLYAASAAISCLVLFVGLRHL----DPNREASKKALENKKEIAKRLGRPLIQTNT-  245
            +Q++V+  A  A S + LF  LR++    DP+  ++ K+ +  K +  + G    Q ++ 
Sbjct  5    IQKVVMDVAFFAASQVALFYALRYIVSSIDPS-PSTTKSRKKSKSVLSQTGLSQSQLDSL  63

Query  246  ----YEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQ  410
                YE  IA ++I P  IDV F SIGGL+ I  +L E VI PL  PELF S  +LL   
Sbjct  64   DLDEYESTIAGEIIPPSSIDVSFESIGGLDEIISSLRETVIYPLTFPELFESKNRLLSAP  123

Query  411  KGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQP  590
            KGVLLYG PG GKTMLAKA+AKES A FIN+ IS+L +KWFG++ KLVA +FSLA K+QP
Sbjct  124  KGVLLYGHPGCGKTMLAKALAKESGATFINLPISSLTNKWFGESNKLVAGLFSLARKVQP  183

Query  591  AIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            +IIFIDE+DS   +R + DHE    MK EFM LWDG TT
Sbjct  184  SIIFIDEIDSLFRERSAGDHEVTAMMKAEFMTLWDGLTT  222



>ref|XP_012049441.1| ATPase [Cryptococcus neoformans var. grubii H99]
 gb|AFR94858.1| ATPase [Cryptococcus neoformans var. grubii H99]
Length=370

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 135/217 (62%), Gaps = 6/217 (3%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT-----  239
            ++  ++  +AAS       L   +  LDP   +S+KA E  K +  + G    Q      
Sbjct  8    RVFMDVAFFAASQVALYYTLRYVVSSLDPASGSSRKAKEKSKNLLAQTGLSETQLASLEL  67

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            + YE  IA +++ P  IDV F  IGGL+ I  +L E VI PL  PELF  G  LL   KG
Sbjct  68   DEYEQAIAAEIVPPSSIDVTFEGIGGLDDIIASLRETVIYPLTFPELFGSGNGLLSAPKG  127

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYG PG GKTMLAKA+AKES A FIN+ +S+L +KWFG++ KLVA +FSLA KLQP+I
Sbjct  128  VLLYGHPGCGKTMLAKALAKESGATFINLPLSSLTNKWFGESNKLVAGLFSLAKKLQPSI  187

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DS   +R + DHE    MK EFM LWDG TT
Sbjct  188  IFIDEIDSLFRERSAGDHEVTAMMKAEFMTLWDGLTT  224



>gb|KIO29284.1| hypothetical protein M407DRAFT_171965 [Tulasnella calospora MUT 
4182]
Length=358

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 124/182 (68%), Gaps = 3/182 (2%)
 Frame = +3

Query  165  REASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALY  344
            R A  K   NK  I +RLG+  ++   YE++IA +VI+PD I + F+ +GGLE+I   L 
Sbjct  41   RSADAKVKGNK--IMERLGKSNLELTHYEEIIAAEVIHPDDIHIRFSDVGGLESIVSNLR  98

Query  345  ELVILPLQRPELFS-HGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLM  521
            E VI PL  PELF+    L+   KGVLLYGPPG GKTMLAKA+AKES A FIN+  S + 
Sbjct  99   ESVIYPLCYPELFAAKSNLISAPKGVLLYGPPGCGKTMLAKALAKESGATFINITASVIQ  158

Query  522  SKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
             KWFG++ KLVA +FSLA KLQP IIFIDE+DSFL +R   DHE    MK EFM LWDG 
Sbjct  159  DKWFGESNKLVAGLFSLARKLQPCIIFIDEIDSFLRERSRGDHEVTAMMKAEFMTLWDGL  218

Query  702  TT  707
             +
Sbjct  219  AS  220



>ref|XP_570595.1| ATPase [Cryptococcus neoformans var. neoformans JEC21]
 ref|XP_775817.1| hypothetical protein CNBD2270 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL21170.1| hypothetical protein CNBD2270 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW43288.1| ATPase, putative [Cryptococcus neoformans var. neoformans JEC21]
Length=370

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 135/217 (62%), Gaps = 6/217 (3%)
 Frame = +3

Query  75   KILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQT-----  239
            ++  ++  +AAS       L   +  LDP   +S+KA E  K +  + G    Q      
Sbjct  8    RVFMDVAFFAASQVALYYTLRYVVSSLDPASGSSRKAKEKSKSLLAQTGLSEAQLASLEL  67

Query  240  NTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGK-LLGPQKG  416
            + YE  IA +++ P  IDV F  IGGL+ I  +L E VI PL  PELF  G  LL   KG
Sbjct  68   DEYEQAIAAEIVPPSSIDVTFEGIGGLDDIIASLRETVIYPLTFPELFGSGNGLLSAPKG  127

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLLYG PG GKTMLAKA+AKES A FIN+ +S+L +KWFG++ KLVA +FSLA KLQP+I
Sbjct  128  VLLYGHPGCGKTMLAKALAKESGATFINLPLSSLTNKWFGESNKLVAGLFSLAKKLQPSI  187

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IFIDE+DS   +R + DHE    MK EFM LWDG TT
Sbjct  188  IFIDEIDSLFRERSAGDHEVTAMMKAEFMTLWDGLTT  224



>ref|XP_008044940.1| ATPase [Trametes versicolor FP-101664 SS1]
 gb|EIW52428.1| ATPase [Trametes versicolor FP-101664 SS1]
Length=346

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 141/221 (64%), Gaps = 5/221 (2%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIA-KRLGR  224
            M    S++  I+   +  A+ AA+   + +V    +D      +K ++ K   A + LG 
Sbjct  1    MAVSASTKRAIVDVAIFVASQAALYYTLRWV----MDTMSPVERKEVKQKSLKALESLGH  56

Query  225  PLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLG  404
              ++ + YE  IA +VI+PD IDV F  IGGL+ I  +L E VI PL+ P LF+   LLG
Sbjct  57   KDLKLDEYESQIASEVIHPDDIDVRFTDIGGLDPIISSLRESVIFPLRFPHLFASSSLLG  116

Query  405  PQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKL  584
              KGVLL+GPPG GKTMLAKA+AKES A FIN+  S L +KW+G++ KLVA +FSLA K 
Sbjct  117  APKGVLLFGPPGCGKTMLAKALAKESGATFINIAASVLTNKWYGESNKLVAGLFSLARKT  176

Query  585  QPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            QP+I+FIDE+DSFL +R   DHE    MK EFM LWDG T+
Sbjct  177  QPSIVFIDEIDSFLRERTKGDHEVTGMMKAEFMTLWDGLTS  217



>gb|KKA26044.1| hypothetical protein TD95_000347, partial [Thielaviopsis punctulata]
Length=430

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 126/189 (67%), Gaps = 1/189 (1%)
 Frame = +3

Query  144  LRHLDPNREASKKALENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLE  323
            L HL  N+   +    N    AK      +  N YE VIA DV++PD I V F +IGGL+
Sbjct  59   LEHLHKNKSGQRAIEGNGAGDAKHFRVEDLALNEYETVIALDVVSPDDIPVGFANIGGLD  118

Query  324  AIKQALYELVILPLQRPELFSH-GKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFIN  500
             I + L E VI PL  P+L+SH G LL    GVLLYGPPG GKTMLAKA+AKES A FIN
Sbjct  119  DIIEELKESVIYPLTMPQLYSHAGPLLSAPSGVLLYGPPGCGKTMLAKALAKESGASFIN  178

Query  501  VKISNLMSKWFGDAQKLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEF  680
            + IS L  KW+GD+ KLV AVFSLA K+QPAIIFIDE+D+ L  R S+DHEA   +K EF
Sbjct  179  LHISTLTEKWYGDSNKLVRAVFSLARKMQPAIIFIDEIDAVLRTRASSDHEASGMVKAEF  238

Query  681  MALWDGFTT  707
            MALWDG  +
Sbjct  239  MALWDGLVS  247



>ref|XP_009545862.1| AAA family ATPase, CDC48 subfamily [Heterobasidion irregulare 
TC 32-1]
 gb|ETW82235.1| AAA family ATPase, CDC48 subfamily [Heterobasidion irregulare 
TC 32-1]
Length=370

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 134/214 (63%), Gaps = 3/214 (1%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDPNREASKKALENKKEIAKRLGRPLIQTN  242
            S+  K L ++ ++ AS A     +   L    PNRE   KA     E  K+LG   ++ +
Sbjct  5    STTKKALLDVAIFLASQAAMWYTVHWMLDSFSPNREKEVKA--KPLEALKKLGHEKLELD  62

Query  243  TYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLL-GPQKGV  419
             YE  IA +VI+PD I V F  IGGL+ I  +L E +I PL  P LF+    L    KGV
Sbjct  63   EYEKTIASEVIHPDDITVRFADIGGLDDIISSLQESIIFPLLYPSLFNASSTLRTAPKGV  122

Query  420  LLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAII  599
            LLYGPPG GKTMLAKA+AKES A FIN+ +S L +KW+G++ KLVA +FSLA K+QP II
Sbjct  123  LLYGPPGCGKTMLAKALAKESGATFINIAVSVLTNKWYGESNKLVAGLFSLARKVQPCII  182

Query  600  FIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            FIDE+DSFL +R   DHE    MK EFM LWDG 
Sbjct  183  FIDEIDSFLRERTKGDHEVTAMMKAEFMTLWDGL  216



>ref|XP_007329926.1| hypothetical protein AGABI1DRAFT_120625 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM79184.1| hypothetical protein AGABI1DRAFT_120625 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=361

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 141/218 (65%), Gaps = 7/218 (3%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFV--GLRHLDPNREASKKALENKKEIAKRLGRPLIQ  236
            S+   + +  +  A+ AA+   V +V  G+ + D   E  +K LE      +RLG   + 
Sbjct  5    STRRAVFEVAIFLASQAALFYTVRWVIDGISNPDKKEEVKEKQLE----ALRRLGHSGLI  60

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELF-SHGKLLGPQK  413
             + YE  +A +VI+PD I+V F+ IGGL+ I  +L E VI PL  P LF S   LLG  K
Sbjct  61   LDEYEKKVANEVIHPDDINVRFSDIGGLDTIISSLRESVIYPLLYPNLFTSTSSLLGAPK  120

Query  414  GVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPA  593
            GVLL+GPPG GKTMLAKA+AKES A FIN+  S L +KW+G++ KLVA +FSLA K+QP+
Sbjct  121  GVLLFGPPGCGKTMLAKALAKESGATFINIAASVLTNKWYGESNKLVAGLFSLARKVQPS  180

Query  594  IIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            IIFIDE+DSFL +R   DHE    MK EFM LWDG T+
Sbjct  181  IIFIDEIDSFLRERTKGDHEVTGMMKAEFMTLWDGLTS  218



>gb|KIK69864.1| hypothetical protein GYMLUDRAFT_34253 [Gymnopus luxurians FD-317 
M1]
Length=371

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 142/221 (64%), Gaps = 7/221 (3%)
 Frame = +3

Query  48   MKGGGSSETKILQELVLYAASAAISCLVLFVGLR-HLDPNREASKKALENKKEIA--KRL  218
            M G   +   I+ E+ L  AS A     L+  +R  +D    AS K   N K++   KRL
Sbjct  1    MAGSHHTTKHIVIEIALLVASQA----ALYYTMRWAIDSFTGASNKKKVNAKQLEALKRL  56

Query  219  GRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKL  398
            G   +Q + YE V+A +VI+PD I V+F+ IGGL+ I  +L E VI PL  P L S   L
Sbjct  57   GHTELQLDEYESVVANEVIHPDDIPVKFSDIGGLDPIITSLRESVIYPLLYPTLLSSSSL  116

Query  399  LGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAY  578
            LG  KGVLLYGPPG GKTMLAKA+AKES A FIN+  S L +KWFG++ KLVA +FSLA 
Sbjct  117  LGAPKGVLLYGPPGCGKTMLAKALAKESGATFINIAASVLTNKWFGESNKLVAGLFSLAR  176

Query  579  KLQPAIIFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGF  701
            K QP+IIFIDE+DSFL +R S DHE    MK EFM LWDG 
Sbjct  177  KTQPSIIFIDEIDSFLRERASGDHEVTAMMKAEFMTLWDGL  217



>gb|AAC19276.1| T14P8.7 [Arabidopsis thaliana]
 emb|CAB80740.1| AT4g02470 [Arabidopsis thaliana]
Length=371

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = +3

Query  186  LENKKEIAKRLGRPLIQTNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPL  365
            ++N+ +  K+  + ++  N +E  +  DVI P  I V F+ IG LE +K+ L ELV+LPL
Sbjct  30   IQNENKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKETLKELVMLPL  89

Query  366  QRPELFSHGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQ  545
            QRPELF  G+L  P KG+LL+GPPGTGKTMLAKA+A E+ A FIN+ +S++ SKWFG+ +
Sbjct  90   QRPELFDKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  149

Query  546  KLVAAVFSLAYKLQPAIIFIDEVDSFLGQRKST-DHEALTNMKTEFMALWDGFTT  707
            K V AVFSLA K+ P++IF+DEVDS LG+R++  +HEA+  MK EFM  WDG  T
Sbjct  150  KYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRT  204



>ref|XP_007366160.1| AAA-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60940.1| AAA-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
Length=346

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 140/217 (65%), Gaps = 6/217 (3%)
 Frame = +3

Query  63   SSETKILQELVLYAASAAISCLVLFVGLRHLDP--NREASKKALENKKEIAKRLGRPLIQ  236
            +S  + + ++ ++AAS       L   +  L P   +E  +K+L+      + LG   ++
Sbjct  5    ASTKRAIFDVAIFAASQVALYYTLRWVMDSLSPVERKEVKQKSLK----ALESLGHKDLK  60

Query  237  TNTYEDVIACDVINPDHIDVEFNSIGGLEAIKQALYELVILPLQRPELFSHGKLLGPQKG  416
             + YE  IA +VI+PD ID+ F+ IGGL+ I  +L E VI PL  P LFS   LLG  KG
Sbjct  61   LDEYESQIASEVIHPDDIDIRFSDIGGLDPIISSLRESVIYPLLYPHLFSSSSLLGAPKG  120

Query  417  VLLYGPPGTGKTMLAKAIAKESRAVFINVKISNLMSKWFGDAQKLVAAVFSLAYKLQPAI  596
            VLL+GPPG GKTMLAKA+AKES A FIN+  S L +KW+G++ KLVA +FSLA K QP+I
Sbjct  121  VLLFGPPGCGKTMLAKALAKESGATFINIAASVLTNKWYGESNKLVAGLFSLARKAQPSI  180

Query  597  IFIDEVDSFLGQRKSTDHEALTNMKTEFMALWDGFTT  707
            +FIDE+DSFL +R   DHE    MK EFM LWDG T+
Sbjct  181  VFIDEIDSFLRERTKGDHEVTGMMKAEFMTLWDGLTS  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1281324548632