BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5025

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228642.1|  PREDICTED: histone-lysine N-methyltransferas...    356   9e-118   Solanum lycopersicum
ref|XP_009768042.1|  PREDICTED: histone-lysine N-methyltransferas...    347   3e-114   Nicotiana sylvestris
ref|XP_009611032.1|  PREDICTED: histone-lysine N-methyltransferas...    343   8e-113   Nicotiana tomentosiformis
ref|XP_006367610.1|  PREDICTED: histone-lysine N-methyltransferas...    341   6e-112   Solanum tuberosum [potatoes]
gb|EYU30121.1|  hypothetical protein MIMGU_mgv1a005562mg                329   3e-107   Erythranthe guttata [common monkey flower]
ref|XP_011070578.1|  PREDICTED: histone-lysine N-methyltransferas...    325   9e-106   Sesamum indicum [beniseed]
emb|CDP16308.1|  unnamed protein product                                320   1e-103   Coffea canephora [robusta coffee]
ref|XP_007222801.1|  hypothetical protein PRUPE_ppa005021mg             317   3e-102   Prunus persica
ref|XP_008381743.1|  PREDICTED: histone-lysine N-methyltransferas...    315   6e-102   Malus domestica [apple tree]
ref|XP_008221467.1|  PREDICTED: histone-lysine N-methyltransferas...    311   7e-102   
ref|XP_007045259.1|  Rubisco methyltransferase family protein iso...    314   2e-101   
ref|XP_008221466.1|  PREDICTED: histone-lysine N-methyltransferas...    315   2e-101   Prunus mume [ume]
ref|XP_009351546.1|  PREDICTED: histone-lysine N-methyltransferas...    312   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_008389174.1|  PREDICTED: histone-lysine N-methyltransferas...    311   2e-100   
ref|XP_010271179.1|  PREDICTED: histone-lysine N-methyltransferas...    311   3e-100   Nelumbo nucifera [Indian lotus]
gb|KHG01954.1|  Histone-lysine N-methyltransferase setd3                310   6e-100   Gossypium arboreum [tree cotton]
gb|KJB50382.1|  hypothetical protein B456_008G168000                    308   3e-99    Gossypium raimondii
ref|XP_012072298.1|  PREDICTED: histone-lysine N-methyltransferas...    305   6e-98    Jatropha curcas
ref|XP_011024040.1|  PREDICTED: histone-lysine N-methyltransferas...    305   8e-98    Populus euphratica
ref|XP_012072299.1|  PREDICTED: histone-lysine N-methyltransferas...    305   8e-98    Jatropha curcas
gb|KDO60745.1|  hypothetical protein CISIN_1g0129691mg                  295   2e-97    Citrus sinensis [apfelsine]
ref|XP_006469244.1|  PREDICTED: histone-lysine N-methyltransferas...    303   5e-97    Citrus sinensis [apfelsine]
ref|XP_003530864.1|  PREDICTED: histone-lysine N-methyltransferas...    302   6e-97    Glycine max [soybeans]
ref|XP_006448171.1|  hypothetical protein CICLE_v10015103mg             297   3e-96    
gb|KHN16537.1|  Histone-lysine N-methyltransferase setd3                300   3e-96    Glycine soja [wild soybean]
ref|XP_006448170.1|  hypothetical protein CICLE_v10015103mg             300   6e-96    Citrus clementina [clementine]
ref|XP_002312458.2|  hypothetical protein POPTR_0008s13380g             299   1e-95    
ref|XP_010107630.1|  Histone-lysine N-methyltransferase setd3           297   5e-95    
ref|XP_004297442.1|  PREDICTED: histone-lysine N-methyltransferas...    297   7e-95    Fragaria vesca subsp. vesca
ref|XP_007160424.1|  hypothetical protein PHAVU_002G320700g             296   2e-94    Phaseolus vulgaris [French bean]
ref|XP_002525993.1|  conserved hypothetical protein                     296   2e-94    
gb|KHG01953.1|  Histone-lysine N-methyltransferase setd3                295   1e-93    Gossypium arboreum [tree cotton]
ref|XP_010043959.1|  PREDICTED: histone-lysine N-methyltransferas...    293   2e-93    Eucalyptus grandis [rose gum]
ref|XP_002281246.1|  PREDICTED: histone-lysine N-methyltransferas...    293   3e-93    Vitis vinifera
ref|XP_010681928.1|  PREDICTED: histone-lysine N-methyltransferas...    293   3e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006415823.1|  hypothetical protein EUTSA_v10007532mg             291   2e-92    Eutrema salsugineum [saltwater cress]
ref|XP_009420293.1|  PREDICTED: histone-lysine N-methyltransferas...    291   3e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010556222.1|  PREDICTED: histone-lysine N-methyltransferas...    288   2e-91    Tarenaya hassleriana [spider flower]
emb|CDY27575.1|  BnaA09g28320D                                          288   2e-91    Brassica napus [oilseed rape]
ref|XP_009113827.1|  PREDICTED: histone-lysine N-methyltransferas...    288   2e-91    Brassica rapa
ref|XP_010906939.1|  PREDICTED: histone-lysine N-methyltransferas...    288   6e-91    Elaeis guineensis
ref|XP_007045258.1|  Rubisco methyltransferase family protein iso...    290   1e-90    
ref|XP_009113825.1|  PREDICTED: histone-lysine N-methyltransferas...    284   7e-90    Brassica rapa
ref|XP_004503402.1|  PREDICTED: histone-lysine N-methyltransferas...    284   1e-89    
gb|KFK44512.1|  hypothetical protein AALP_AA1G266300                    283   2e-89    Arabis alpina [alpine rockcress]
ref|XP_003630935.1|  SET domain-containing protein                      282   8e-89    Medicago truncatula
ref|XP_008467098.1|  PREDICTED: histone-lysine N-methyltransferas...    279   1e-87    Cucumis melo [Oriental melon]
ref|XP_008467097.1|  PREDICTED: histone-lysine N-methyltransferas...    279   1e-87    Cucumis melo [Oriental melon]
gb|EPS70598.1|  hypothetical protein M569_04159                         278   2e-87    Genlisea aurea
ref|XP_006307219.1|  hypothetical protein CARUB_v10008819mg             279   4e-87    
ref|NP_564222.1|  rubisco methyltransferase-like protein                277   5e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045257.1|  Rubisco methyltransferase family protein iso...    281   9e-87    
ref|XP_004150615.1|  PREDICTED: uncharacterized protein LOC101210959    276   1e-86    Cucumis sativus [cucumbers]
ref|XP_010477988.1|  PREDICTED: histone-lysine N-methyltransferas...    275   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010460423.1|  PREDICTED: histone-lysine N-methyltransferas...    275   3e-86    Camelina sativa [gold-of-pleasure]
emb|CDX84966.1|  BnaC05g20890D                                          274   5e-86    
ref|XP_002890701.1|  hypothetical protein ARALYDRAFT_472886             274   8e-86    
gb|AAM65946.1|  unknown                                                 273   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499150.1|  PREDICTED: histone-lysine N-methyltransferas...    273   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_008809406.1|  PREDICTED: histone-lysine N-methyltransferas...    271   2e-84    Phoenix dactylifera
ref|NP_001151430.1|  SET domain containing protein                      266   1e-82    Zea mays [maize]
ref|XP_003570495.1|  PREDICTED: histone-lysine N-methyltransferas...    265   2e-82    Brachypodium distachyon [annual false brome]
ref|XP_006647850.1|  PREDICTED: histone-lysine N-methyltransferas...    262   5e-81    Oryza brachyantha
gb|EEE57758.1|  hypothetical protein OsJ_08284                          259   2e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454330.1|  hypothetical protein SORBIDRAFT_04g028760          260   2e-80    Sorghum bicolor [broomcorn]
ref|XP_011628004.1|  PREDICTED: histone-lysine N-methyltransferas...    259   3e-80    
ref|XP_011628008.1|  PREDICTED: histone-lysine N-methyltransferas...    259   4e-80    
gb|EEC73951.1|  hypothetical protein OsI_08832                          259   5e-80    Oryza sativa Indica Group [Indian rice]
ref|NP_001048036.1|  Os02g0733800                                       259   5e-80    
ref|XP_006828432.2|  PREDICTED: histone-lysine N-methyltransferas...    259   5e-80    Amborella trichopoda
ref|XP_004953834.1|  PREDICTED: histone-lysine N-methyltransferas...    254   4e-78    Setaria italica
dbj|BAK03360.1|  predicted protein                                      253   8e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009113823.1|  PREDICTED: histone-lysine N-methyltransferas...    242   1e-73    Brassica rapa
gb|KHN21605.1|  Histone-lysine N-methyltransferase setd3                236   8e-72    Glycine soja [wild soybean]
ref|XP_006580887.1|  PREDICTED: histone-lysine N-methyltransferas...    226   6e-68    
gb|KCW85968.1|  hypothetical protein EUGRSUZ_B02671                     197   3e-57    Eucalyptus grandis [rose gum]
ref|XP_002964620.1|  hypothetical protein SELMODRAFT_81798              196   4e-56    
ref|XP_002989522.1|  hypothetical protein SELMODRAFT_129980             195   9e-56    
ref|XP_011463173.1|  PREDICTED: histone-lysine N-methyltransferas...    192   4e-55    Fragaria vesca subsp. vesca
gb|KJB50381.1|  hypothetical protein B456_008G168000                    189   2e-54    Gossypium raimondii
gb|AAK68776.1|  Unknown protein                                         184   3e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006448172.1|  hypothetical protein CICLE_v10015103mg             182   8e-52    
ref|XP_008467099.1|  PREDICTED: histone-lysine N-methyltransferas...    181   9e-51    Cucumis melo [Oriental melon]
gb|ACF87938.1|  unknown                                                 175   3e-49    Zea mays [maize]
emb|CDY66565.1|  BnaAnng22450D                                          142   2e-36    Brassica napus [oilseed rape]
gb|EMT12546.1|  hypothetical protein F775_52053                         121   1e-28    
ref|XP_002955706.1|  hypothetical protein VOLCADRAFT_106928             115   3e-26    Volvox carteri f. nagariensis
ref|XP_001421544.1|  predicted protein                                  113   1e-25    Ostreococcus lucimarinus CCE9901
ref|XP_005644202.1|  SET domain-containing protein                      110   1e-24    Coccomyxa subellipsoidea C-169
ref|XP_002506068.1|  set domain protein                                 107   2e-23    Micromonas commoda
ref|XP_001703025.1|  predicted protein                                  107   2e-23    Chlamydomonas reinhardtii
emb|CEG00242.1|  Rubisco LS methyltransferase, substrate-binding ...    105   1e-22    Ostreococcus tauri
ref|XP_011399030.1|  Histone-lysine N-methyltransferase setd3           100   3e-21    Auxenochlorella protothecoides
ref|XP_005843772.1|  hypothetical protein CHLNCDRAFT_139898             100   6e-21    Chlorella variabilis
gb|KIY97203.1|  hypothetical protein MNEG_10760                       93.6    2e-19    Monoraphidium neglectum
ref|XP_003062743.1|  predicted protein                                94.4    1e-18    Micromonas pusilla CCMP1545
ref|XP_010046478.1|  PREDICTED: uncharacterized protein LOC104435421  88.6    5e-17    
emb|CBJ25550.1|  set domain protein                                   82.4    2e-14    Ectocarpus siliculosus
gb|ABF73022.1|  putative ribulose-1,5 bisphosphate carboxylase pr...  78.2    6e-14    Karenia brevis
gb|ADE75732.1|  unknown                                               76.6    3e-13    Picea sitchensis
ref|XP_004513627.1|  PREDICTED: uncharacterized protein LOC101503917  70.1    2e-11    
ref|XP_003083454.1|  N-methyltransferase (ISS)                        70.5    1e-10    
dbj|GAM26057.1|  hypothetical protein SAMD00019534_092320             70.1    1e-10    Acytostelium subglobosum LB1
gb|ADE77120.1|  unknown                                               67.0    2e-10    Picea sitchensis
gb|EFA80143.1|  hypothetical protein PPL_06965                        69.3    2e-10    Heterostelium album PN500
ref|XP_002839331.1|  hypothetical protein                             68.2    7e-10    Tuber melanosporum Mel28
ref|XP_004886528.1|  PREDICTED: histone-lysine N-methyltransferas...  66.2    2e-09    
ref|XP_006827327.1|  PREDICTED: fructose-bisphosphate aldolase-ly...  66.6    2e-09    Amborella trichopoda
ref|XP_004886527.1|  PREDICTED: histone-lysine N-methyltransferas...  66.2    3e-09    
ref|XP_011547874.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    4e-09    Plutella xylostella [cabbage moth]
gb|EFB14212.1|  hypothetical protein PANDA_005835                     65.5    5e-09    Ailuropoda melanoleuca
ref|XP_008940006.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-09    Merops nubicus
ref|XP_002917505.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    5e-09    Ailuropoda melanoleuca
ref|XP_004665660.1|  PREDICTED: histone-lysine N-methyltransferas...  64.7    1e-08    Jaculus jaculus
ref|XP_008696086.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    1e-08    Ursus maritimus [white bear]
ref|XP_006749425.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    1e-08    Leptonychotes weddellii
ref|XP_010607434.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    1e-08    Fukomys damarensis [Damara mole rat]
ref|XP_004520416.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    1e-08    Ceratitis capitata [medfly]
ref|XP_003787079.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    1e-08    Otolemur garnettii
ref|XP_005623849.1|  PREDICTED: SET domain containing 3 isoform X1    64.3    1e-08    Canis lupus familiaris [dogs]
ref|XP_004754773.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    1e-08    Mustela putorius furo [black ferret]
ref|XP_007518442.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    1e-08    Erinaceus europaeus [common hedgehog]
ref|XP_004395593.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    1e-08    Odobenus rosmarus divergens
ref|XP_004754774.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    1e-08    Mustela putorius furo [black ferret]
sp|E2RBS6.1|SETD3_CANFA  RecName: Full=Histone-lysine N-methyltra...  64.3    1e-08    Canis lupus familiaris [dogs]
ref|XP_008763130.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    1e-08    Rattus norvegicus [brown rat]
ref|XP_547974.2|  PREDICTED: SET domain containing 3 isoform X2       64.3    1e-08    Canis lupus familiaris [dogs]
ref|XP_008696078.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    1e-08    Ursus maritimus [white bear]
ref|XP_006933177.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    1e-08    
ref|XP_004395594.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    1e-08    Odobenus rosmarus divergens
ref|XP_007094975.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    2e-08    Panthera tigris altaica
ref|XP_010607433.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    2e-08    
ref|XP_005390471.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    2e-08    
gb|AAH09054.2|  SETD3 protein                                         62.0    2e-08    Homo sapiens [man]
ref|XP_005390470.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    2e-08    
ref|XP_010115374.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    2e-08    Chlamydotis macqueenii
ref|XP_002424484.1|  SET domain-containing protein, putative          63.5    2e-08    Pediculus humanus corporis [human body lice]
ref|XP_005390472.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    2e-08    Chinchilla lanigera
ref|XP_005333959.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    2e-08    Ictidomys tridecemlineatus
ref|XP_010286760.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    2e-08    Phaethon lepturus
ref|XP_006516143.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    
ref|XP_010587146.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    Loxodonta africana [African bush elephant]
ref|XP_003408672.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    Loxodonta africana [African bush elephant]
ref|XP_005390469.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    
ref|XP_006516142.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    
gb|ERE72919.1|  histone-lysine N-methyltransferase setd3              62.0    2e-08    Cricetulus griseus [Chinese hamsters]
ref|XP_005343587.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    Microtus ochrogaster [prairie voles]
ref|XP_005438913.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    Falco cherrug
ref|XP_005230640.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    Falco peregrinus [peregrine]
ref|XP_009673764.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    Struthio camelus australis
ref|XP_008823863.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    
ref|NP_082538.2|  histone-lysine N-methyltransferase setd3            63.5    2e-08    Mus musculus [mouse]
gb|EDL18726.1|  mCG18357, isoform CRA_d                               63.5    2e-08    Mus musculus [mouse]
ref|XP_003503762.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    Cricetulus griseus [Chinese hamsters]
ref|XP_004635281.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    2e-08    
dbj|BAB27964.1|  unnamed protein product                              63.5    2e-08    Mus musculus [mouse]
gb|EDL18725.1|  mCG18357, isoform CRA_c                               63.5    2e-08    Mus musculus [mouse]
ref|XP_001448054.1|  hypothetical protein                             63.5    2e-08    Paramecium tetraurelia strain d4-2
gb|EDL97578.1|  rCG27725, isoform CRA_b                               63.2    3e-08    Rattus norvegicus [brown rat]
ref|XP_002726820.2|  PREDICTED: histone-lysine N-methyltransferas...  63.2    3e-08    Rattus norvegicus [brown rat]
ref|XP_003928891.2|  PREDICTED: histone-lysine N-methyltransferas...  63.2    3e-08    Saimiri boliviensis boliviensis
ref|XP_005000549.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    3e-08    Cavia porcellus [guinea pig]
gb|ACA35060.1|  SET domain containing 3 isoform a (predicted)         63.2    3e-08    Callithrix jacchus [common marmoset]
ref|XP_002754318.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    3e-08    Callithrix jacchus [common marmoset]
ref|XP_006971758.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    3e-08    Peromyscus maniculatus bairdii
sp|B0VX69.2|SETD3_CALJA  RecName: Full=Histone-lysine N-methyltra...  63.2    3e-08    Callithrix jacchus [common marmoset]
ref|XP_005683982.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    3e-08    
ref|XP_006037453.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    3e-08    
ref|XP_008823862.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    3e-08    Nannospalax galili
ref|XP_004699177.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    3e-08    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_006184218.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Camelus ferus
ref|XP_006409802.1|  hypothetical protein EUTSA_v10017450mg           59.3    4e-08    
ref|XP_007455709.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Lipotes vexillifer [baiji]
ref|XP_010823267.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    
ref|XP_001925323.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Sus scrofa [pigs]
ref|XP_009935125.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Opisthocomus hoazin [hoatzin]
ref|XP_007178938.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Balaenoptera acutorostrata scammoni
ref|XP_010163308.1|  PREDICTED: uncharacterized protein LOC104522652  62.8    4e-08    
ref|XP_006261107.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    
gb|ABG67019.1|  hypothetical protein LOC84193                         62.8    4e-08    Bos taurus [bovine]
ref|XP_010351976.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    4e-08    Rhinopithecus roxellana
ref|XP_007127406.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    
ref|XP_005483256.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Zonotrichia albicollis
ref|XP_010985881.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Camelus dromedarius [camel]
ref|XP_011939307.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Cercocebus atys
ref|XP_006839672.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    Chrysochloris asiatica
ref|NP_001162549.1|  histone-lysine N-methyltransferase setd3         62.8    4e-08    Papio anubis [baboon]
ref|XP_011715339.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    4e-08    
ref|XP_009426713.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    4e-08    
gb|KIJ49632.1|  hypothetical protein M422DRAFT_225528                 62.4    4e-08    Sphaerobolus stellatus SS14
gb|EHH63882.1|  hypothetical protein EGM_16943                        62.8    4e-08    Macaca fascicularis [crab eating macaque]
ref|XP_004584591.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    5e-08    Ochotona princeps [southern American pika]
ref|XP_009866147.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    5e-08    Apaloderma vittatum
ref|XP_009501524.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    5e-08    Phalacrocorax carbo [common cormorant]
ref|XP_006786319.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    5e-08    Neolamprologus brichardi [lyretail cichlid]
ref|XP_011847041.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Mandrillus leucophaeus
ref|NP_001247800.1|  SET domain containing 3                          62.4    5e-08    Macaca mulatta [rhesus macaque]
ref|XP_005000551.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    5e-08    
ref|XP_011954424.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  62.4    5e-08    
ref|XP_006209111.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Vicugna pacos
ref|XP_011373557.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    5e-08    Pteropus vampyrus
ref|XP_010351975.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Rhinopithecus roxellana
ref|XP_007985990.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Chlorocebus sabaeus
gb|AAH66931.1|  SETD3 protein                                         61.6    5e-08    Homo sapiens [man]
ref|NP_954574.1|  histone-lysine N-methyltransferase setd3 isoform b  61.6    5e-08    Homo sapiens [man]
ref|XP_010010841.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    5e-08    Nestor notabilis
ref|XP_005976639.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Pantholops hodgsonii [Tibetan antelope]
gb|AAI20969.1|  SETD3 protein                                         61.6    5e-08    Homo sapiens [man]
ref|XP_005832141.1|  hypothetical protein GUITHDRAFT_139093           61.6    5e-08    Guillardia theta CCMP2712
ref|XP_011559908.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Plutella xylostella [cabbage moth]
ref|XP_011968307.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Ovis aries musimon
ref|XP_010160219.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    5e-08    Eurypyga helias
ref|XP_005695462.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    
ref|XP_005506163.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Columba livia [carrier pigeon]
ref|XP_005196380.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    
ref|XP_006925717.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    
ref|XP_009702461.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    5e-08    Cariama cristata
gb|ELR57800.1|  SET domain-containing protein 3                       62.4    5e-08    Bos mutus
sp|B5FW36.1|SETD3_OTOGA  RecName: Full=Histone-lysine N-methyltra...  62.4    5e-08    Otolemur garnettii
ref|XP_010849675.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  62.4    5e-08    Bison bison bison
ref|XP_007178937.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    Balaenoptera acutorostrata scammoni
ref|XP_006079183.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    
ref|XP_009247749.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    5e-08    
ref|XP_010823268.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    5e-08    
ref|XP_011535533.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    5e-08    
ref|XP_005893779.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    Bos mutus
ref|XP_007127405.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    
sp|B2KI88.1|SETD3_RHIFE  RecName: Full=Histone-lysine N-methyltra...  62.4    6e-08    Rhinolophus ferrumequinum
ref|XP_006079181.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    
ref|XP_004316161.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    
ref|XP_007178936.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    Balaenoptera acutorostrata scammoni
ref|XP_011968306.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    Ovis aries musimon
ref|XP_004262432.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    Orcinus orca [Orca]
ref|XP_004262431.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    
ref|XP_589822.3|  PREDICTED: histone-lysine N-methyltransferase s...  62.4    6e-08    
gb|AAI42996.1|  SET domain containing 3                               62.4    6e-08    Homo sapiens [man]
ref|XP_006079184.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    6e-08    
ref|XP_004434307.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    6e-08    
ref|XP_011939308.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    6e-08    Cercocebus atys
ref|NP_115609.2|  histone-lysine N-methyltransferase setd3 isoform a  62.0    6e-08    Homo sapiens [man]
ref|XP_003832895.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    6e-08    Pan paniscus [bonobo]
ref|XP_004055723.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    6e-08    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_004376789.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    6e-08    
ref|XP_010199585.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    6e-08    Colius striatus
ref|XP_011535535.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    6e-08    Homo sapiens [man]
ref|XP_005020804.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    6e-08    
ref|XP_008956541.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    6e-08    Pan paniscus [bonobo]
ref|XP_003275417.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    6e-08    
ref|XP_002825140.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    7e-08    Pongo abelii [orang utan]
sp|B1MTJ4.2|SETD3_CALMO  RecName: Full=Histone-lysine N-methyltra...  62.0    7e-08    Plecturocebus moloch [Dusky titi]
ref|XP_009989653.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    7e-08    Tauraco erythrolophus
ref|XP_004837038.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    7e-08    Heterocephalus glaber [naked mole rat]
gb|ACA57918.1|  SET domain containing 3 isoform a (predicted)         62.0    7e-08    Plecturocebus moloch [Dusky titi]
ref|XP_009946319.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    7e-08    Leptosomus discolor
ref|XP_008072667.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    7e-08    Carlito syrichta
ref|XP_647487.1|  hypothetical protein DDB_G0268558                   61.6    7e-08    Dictyostelium discoideum AX4
ref|XP_005020802.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    8e-08    
ref|XP_002200601.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    8e-08    
ref|XP_008517745.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    8e-08    Equus przewalskii [Przewalski horse]
ref|XP_010132490.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    9e-08    Buceros rhinoceros silvestris
gb|ELK01195.1|  SET domain-containing protein 3                       62.0    9e-08    Pteropus alecto
ref|XP_009486745.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    9e-08    Pelecanus crispus
ref|XP_005605495.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    9e-08    Equus caballus [domestic horse]
ref|XP_005477784.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    9e-08    
ref|XP_010219701.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    9e-08    Tinamus guttatus
ref|XP_011449702.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    9e-08    Crassostrea gigas
ref|XP_008490929.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    9e-08    Calypte anna
ref|XP_008517746.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    1e-07    Equus przewalskii [Przewalski horse]
ref|XP_010582226.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    1e-07    Haliaeetus leucocephalus
ref|XP_007381064.1|  SET domain-containing protein                    61.6    1e-07    Punctularia strigosozonata HHB-11173 SS5
ref|XP_005149596.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    1e-07    Melopsittacus undulatus
ref|XP_008928402.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    1e-07    Manacus vitellinus
ref|XP_009078693.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    1e-07    Acanthisitta chloris
ref|XP_009996320.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    1e-07    Chaetura pelagica
ref|XP_009919176.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07    Haliaeetus albicilla
ref|XP_009889331.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    1e-07    Charadrius vociferus
ref|XP_010582223.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    1e-07    Haliaeetus leucocephalus
ref|XP_009100004.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    1e-07    Serinus canaria [canary]
ref|XP_009572039.1|  PREDICTED: uncharacterized protein LOC104073819  61.2    1e-07    Fulmarus glacialis
ref|XP_011968311.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    1e-07    
ref|XP_004837037.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_005520200.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_005417933.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_004837034.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_008581668.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_004837035.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_008627965.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_003291152.1|  hypothetical protein DICPUDRAFT_155733           61.2    1e-07    
ref|XP_011571381.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_004603800.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_010393124.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
gb|EHJ69829.1|  putative SET domain containing 3                      61.2    1e-07    
ref|XP_009962229.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    1e-07    
ref|XP_005646137.1|  SET domain-containing protein                    59.7    1e-07    
ref|XP_004564248.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_009465766.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
gb|KDR19932.1|  SET domain-containing protein 3                       60.8    1e-07    
ref|XP_005877943.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_005746186.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07    
ref|XP_008581667.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    1e-07    
ref|XP_005938765.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    2e-07    
ref|XP_008153003.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    2e-07    
ref|XP_010192982.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    2e-07    
ref|XP_010299716.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    2e-07    
ref|XP_006107202.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    2e-07    
ref|XP_004340372.1|  SET domain containing protein                    60.5    2e-07    
ref|XP_009557460.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    2e-07    
ref|XP_005047631.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    2e-07    
ref|XP_006160039.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    2e-07    
ref|XP_009326495.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    2e-07    
ref|XP_009326510.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    3e-07    
ref|XP_004447745.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    3e-07    
ref|XP_006160035.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    3e-07    
sp|C1FXW2.1|SETD3_DASNO  RecName: Full=Histone-lysine N-methyltra...  60.1    3e-07    
ref|XP_006879229.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-07    
ref|XP_006160036.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-07    
ref|XP_006766687.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-07    
ref|XP_006160037.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-07    
gb|ELK28072.1|  Histone-lysine N-methyltransferase setd3              60.1    3e-07    
ref|XP_009279097.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-07    
ref|XP_009903555.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-07    
ref|XP_009279099.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    3e-07    
gb|ELW47217.1|  Histone-lysine N-methyltransferase setd3              60.1    3e-07    
ref|XP_004682077.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-07    
gb|EPQ14951.1|  Histone-lysine N-methyltransferase setd3              59.7    3e-07    
ref|XP_009326503.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    3e-07    
gb|EPX56043.1|  SET domain containing protein                         59.7    3e-07    
ref|XP_009279098.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    4e-07    
ref|WP_044834540.1|  hypothetical protein                             59.7    4e-07    
ref|WP_043434171.1|  hypothetical protein                             59.7    4e-07    
ref|XP_004335535.1|  SET domain containing protein                    59.7    4e-07    
ref|XP_003756612.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    4e-07    
ref|XP_009811979.1|  PREDICTED: histone-lysine N-methyltransferas...  58.5    4e-07    
ref|NP_001006486.1|  histone-lysine N-methyltransferase setd3         59.7    4e-07    
ref|XP_004358047.1|  SET domain containing protein                    58.9    4e-07    
ref|XP_003641459.2|  PREDICTED: histone-lysine N-methyltransferas...  59.7    5e-07    
ref|XP_007065015.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    5e-07    
gb|ACJ76599.1|  SET domain-containing protein 3 (predicted)           58.9    5e-07    
ref|XP_003643627.2|  PREDICTED: histone-lysine N-methyltransferas...  58.5    6e-07    
ref|XP_009635173.1|  PREDICTED: histone-lysine N-methyltransferas...  58.2    6e-07    
ref|XP_007473665.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    6e-07    
ref|XP_005305900.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    6e-07    
ref|XP_002612559.1|  hypothetical protein BRAFLDRAFT_219602           58.9    6e-07    
ref|XP_001367810.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    6e-07    
ref|XP_010082198.1|  PREDICTED: histone-lysine N-methyltransferas...  57.8    6e-07    
pdb|3SMT|A  Chain A, Crystal Structure Of Human Set Domain-Contai...  58.9    7e-07    
ref|XP_008247172.1|  PREDICTED: histone-lysine N-methyltransferas...  58.9    7e-07    
ref|XP_003206761.2|  PREDICTED: histone-lysine N-methyltransferas...  58.9    7e-07    
ref|XP_008247173.1|  PREDICTED: histone-lysine N-methyltransferas...  58.9    7e-07    
ref|XP_003643892.2|  PREDICTED: histone-lysine N-methyltransferas...  58.5    7e-07    
emb|CDS08282.1|  hypothetical protein LRAMOSA02230                    58.9    7e-07    
dbj|GAN11020.1|  SET domain-containing protein                        58.5    8e-07    
ref|XP_007473664.1|  PREDICTED: histone-lysine N-methyltransferas...  58.9    8e-07    
ref|XP_321037.5|  AGAP002018-PA                                       58.5    8e-07    
gb|AES94087.2|  histone-lysine N-methyltransferase                    55.5    9e-07    
ref|XP_003611129.1|  hypothetical protein MTR_5g010630                55.5    9e-07    
ref|XP_002721936.2|  PREDICTED: histone-lysine N-methyltransferas...  58.9    9e-07    
ref|XP_003224897.2|  PREDICTED: histone-lysine N-methyltransferas...  57.4    1e-06    
ref|WP_043409385.1|  hypothetical protein                             58.2    1e-06    
gb|KEH30791.1|  rubisco large subunit N-methyltransferase             58.2    1e-06    
gb|KCW85966.1|  hypothetical protein EUGRSUZ_B02669                   57.8    1e-06    
ref|XP_004928302.1|  PREDICTED: histone-lysine N-methyltransferas...  58.2    1e-06    
ref|XP_005845314.1|  hypothetical protein CHLNCDRAFT_137077           58.2    1e-06    
ref|XP_011212148.1|  PREDICTED: histone-lysine N-methyltransferas...  57.0    1e-06    
ref|XP_005990382.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  58.2    1e-06    
ref|XP_001759585.1|  predicted protein                                57.8    1e-06    
gb|KEH30792.1|  rubisco large subunit N-methyltransferase             57.8    2e-06    
ref|XP_003214383.2|  PREDICTED: histone-lysine N-methyltransferas...  57.8    2e-06    
ref|XP_007667065.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  57.0    2e-06    
gb|EPB82303.1|  hypothetical protein HMPREF1544_10943                 57.4    2e-06    
dbj|GAM87928.1|  hypothetical protein ANO11243_059560                 57.4    3e-06    
ref|XP_001512684.3|  PREDICTED: histone-lysine N-methyltransferas...  57.0    3e-06    
ref|XP_011312838.1|  PREDICTED: histone-lysine N-methyltransferas...  57.0    3e-06    
gb|EIE76784.1|  hypothetical protein RO3G_01488                       57.0    3e-06    
dbj|GAM27406.1|  hypothetical protein SAMD00019534_105810             57.0    3e-06    
ref|XP_008192296.1|  PREDICTED: histone-lysine N-methyltransferas...  57.0    3e-06    
emb|CDW58566.1|  Histone-lysine N-methyltransferase setd3             57.0    3e-06    
ref|XP_002612520.1|  hypothetical protein BRAFLDRAFT_214305           56.6    3e-06    
ref|XP_005090791.1|  PREDICTED: histone-lysine N-methyltransferas...  57.0    3e-06    
gb|AIC60917.1|  SETD3                                                 55.5    4e-06    
ref|XP_001952202.2|  PREDICTED: histone-lysine N-methyltransferas...  55.8    4e-06    
ref|XP_011294563.1|  PREDICTED: histone-lysine N-methyltransferas...  57.0    4e-06    
ref|XP_004516567.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  56.6    4e-06    
gb|KEH38300.1|  rubisco methyltransferase family protein              53.1    4e-06    
ref|XP_005090792.1|  PREDICTED: histone-lysine N-methyltransferas...  56.6    4e-06    
ref|XP_003241429.1|  PREDICTED: histone-lysine N-methyltransferas...  56.6    4e-06    
ref|XP_009055118.1|  hypothetical protein LOTGIDRAFT_118649           56.2    5e-06    
gb|EFA01708.1|  hypothetical protein TcasGA2_TC007288                 55.8    5e-06    
gb|EGO00330.1|  hypothetical protein SERLA73DRAFT_89272               56.6    5e-06    
ref|XP_007318011.1|  hypothetical protein SERLADRAFT_437599           56.6    5e-06    
ref|XP_006123823.1|  PREDICTED: histone-lysine N-methyltransferas...  56.6    5e-06    
ref|XP_006123826.1|  PREDICTED: histone-lysine N-methyltransferas...  56.6    5e-06    
gb|ELU11224.1|  hypothetical protein CAPTEDRAFT_181634                56.2    5e-06    
ref|XP_003436005.1|  AGAP002018-PB                                    56.2    5e-06    
gb|KFM79046.1|  Histone-lysine N-methyltransferase setd3              55.8    6e-06    
ref|XP_004358932.1|  hypothetical protein DFA_00957                   56.2    6e-06    
ref|XP_003556768.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  56.2    6e-06    
ref|XP_008291908.1|  PREDICTED: histone-lysine N-methyltransferas...  56.2    7e-06    
ref|XP_011177109.1|  PREDICTED: histone-lysine N-methyltransferas...  55.5    7e-06    
ref|XP_003529470.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  55.8    8e-06    
ref|XP_008956542.1|  PREDICTED: histone-lysine N-methyltransferas...  55.8    8e-06    
ref|XP_007439041.1|  PREDICTED: histone-lysine N-methyltransferas...  55.8    8e-06    
ref|XP_657490.1|  hypothetical protein                                55.8    8e-06    
ref|XP_011689690.1|  PREDICTED: histone-lysine N-methyltransferas...  55.8    8e-06    
dbj|BAB15525.1|  unnamed protein product                              55.8    9e-06    
gb|EPB86184.1|  hypothetical protein HMPREF1544_06996                 55.8    9e-06    
ref|XP_001401929.2|  SET domain protein                               55.8    9e-06    
ref|XP_001633261.1|  predicted protein                                55.5    1e-05    
ref|XP_001443948.1|  hypothetical protein                             55.5    1e-05    
dbj|GAM19232.1|  hypothetical protein SAMD00019534_024070             55.5    1e-05    
emb|CEJ01742.1|  hypothetical protein RMCBS344292_15763               55.1    1e-05    
ref|XP_002605138.1|  hypothetical protein BRAFLDRAFT_122719           55.1    1e-05    
ref|XP_006632323.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  55.1    1e-05    
ref|XP_011061385.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    1e-05    
gb|AAI35195.1|  LOC549331 protein                                     55.1    2e-05    
emb|CEG68627.1|  hypothetical protein RMATCC62417_04848               54.7    2e-05    
emb|CCA68310.1|  related to SET7-Regulatory protein                   54.7    2e-05    
ref|XP_005305901.1|  PREDICTED: histone-lysine N-methyltransferas...  54.7    2e-05    
ref|NP_001016577.1|  histone-lysine N-methyltransferase setd3         54.7    2e-05    
sp|B7ZUF3.1|SETD3_XENTR  RecName: Full=Histone-lysine N-methyltra...  54.7    2e-05    
emb|CEI97595.1|  hypothetical protein RMCBS344292_11725               54.3    2e-05    
ref|XP_001851364.1|  conserved hypothetical protein                   53.9    2e-05    
gb|EMS21638.1|  SET domain-containing protein 6                       54.3    2e-05    
ref|XP_011395602.1|  Protein SET DOMAIN GROUP 40                      54.3    2e-05    
ref|XP_646263.1|  SET domain-containing protein                       54.3    3e-05    
emb|CEG68626.1|  hypothetical protein RMATCC62417_04848               54.3    3e-05    
ref|XP_001449873.1|  hypothetical protein                             54.3    3e-05    
ref|XP_011635617.1|  PREDICTED: histone-lysine N-methyltransferas...  54.3    3e-05    
gb|KEQ84445.1|  SET domain-containing protein                         54.3    3e-05    
ref|XP_002505573.1|  set domain protein                               54.3    3e-05    
ref|XP_002956649.1|  hypothetical protein VOLCADRAFT_107344           53.9    3e-05    
gb|EPZ34777.1|  hypothetical protein O9G_004489                       54.3    3e-05    
emb|CEJ80640.1|  hypothetical protein VHEMI00813                      53.9    3e-05    
ref|XP_012055361.1|  PREDICTED: histone-lysine N-methyltransferas...  53.5    3e-05    
ref|XP_002502136.1|  predicted protein                                53.9    3e-05    
dbj|GAA97802.1|  hypothetical protein E5Q_04481                       53.9    3e-05    
gb|EGI61270.1|  SET domain-containing protein 3                       53.1    3e-05    
ref|XP_011149859.1|  PREDICTED: histone-lysine N-methyltransferas...  53.9    4e-05    
gb|KEQ94513.1|  hypothetical protein AUEXF2481DRAFT_5995              53.9    4e-05    
gb|KFB37363.1|  AGAP002018-PA-like protein                            52.8    4e-05    
ref|XP_008860094.1|  [Ribulose-bisphosphate-carboxylase]-lysine N...  53.9    4e-05    
gb|KEQ61003.1|  SET domain-containing protein                         53.5    5e-05    
ref|XP_003058768.1|  predicted protein                                53.5    5e-05    
ref|XP_008618202.1|  hypothetical protein SDRG_13880                  53.5    5e-05    
ref|XP_006639154.1|  PREDICTED: SET domain-containing protein 4-like  53.1    5e-05    
emb|CEP16037.1|  hypothetical protein                                 53.5    5e-05    
ref|XP_005797792.1|  PREDICTED: histone-lysine N-methyltransferas...  53.5    5e-05    
ref|NP_172856.1|  [fructose-bisphosphate aldolase]-lysine N-methy...  53.1    5e-05    
gb|KDO32172.1|  hypothetical protein SPRG_03389                       53.1    6e-05    
ref|XP_007553148.1|  PREDICTED: histone-lysine N-methyltransferas...  53.5    6e-05    
ref|XP_007864235.1|  SET domain-containing protein                    53.1    6e-05    
ref|XP_008398366.1|  PREDICTED: histone-lysine N-methyltransferas...  53.1    6e-05    
ref|XP_007942800.1|  PREDICTED: histone-lysine N-methyltransferas...  53.1    7e-05    
ref|XP_008482060.1|  PREDICTED: SET domain-containing protein 4       52.8    7e-05    
ref|XP_001625323.1|  predicted protein                                52.8    7e-05    
gb|AAC29137.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  52.8    7e-05    
emb|CDW88916.1|  set domain containing protein                        53.1    8e-05    
gb|AAC29136.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase N...  52.8    8e-05    
ref|XP_011881916.1|  PREDICTED: histone-lysine N-methyltransferas...  52.8    8e-05    
ref|XP_002488126.1|  SET domain protein                               52.8    8e-05    
ref|XP_008361779.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  52.8    9e-05    
ref|XP_011463675.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  52.8    9e-05    
gb|KFK43648.1|  hypothetical protein AALP_AA1G154400                  52.8    9e-05    
ref|XP_008221574.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  52.8    9e-05    
gb|KFD53485.1|  hypothetical protein M513_05591                       52.8    1e-04    
ref|XP_002596839.1|  hypothetical protein BRAFLDRAFT_284593           52.8    1e-04    
gb|EFN77610.1|  SET domain-containing protein 3                       52.0    1e-04    
ref|XP_002992361.1|  hypothetical protein SELMODRAFT_430576           52.4    1e-04    
ref|XP_001738871.1|  hypothetical protein                             52.4    1e-04    
sp|Q43088.1|RBCMT_PEA  RecName: Full=Ribulose-1,5 bisphosphate ca...  52.4    1e-04    
ref|XP_008800499.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...  52.0    1e-04    
ref|XP_011254420.1|  PREDICTED: histone-lysine N-methyltransferas...  52.0    1e-04    
ref|XP_002174388.1|  lysine methyltransferase                         52.0    2e-04    
ref|XP_005838229.1|  hypothetical protein GUITHDRAFT_103166           52.0    2e-04    
gb|KIY70636.1|  SET domain-containing protein                         52.0    2e-04    
emb|CBJ32909.1|  protein N-methyltransferase                          51.6    2e-04    
ref|XP_003977480.1|  PREDICTED: histone-lysine N-methyltransferas...  52.0    2e-04    
ref|XP_003576520.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...  51.6    2e-04    
ref|XP_011114351.1|  hypothetical protein H072_8656                   51.6    2e-04    
ref|XP_011159299.1|  PREDICTED: histone-lysine N-methyltransferas...  51.6    2e-04    
ref|XP_006820034.1|  PREDICTED: SET domain-containing protein 4-like  51.6    2e-04    
ref|XP_011128127.1|  hypothetical protein AOL_s00215g623              51.6    2e-04    
ref|XP_010108706.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...  51.6    2e-04    
ref|XP_003488333.1|  PREDICTED: histone-lysine N-methyltransferas...  51.6    2e-04    
ref|XP_006417064.1|  hypothetical protein EUTSA_v10007614mg           51.6    2e-04    
ref|XP_007266369.1|  SET domain-containing protein                    51.6    2e-04    
pdb|2H21|A  Chain A, Structure Of Rubisco Lsmt Bound To Adomet        51.6    2e-04    
gb|EYE90556.1|  SET domain protein                                    51.6    2e-04    
gb|KJE92150.1|  hypothetical protein CAOG_009636                      51.6    2e-04    
pdb|1MLV|A  Chain A, Structure And Catalytic Mechanism Of A Set D...  51.2    2e-04    
ref|XP_003398458.1|  PREDICTED: histone-lysine N-methyltransferas...  51.6    2e-04    
gb|ETE71402.1|  Histone-lysine N-methyltransferase setd3              51.6    3e-04    
emb|CEP09797.1|  hypothetical protein                                 51.2    3e-04    
ref|XP_004085141.1|  PREDICTED: histone-lysine N-methyltransferas...  51.2    3e-04    
ref|XP_011312839.1|  PREDICTED: histone-lysine N-methyltransferas...  51.2    3e-04    
ref|XP_005847559.1|  hypothetical protein CHLNCDRAFT_52262            51.2    3e-04    
gb|KIW03364.1|  hypothetical protein PV09_05572                       51.2    3e-04    
ref|XP_006562938.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  51.2    3e-04    
gb|ETP02735.1|  hypothetical protein F441_20218                       51.2    3e-04    
emb|CBN78133.1|  protein N-methyltransferase                          51.2    3e-04    



>ref|XP_004228642.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Solanum 
lycopersicum]
Length=471

 Score =   356 bits (913),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 194/225 (86%), Gaps = 7/225 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M +KM LMA SLTH+RPLTCAA  A +Y SRL  QPPDLIKWVK EGGFVH S+K+A  +
Sbjct  1    MSSKMMLMANSLTHVRPLTCAA--AAVYPSRLVAQPPDLIKWVKTEGGFVHKSIKVAQGD  58

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF--GTVEAD---SPIPKLAQQVPEELWAMKLG  351
             +GLG+VAS+DIPKGSDLIALP+H+PL+F   T E++   S + KLAQ VPEELWAMKLG
Sbjct  59   TFGLGLVASEDIPKGSDLIALPQHIPLKFDGSTSESENSHSALIKLAQHVPEELWAMKLG  118

Query  352  LKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEK  531
            LKLLQER+RKGSFWWPYISNLPE YSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLL+FEK
Sbjct  119  LKLLQERARKGSFWWPYISNLPETYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLDFEK  178

Query  532  FVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
             + +EL N++ D HPF GQDVDSSALGWAMSAVSSRAFRLYGGKR
Sbjct  179  ILKHELENLKPDDHPFSGQDVDSSALGWAMSAVSSRAFRLYGGKR  223



>ref|XP_009768042.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
sylvestris]
Length=476

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 191/228 (84%), Gaps = 12/228 (5%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M TKM LMA SLTH+RPLTCAA +     SRL  QPPDLIKWVK EGGFVH SV+IA  +
Sbjct  1    MSTKMMLMANSLTHVRPLTCAAAAG----SRLVPQPPDLIKWVKSEGGFVHKSVQIAQGD  56

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEAD--------SPIPKLAQQVPEELWAM  342
             +GLG+VAS+DIPKGSD+IALP+H+PL+ G++EA+        S + KLAQ VPEELWAM
Sbjct  57   SFGLGLVASEDIPKGSDIIALPQHIPLKIGSLEAETSLDAGAHSALIKLAQHVPEELWAM  116

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            KLGLKLLQER++KGSFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE
Sbjct  117  KLGLKLLQERAKKGSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  176

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
            F+K + +EL N++ D HPF GQ VDSSALGWAMSAVSSRAFRLYG KR
Sbjct  177  FDKILKHELENLKPDDHPFGGQHVDSSALGWAMSAVSSRAFRLYGSKR  224



>ref|XP_009611032.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
tomentosiformis]
Length=476

 Score =   343 bits (880),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 190/228 (83%), Gaps = 12/228 (5%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M TKM LMA SLTH+RPLTC A +     SRL  QPPDLIKWVK EGGFVH SV+I+  +
Sbjct  1    MSTKMMLMANSLTHVRPLTCVAAAG----SRLVPQPPDLIKWVKSEGGFVHKSVQISQGD  56

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEAD--------SPIPKLAQQVPEELWAM  342
             +GLG+VAS+DIPKGSD+IALP+H+PL+FG++EA+        S +  LAQ VPEELWAM
Sbjct  57   SFGLGLVASEDIPKGSDIIALPQHIPLKFGSLEAETSLDAGAHSALINLAQHVPEELWAM  116

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            KLGLKLL+ER++KGSFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE
Sbjct  117  KLGLKLLRERAKKGSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  176

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
            F+K + +EL N++ D HPF GQ VDSSALGWAMSAVSSRAFRLYG KR
Sbjct  177  FDKILKHELENLKPDDHPFGGQHVDSSALGWAMSAVSSRAFRLYGSKR  224



>ref|XP_006367610.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Solanum 
tuberosum]
Length=475

 Score =   341 bits (875),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 190/227 (84%), Gaps = 7/227 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSAT--LYSSRLATQPPDLIKWVKREGGFVHPSVKIAI  180
            M +KM LMA SLTH+RPLTCA  +A   +Y SRL  QPPDLIKWVK EGGFVH S+KIA 
Sbjct  1    MSSKMMLMANSLTHVRPLTCATAAAAAAVYPSRLVAQPPDLIKWVKIEGGFVHKSIKIAQ  60

Query  181  SEPYGLGVVASDDIPKGSDLIALPEHLPLQFG-----TVEADSPIPKLAQQVPEELWAMK  345
             + +GLG+VAS+DIPKGSDLIALP+H+PL+F      +  + S + KLAQ VPEELWAMK
Sbjct  61   GDSFGLGLVASEDIPKGSDLIALPQHIPLKFDGSSSESENSHSALIKLAQHVPEELWAMK  120

Query  346  LGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEF  525
            LGLKLLQER+RKGSFWWPYISNLPE YSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEF
Sbjct  121  LGLKLLQERARKGSFWWPYISNLPETYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEF  180

Query  526  EKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
             K + +EL N++ D HPF  QDVDSSALGWAMSAVSSRAFRLYGGKR
Sbjct  181  GKILKHELENLKPDDHPFSCQDVDSSALGWAMSAVSSRAFRLYGGKR  227



>gb|EYU30121.1| hypothetical protein MIMGU_mgv1a005562mg [Erythranthe guttata]
Length=479

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 186/227 (82%), Gaps = 8/227 (4%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M TKM LMA+SLTH RP+ CAA SA +  SRLA+QPPDLIKWV+REGGFVH S+KIA  E
Sbjct  1    MSTKMMLMASSLTHARPIACAAASAFINPSRLASQPPDLIKWVRREGGFVHHSIKIAYLE  60

Query  187  P-------YGLGVVASDDIPKGSDLIALPEHLPLQFGTVEAD-SPIPKLAQQVPEELWAM  342
                     GLG+VA+DDIPKGSDLI LP+H+PL+F   + + S +  LA+ +PEELWAM
Sbjct  61   EDKPNGPGLGLGLVATDDIPKGSDLITLPDHIPLRFDAKDGEPSTLIDLARHIPEELWAM  120

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            KLG++LLQER+ +GSFWWPYI NLPE YSVPIFFPGEDIKNLQYAPLL+QVNKRCRFLLE
Sbjct  121  KLGVRLLQERAIRGSFWWPYIGNLPETYSVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLE  180

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            FEK V NEL  ++ D HPF G+++D+SALGWAMSAVSSRAFRL+G K
Sbjct  181  FEKLVKNELETIKLDDHPFGGKNIDASALGWAMSAVSSRAFRLHGKK  227



>ref|XP_011070578.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Sesamum 
indicum]
Length=482

 Score =   325 bits (834),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 187/228 (82%), Gaps = 8/228 (4%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M +KM LMA SLTH RPL  AA SA LY +RL  QPPD+IKWV+REGGFVH S+KIA  E
Sbjct  1    MSSKMMLMATSLTHARPLAYAAASACLYPARLVPQPPDIIKWVRREGGFVHQSIKIAYLE  60

Query  187  P-------YGLGVVASDDIPKGSDLIALPEHLPLQFGTVEAD-SPIPKLAQQVPEELWAM  342
                     GLG+VAS++IPKGSDLI LP+H+PL+F   + + S +  LA+ +PEELWAM
Sbjct  61   EEKPNGLGLGLGLVASEEIPKGSDLIILPQHIPLRFDAKDGEPSALIDLARHIPEELWAM  120

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            KLGLKLLQER+RKGSFWWPYISNLPE YSVPIFFPGEDIKNLQYAPLL+QVNKRCRFLL+
Sbjct  121  KLGLKLLQERARKGSFWWPYISNLPETYSVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLD  180

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
            FEK V N+L NV+ D HPF GQD+D+S+LGWAMSAVSSRAFRLYG ++
Sbjct  181  FEKLVKNKLGNVKLDDHPFGGQDIDASSLGWAMSAVSSRAFRLYGSRQ  228



>emb|CDP16308.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 183/226 (81%), Gaps = 8/226 (4%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M TK+  MA+SL+ +RPLTCAA +  L S RL  QPPDLIKWVKREGGFVH +VK+A  +
Sbjct  1    MSTKIMFMASSLSQVRPLTCAA-AGGLSSGRLVPQPPDLIKWVKREGGFVHQAVKVA-QQ  58

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS------PIPKLAQQVPEELWAMKL  348
              GLG++A+ +IPKGSDLI LPEH+PL+F   EADS       + KLAQ +PEELWAMKL
Sbjct  59   LDGLGLIATAEIPKGSDLIVLPEHIPLRFEASEADSEKGSYSSLIKLAQHIPEELWAMKL  118

Query  349  GLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE  528
            GLKLLQER++KGSFWW YISNLPE YSVPIFF GEDIKNLQYAPLL QVNKRCRFLL+F+
Sbjct  119  GLKLLQERAKKGSFWWSYISNLPETYSVPIFFQGEDIKNLQYAPLLSQVNKRCRFLLDFD  178

Query  529  KFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
            K V  ++ N+  + HPF GQDVD+SALGWAMSAVSSRAFRL+G KR
Sbjct  179  KAVKIKIENLRSEDHPFGGQDVDASALGWAMSAVSSRAFRLHGNKR  224



>ref|XP_007222801.1| hypothetical protein PRUPE_ppa005021mg [Prunus persica]
 gb|EMJ24000.1| hypothetical protein PRUPE_ppa005021mg [Prunus persica]
Length=481

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 181/220 (82%), Gaps = 7/220 (3%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLT  RPLTC A ++T Y  RLA  PPDLIKWV+REGGFVH +VKIA    +GLG+
Sbjct  6    MVMASLTAFRPLTCGASTSTSYPGRLAPYPPDLIKWVRREGGFVHEAVKIAQDSSFGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVEA-------DSPIPKLAQQVPEELWAMKLGLKLL  363
            VAS++IPKGS+LI LPEH+PL+FG++E+       DS I  LA+ VPEELWAMKLGLKLL
Sbjct  66   VASEEIPKGSELIVLPEHVPLRFGSLESEGGDGGLDSVIVNLARHVPEELWAMKLGLKLL  125

Query  364  QERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVN  543
            QER++ GSFWWPYIS+LPE +++PIFFPGEDIKNLQYAPLLYQVNKRCRFLL+FE+ V  
Sbjct  126  QERAKTGSFWWPYISSLPETFNIPIFFPGEDIKNLQYAPLLYQVNKRCRFLLDFEQEVKC  185

Query  544  ELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
             L N++ + HPF GQ VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  186  ALENLKPNDHPFGGQAVDASSLGWAMSAVSSRAFRLYGKK  225



>ref|XP_008381743.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=483

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 184/227 (81%), Gaps = 8/227 (4%)
 Frame = +1

Query  1    GSMPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAI  180
            GS      ++ AS T  RPLTCAA ++  Y +RLA  PPDLIKWV+REGGFVH +VKIA 
Sbjct  4    GSTMAASKMLMASFTAFRPLTCAASAS--YPARLAPHPPDLIKWVRREGGFVHEAVKIAQ  61

Query  181  SEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEAD------SPIPKLAQQVPEELWAM  342
               +GLG+VAS++IPKGS+LI LPEH+PL+FG++E+D      S +  LA+ VPEELWAM
Sbjct  62   DSSFGLGLVASEEIPKGSELIVLPEHVPLRFGSIESDGGDGVDSVLDDLARLVPEELWAM  121

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            KLGLKLLQER++ GSFWWPYIS+LPE +++PIFFPGEDIKNLQYAPLLYQVNKRCRFLL+
Sbjct  122  KLGLKLLQERAKTGSFWWPYISSLPETFNIPIFFPGEDIKNLQYAPLLYQVNKRCRFLLD  181

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            FEK V + L N++ + HPF GQ VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  182  FEKEVKHALENLKPNDHPFGGQSVDASSLGWAMSAVSSRAFRLYGKK  228



>ref|XP_008221467.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Prunus mume]
 ref|XP_008245923.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Prunus mume]
Length=356

 Score =   311 bits (797),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 181/220 (82%), Gaps = 7/220 (3%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLT  RPLTCAA ++T Y  RLA  PPDLIKWV+REGGFVH +VKIA    +GLG+
Sbjct  6    MVMASLTAFRPLTCAASTSTSYPGRLAPYPPDLIKWVRREGGFVHEAVKIAQDSSFGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVEA-------DSPIPKLAQQVPEELWAMKLGLKLL  363
            VAS++IPKGS+LI LPEH+PL+FG++E+       DS +  LA+ VPEELWAMKLGLKLL
Sbjct  66   VASEEIPKGSELIVLPEHVPLRFGSLESEGGDGGLDSVLVNLARHVPEELWAMKLGLKLL  125

Query  364  QERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVN  543
            QER++ GSFWW YIS+LPE +++PIFFPGEDIKNLQYAPLLYQVNKRCRFLL+FE+ V  
Sbjct  126  QERAKTGSFWWSYISSLPETFNIPIFFPGEDIKNLQYAPLLYQVNKRCRFLLDFEQEVER  185

Query  544  ELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
             L N++ + HPF GQ VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  186  ALENLKPNDHPFGGQAVDASSLGWAMSAVSSRAFRLYGKK  225



>ref|XP_007045259.1| Rubisco methyltransferase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY01091.1| Rubisco methyltransferase family protein isoform 3 [Theobroma 
cacao]
Length=473

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 175/216 (81%), Gaps = 5/216 (2%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++  SLT  RPLTCAA  A  Y +RL   PPDL+KWVKREGGFVH +VKIA     GLG+
Sbjct  6    MLIPSLTKFRPLTCAA--AAFYPTRLVPHPPDLVKWVKREGGFVHEAVKIAQDTTLGLGL  63

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVE---ADSPIPKLAQQVPEELWAMKLGLKLLQERS  375
            VAS +IPKGSDLI LP+H+PL+F + E   ADS +  L+ QVPEELWAMKLGLKLLQER+
Sbjct  64   VASGEIPKGSDLIVLPDHVPLKFQSDEQNGADSVLLHLSHQVPEELWAMKLGLKLLQERA  123

Query  376  RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSN  555
            + GSFWWPYISNLPE YSVPIFF GEDIKNLQYAPLLYQVNKRCRFLLEFE+ V N L +
Sbjct  124  KVGSFWWPYISNLPETYSVPIFFTGEDIKNLQYAPLLYQVNKRCRFLLEFEQEVKNALKD  183

Query  556  VERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            ++   HPF GQDVD+S+LGWAMSAVSSRAFRLYG K
Sbjct  184  LKLSEHPFGGQDVDASSLGWAMSAVSSRAFRLYGKK  219



>ref|XP_008221466.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Prunus mume]
 ref|XP_008245922.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Prunus mume]
Length=481

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 181/220 (82%), Gaps = 7/220 (3%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLT  RPLTCAA ++T Y  RLA  PPDLIKWV+REGGFVH +VKIA    +GLG+
Sbjct  6    MVMASLTAFRPLTCAASTSTSYPGRLAPYPPDLIKWVRREGGFVHEAVKIAQDSSFGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVEA-------DSPIPKLAQQVPEELWAMKLGLKLL  363
            VAS++IPKGS+LI LPEH+PL+FG++E+       DS +  LA+ VPEELWAMKLGLKLL
Sbjct  66   VASEEIPKGSELIVLPEHVPLRFGSLESEGGDGGLDSVLVNLARHVPEELWAMKLGLKLL  125

Query  364  QERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVN  543
            QER++ GSFWW YIS+LPE +++PIFFPGEDIKNLQYAPLLYQVNKRCRFLL+FE+ V  
Sbjct  126  QERAKTGSFWWSYISSLPETFNIPIFFPGEDIKNLQYAPLLYQVNKRCRFLLDFEQEVER  185

Query  544  ELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
             L N++ + HPF GQ VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  186  ALENLKPNDHPFGGQAVDASSLGWAMSAVSSRAFRLYGKK  225



>ref|XP_009351546.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pyrus x 
bretschneideri]
Length=484

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 180/219 (82%), Gaps = 8/219 (4%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ AS T  RPLTCAA ++  Y +RLA  PPDLIKWV+REGGFVH +VKIA    +GLG+
Sbjct  12   MLMASFTAFRPLTCAASAS--YPARLAPHPPDLIKWVRREGGFVHEAVKIAQDSSFGLGL  69

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVEAD------SPIPKLAQQVPEELWAMKLGLKLLQ  366
            VAS++IPKGS+LI LPEH+PL+F ++E+D      S +  LA+ VPEELWAMKLGLKLLQ
Sbjct  70   VASEEIPKGSELIVLPEHVPLRFDSIESDGGDGVDSVLDDLARLVPEELWAMKLGLKLLQ  129

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER++ GSFWWPYIS+LPE +++PIFFPGEDIKNLQYAPLLYQVNKRCRFLL+FEK V   
Sbjct  130  ERAKTGSFWWPYISSLPETFNIPIFFPGEDIKNLQYAPLLYQVNKRCRFLLDFEKEVKRA  189

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            L N++ + HPF GQ VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  190  LENLKSNDHPFGGQSVDASSLGWAMSAVSSRAFRLYGKK  228



>ref|XP_008389174.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=478

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 179/219 (82%), Gaps = 8/219 (4%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ AS T  RPLTCAA ++  Y +RLA  PPDLIKWV+REGGFVH  VKIA    +GLG+
Sbjct  6    MLLASFTAFRPLTCAASAS--YPARLAPHPPDLIKWVRREGGFVHEGVKIAQDSSFGLGL  63

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVEA------DSPIPKLAQQVPEELWAMKLGLKLLQ  366
            VAS++IPKGS+LI LPEH+PL+FG  E+      DS +  LA+QVPEELWAMKLGLKLLQ
Sbjct  64   VASEEIPKGSELIVLPEHVPLRFGLTESEGGDGVDSVLDNLARQVPEELWAMKLGLKLLQ  123

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER++ GSFWWPYIS+LPE +++PIFFPGEDIKNLQYAPLLYQVNKRCRFLL+FE+ V   
Sbjct  124  ERAKTGSFWWPYISSLPETFNIPIFFPGEDIKNLQYAPLLYQVNKRCRFLLDFEQEVKRA  183

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            L N++ + HPF GQ VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  184  LENLKPNDHPFGGQAVDASSLGWAMSAVSSRAFRLYGRK  222



>ref|XP_010271179.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=494

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 181/217 (83%), Gaps = 8/217 (4%)
 Frame = +1

Query  31   AASLTHLRPLTCAAVSAT--LYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
              SLTH RPLTCA+ SA+   + +RL   PPDL+KWV++EGGFVH  +KIA  + YGLG+
Sbjct  21   TTSLTHFRPLTCASASASTACHPARLVPHPPDLVKWVRQEGGFVHHGLKIAAGDSYGLGL  80

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVEAD------SPIPKLAQQVPEELWAMKLGLKLLQ  366
            VAS++IPKGSDLIALP HLPL+F +++++      S + +LA+QVPEELWAM+LGLKLLQ
Sbjct  81   VASEEIPKGSDLIALPSHLPLRFRSLDSEDGDGIESVLIQLARQVPEELWAMRLGLKLLQ  140

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER++ GSFWWPYISNLPE YSVPIFFPG+DIKNLQYAPLLYQVNKRCRFLL+FE+ + + 
Sbjct  141  ERAKVGSFWWPYISNLPETYSVPIFFPGDDIKNLQYAPLLYQVNKRCRFLLDFERAMKDA  200

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
            L NV  + HPF GQ++D+S+LGWAMSAVSSRAFRL+G
Sbjct  201  LENVRPEDHPFGGQNIDASSLGWAMSAVSSRAFRLHG  237



>gb|KHG01954.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=476

 Score =   310 bits (795),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 173/216 (80%), Gaps = 3/216 (1%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            L+  +L+H RPLTCAA  +    +RL   PPDL+KW+KREGGFVH +V I     YGLG+
Sbjct  6    LLIPTLSHFRPLTCAAAVSATNPARLVPHPPDLLKWIKREGGFVHEAVTITQDTTYGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTV---EADSPIPKLAQQVPEELWAMKLGLKLLQERS  375
            VAS  IPKGSDLI LPEH+PL+F +    EADS +  L+ +VPEELWAMKLGLKLLQER+
Sbjct  66   VASGGIPKGSDLIVLPEHVPLKFQSDKDDEADSVLLPLSNRVPEELWAMKLGLKLLQERA  125

Query  376  RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSN  555
            + GSFWWPYISNLPE Y+VPIFF GEDIKNLQYAPLLYQVNKRCRFLLEFE+ V N L N
Sbjct  126  KVGSFWWPYISNLPETYTVPIFFSGEDIKNLQYAPLLYQVNKRCRFLLEFEQEVKNVLKN  185

Query  556  VERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            ++   HPF GQDVD+S+LGWAMSAVSSRAFRLYG K
Sbjct  186  LKPSEHPFGGQDVDASSLGWAMSAVSSRAFRLYGKK  221



>gb|KJB50382.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=475

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 172/216 (80%), Gaps = 3/216 (1%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            L+  +L+H RPLTCAA  +    +RL   PPDL+KW+KREGGFVH +V I     YGLG+
Sbjct  6    LLIPTLSHFRPLTCAAAVSASNPARLVPHPPDLLKWIKREGGFVHEAVTITQDTTYGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTV---EADSPIPKLAQQVPEELWAMKLGLKLLQERS  375
            VAS  IPKGSDLI LPEH+PL+F +    EADS    L+ +VPEELWAMKLGLKLLQER+
Sbjct  66   VASGGIPKGSDLIVLPEHVPLKFQSDKDDEADSVSLPLSNRVPEELWAMKLGLKLLQERA  125

Query  376  RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSN  555
            + GSFWWPYISNLPE Y+VPIFF GEDIKNLQYAPLLYQVNKRCRFLLEFE+ V N L N
Sbjct  126  KVGSFWWPYISNLPETYTVPIFFSGEDIKNLQYAPLLYQVNKRCRFLLEFEQEVKNVLKN  185

Query  556  VERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            ++   HPF GQDVD+S+LGWAMSAVSSRAFRLYG K
Sbjct  186  LKPSEHPFGGQDVDASSLGWAMSAVSSRAFRLYGKK  221



>ref|XP_012072298.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Jatropha curcas]
 gb|KDP38111.1| hypothetical protein JCGZ_04754 [Jatropha curcas]
Length=482

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 175/219 (80%), Gaps = 6/219 (3%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLTH RPLTCAA +   Y +RL   PP+LIKWV+REGGFVH +VKI+       G+
Sbjct  6    MVIASLTHCRPLTCAATATASYPARLVPHPPELIKWVRREGGFVHQAVKISQDGTNSFGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVE------ADSPIPKLAQQVPEELWAMKLGLKLLQ  366
            +AS  IPKGS+LI LP+H+PL+FG ++      A S +  LAQ+VPEELWAMKLGLKLLQ
Sbjct  66   IASQAIPKGSELIVLPDHIPLKFGPLDFEVADGATSALVNLAQKVPEELWAMKLGLKLLQ  125

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER++ GSFWWPYISNLPE YSVPIFFPGEDIKNLQYAPLL+QVNKRCRFLL+FEK V   
Sbjct  126  ERAKIGSFWWPYISNLPETYSVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLDFEKEVRLT  185

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            L N++ + HP+ GQ VD+S+LGWAMSAVSSRAFRL+G K
Sbjct  186  LENLKPNDHPYGGQHVDASSLGWAMSAVSSRAFRLFGKK  224



>ref|XP_011024040.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Populus 
euphratica]
Length=479

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 177/218 (81%), Gaps = 5/218 (2%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAV-SATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLG  201
             + ASLT  RPLTCAA  +A+ Y  RL   PPDLIKWV+REGGFVH ++KI+     GLG
Sbjct  6    FVMASLTTCRPLTCAATATASSYQERLVPHPPDLIKWVRREGGFVHQAIKISQDGTNGLG  65

Query  202  VVASDDIPKGSDLIALPEHLPLQFG----TVEADSPIPKLAQQVPEELWAMKLGLKLLQE  369
            ++AS DIPKGS LI+LP+++PL+FG      EA S + KLAQ+VP+ELWAMKLGLKLLQE
Sbjct  66   LIASHDIPKGSQLISLPDNIPLKFGDEDGVDEAHSVLVKLAQKVPDELWAMKLGLKLLQE  125

Query  370  RSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNEL  549
            R+R  SFWWPYISNLP+ YSVPIFF GEDIKNLQYAPLLYQVN+RCRFLL+FE+ V   +
Sbjct  126  RARVNSFWWPYISNLPQTYSVPIFFQGEDIKNLQYAPLLYQVNRRCRFLLDFEQEVKRAV  185

Query  550  SNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
             N++++ HPF+ QDVD+S+LGW+MSAVSSRAFRLYG K
Sbjct  186  ENLKQNDHPFDRQDVDASSLGWSMSAVSSRAFRLYGKK  223



>ref|XP_012072299.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Jatropha curcas]
Length=477

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 175/219 (80%), Gaps = 6/219 (3%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLTH RPLTCAA +   Y +RL   PP+LIKWV+REGGFVH +VKI+       G+
Sbjct  1    MILASLTHCRPLTCAATATASYPARLVPHPPELIKWVRREGGFVHQAVKISQDGTNSFGL  60

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVE------ADSPIPKLAQQVPEELWAMKLGLKLLQ  366
            +AS  IPKGS+LI LP+H+PL+FG ++      A S +  LAQ+VPEELWAMKLGLKLLQ
Sbjct  61   IASQAIPKGSELIVLPDHIPLKFGPLDFEVADGATSALVNLAQKVPEELWAMKLGLKLLQ  120

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER++ GSFWWPYISNLPE YSVPIFFPGEDIKNLQYAPLL+QVNKRCRFLL+FEK V   
Sbjct  121  ERAKIGSFWWPYISNLPETYSVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLDFEKEVRLT  180

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            L N++ + HP+ GQ VD+S+LGWAMSAVSSRAFRL+G K
Sbjct  181  LENLKPNDHPYGGQHVDASSLGWAMSAVSSRAFRLFGKK  219



>gb|KDO60745.1| hypothetical protein CISIN_1g0129691mg, partial [Citrus sinensis]
Length=237

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 177/219 (81%), Gaps = 10/219 (5%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKI---AISEPYG  195
            ++ +SL H+RP+TCAA     Y +RL   PPDL+KW+K+EGGFVH +VKI     +E YG
Sbjct  6    IVLSSLIHIRPITCAAS----YHTRLVPHPPDLVKWIKKEGGFVHQAVKIFPQEDNETYG  61

Query  196  LGVVASDDIPKGSDLIALPEHLPLQFGTVE---ADSPIPKLAQQVPEELWAMKLGLKLLQ  366
            LG+VAS DIPKGS LIALP+H+PL+F +     ADS +  LA QVPEELWAMKLGLKLLQ
Sbjct  62   LGLVASQDIPKGSLLIALPDHIPLKFESDAGDGADSVLVDLASQVPEELWAMKLGLKLLQ  121

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER+R GSFWWPYISNLPE YSVPIFF GEDIKNLQY PLLYQVNKRCRFLL+F++ V   
Sbjct  122  ERARLGSFWWPYISNLPETYSVPIFFQGEDIKNLQYVPLLYQVNKRCRFLLDFDQEVRRA  181

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            L+NV+ + HPF GQ++++S+LGWAMSAVSSRAFRL+G K
Sbjct  182  LANVKPNDHPFGGQELNASSLGWAMSAVSSRAFRLHGKK  220



>ref|XP_006469244.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Citrus 
sinensis]
Length=474

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 178/219 (81%), Gaps = 10/219 (5%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKI---AISEPYG  195
            ++ +SL H+RP+TCAA     Y +RL   PPDL+KWVK+EGGFVH +VKI     +E YG
Sbjct  6    IVLSSLIHIRPITCAAS----YHTRLVPHPPDLVKWVKKEGGFVHQAVKIFPQEDNETYG  61

Query  196  LGVVASDDIPKGSDLIALPEHLPLQFGTVE---ADSPIPKLAQQVPEELWAMKLGLKLLQ  366
            LG+VAS DIPKGS LIALP+H+PL+F +     ADS +  LA QVPEELWAMKLGLKLLQ
Sbjct  62   LGLVASQDIPKGSLLIALPDHIPLKFESDAGDGADSVLVDLASQVPEELWAMKLGLKLLQ  121

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER+R GSFWWPYISNLPE YSVPIFF GEDIKNLQYAPLLYQVNKRCRFLL+F++ V   
Sbjct  122  ERARLGSFWWPYISNLPETYSVPIFFQGEDIKNLQYAPLLYQVNKRCRFLLDFDQEVRRA  181

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            L+NV+ + HPF GQ++++S+LGWAMSAVSSRAFRL+G K
Sbjct  182  LANVKPNDHPFGGQELNASSLGWAMSAVSSRAFRLHGKK  220



>ref|XP_003530864.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine 
max]
Length=472

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 178/221 (81%), Gaps = 7/221 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-IS  183
            M T  T+M  SL+ LRPLTCA+ SA    SRL  QPPDLIKWV REGGFVH +VKI  + 
Sbjct  1    MATGKTVMC-SLSQLRPLTCASTSA----SRLVPQPPDLIKWVTREGGFVHRAVKITQLD  55

Query  184  EPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEAD-SPIPKLAQQVPEELWAMKLGLKL  360
               GLG+VA ++IP+GSDLI LP HLPL+F +++ D S +  LA+QVPEELWAMKLGLKL
Sbjct  56   SSNGLGLVAKEEIPRGSDLIVLPHHLPLRFTSLQQDPSLLHHLARQVPEELWAMKLGLKL  115

Query  361  LQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVV  540
            LQER++ GSFWWPYISNLPE Y+VPIFF GEDIKNL YAP+L+QVNKRCRFLL+FE+ V 
Sbjct  116  LQERAKVGSFWWPYISNLPETYTVPIFFSGEDIKNLHYAPILHQVNKRCRFLLDFEREVK  175

Query  541  NELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
              L ++ +D HPF GQ+VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  176  RTLVSLTQDKHPFGGQEVDASSLGWAMSAVSSRAFRLYGEK  216



>ref|XP_006448171.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61411.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=373

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKI---AISEPYG  195
            ++ +SL H+RP+TCAA     Y +RL   PPDL+KWVK+EGGFVH +VK+     +E YG
Sbjct  6    IVLSSLIHIRPITCAAS----YHTRLVPHPPDLVKWVKKEGGFVHQAVKLFPQEDNETYG  61

Query  196  LGVVASDDIPKGSDLIALPEHLPLQFGTVE---ADSPIPKLAQQVPEELWAMKLGLKLLQ  366
            LG+VAS DIPKGS LIALP+H+PL+F +     ADS +  LA QVPEELWAMKLGLKLLQ
Sbjct  62   LGLVASQDIPKGSLLIALPDHIPLKFESDAGDGADSVLVDLASQVPEELWAMKLGLKLLQ  121

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER+R GSFWWPYISNLPE YSVPIFF GEDIKNLQYAPLLYQVNKRCRFLL+F++ V + 
Sbjct  122  ERARLGSFWWPYISNLPETYSVPIFFQGEDIKNLQYAPLLYQVNKRCRFLLDFDQEVRHA  181

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            L++V+ + HPF GQ++++S+LGWAMSAVSSRAFRL+G K
Sbjct  182  LASVKPNDHPFGGQELNASSLGWAMSAVSSRAFRLHGKK  220



>gb|KHN16537.1| Histone-lysine N-methyltransferase setd3 [Glycine soja]
Length=470

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 177/221 (80%), Gaps = 7/221 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-IS  183
            M T  T+M  SL+ LRPLTCA+ SA    SRL  QPPDLIKWV REGGFVH +VKI  + 
Sbjct  1    MATGKTVMC-SLSQLRPLTCASTSA----SRLVPQPPDLIKWVTREGGFVHRAVKITQLD  55

Query  184  EPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEAD-SPIPKLAQQVPEELWAMKLGLKL  360
               GLG+VA ++IP+GSDLI LP HLPL+F +++ D S +  LA+QVPEELWAMKLGLKL
Sbjct  56   SSNGLGLVAKEEIPRGSDLIVLPHHLPLRFTSLQQDPSLLHHLARQVPEELWAMKLGLKL  115

Query  361  LQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVV  540
            LQER++ GSFWWPYISNLPE Y+VPIFF GEDIKNL YAP+L+QVNKRCRFLL+FE+ V 
Sbjct  116  LQERAKVGSFWWPYISNLPETYTVPIFFSGEDIKNLHYAPILHQVNKRCRFLLDFEREVK  175

Query  541  NELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
              L ++  D HPF GQ+VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  176  RALVSLTPDKHPFGGQEVDASSLGWAMSAVSSRAFRLYGEK  216



>ref|XP_006448170.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61410.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=474

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKI---AISEPYG  195
            ++ +SL H+RP+TCAA     Y +RL   PPDL+KWVK+EGGFVH +VK+     +E YG
Sbjct  6    IVLSSLIHIRPITCAAS----YHTRLVPHPPDLVKWVKKEGGFVHQAVKLFPQEDNETYG  61

Query  196  LGVVASDDIPKGSDLIALPEHLPLQFGTVE---ADSPIPKLAQQVPEELWAMKLGLKLLQ  366
            LG+VAS DIPKGS LIALP+H+PL+F +     ADS +  LA QVPEELWAMKLGLKLLQ
Sbjct  62   LGLVASQDIPKGSLLIALPDHIPLKFESDAGDGADSVLVDLASQVPEELWAMKLGLKLLQ  121

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNE  546
            ER+R GSFWWPYISNLPE YSVPIFF GEDIKNLQYAPLLYQVNKRCRFLL+F++ V + 
Sbjct  122  ERARLGSFWWPYISNLPETYSVPIFFQGEDIKNLQYAPLLYQVNKRCRFLLDFDQEVRHA  181

Query  547  LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            L++V+ + HPF GQ++++S+LGWAMSAVSSRAFRL+G K
Sbjct  182  LASVKPNDHPFGGQELNASSLGWAMSAVSSRAFRLHGKK  220



>ref|XP_002312458.2| hypothetical protein POPTR_0008s13380g [Populus trichocarpa]
 gb|EEE89825.2| hypothetical protein POPTR_0008s13380g [Populus trichocarpa]
Length=479

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAV-SATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLG  201
             + ASLT+ RPLTCAA  +A+ Y  RL   PPDLIKWV+REGGFVH ++KI+     G G
Sbjct  6    FVMASLTNCRPLTCAATFTASSYQERLVPNPPDLIKWVRREGGFVHQAIKISQDGTNGPG  65

Query  202  VVASDDIPKGSDLIALPEHLPLQFG----TVEADSPIPKLAQQVPEELWAMKLGLKLLQE  369
            ++AS DIPKGS LI LP+++PL+FG      EA S + KLA +VP+ELWAMKLGLKLLQE
Sbjct  66   LIASHDIPKGSQLIVLPDNIPLKFGDEDGVDEAHSVLVKLAHKVPDELWAMKLGLKLLQE  125

Query  370  RSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNEL  549
            R+R  SFWWPYISNLP  YSVPIFF GEDIKNLQYAPLLYQVN+RCRFLL+FE+ V   +
Sbjct  126  RARVNSFWWPYISNLPRTYSVPIFFQGEDIKNLQYAPLLYQVNRRCRFLLDFEQEVKRAV  185

Query  550  SNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
             N++++ HPF+ QDVD+S+LGW+MSAVSSRAFRLYG K
Sbjct  186  ENLKQNDHPFDRQDVDASSLGWSMSAVSSRAFRLYGKK  223



>ref|XP_010107630.1| Histone-lysine N-methyltransferase setd3 [Morus notabilis]
 gb|EXC16432.1| Histone-lysine N-methyltransferase setd3 [Morus notabilis]
Length=469

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 172/218 (79%), Gaps = 8/218 (4%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAV-SATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAIS  183
            M     +MA+SLTH R LTCAA  S+  Y +RL  QPPDLIKWV+R+GGFVH S+KIA  
Sbjct  1    MAASKMVMASSLTHFRRLTCAATDSSASYPARLVPQPPDLIKWVRRQGGFVHHSLKIAQD  60

Query  184  EPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLL  363
               GLG++ASD+IPKGSDLIALP H+PL+F  +E+D           EELWAMKLGL+ L
Sbjct  61   STNGLGLLASDEIPKGSDLIALPHHIPLRFSPLESDGIWT-------EELWAMKLGLRFL  113

Query  364  QERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVN  543
            QER++ GSFWWPYISNLPE YSVPIFF GEDIKNLQYAPLLYQVNKRCRFLL+FE+ V  
Sbjct  114  QERAKVGSFWWPYISNLPEAYSVPIFFAGEDIKNLQYAPLLYQVNKRCRFLLDFEQEVRR  173

Query  544  ELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
             L +++ + HPF G+DVD+S+LGWAMSAVSSRAFR++G
Sbjct  174  ALEDLKANDHPFNGEDVDASSLGWAMSAVSSRAFRVHG  211



>ref|XP_004297442.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Fragaria vesca subsp. vesca]
Length=482

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 175/221 (79%), Gaps = 8/221 (4%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATL--YSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGL  198
            ++ ASLT +RP +CAA ++    Y  RLA   PDLIKWV+REGGFVH +VKIA    +GL
Sbjct  6    MVMASLTAIRPFSCAAAASASASYPGRLAPHTPDLIKWVRREGGFVHEAVKIAQDTSFGL  65

Query  199  GVVASDDIPKGSDLIALPEHLPLQFGTVE------ADSPIPKLAQQVPEELWAMKLGLKL  360
            G+VA+D+IPKGS+L+ LPEH+PL+F  +E      AD+ +  LA+QVP+ELWAMKLGLKL
Sbjct  66   GLVATDEIPKGSELVVLPEHVPLRFVPLESDSGDGADAVLANLARQVPDELWAMKLGLKL  125

Query  361  LQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVV  540
            LQER+R GSFWWPYI NLPE +SVPIFFPGEDIKNLQYAP+LYQVNKRCRFLLEFE+ V 
Sbjct  126  LQERARVGSFWWPYIGNLPEAFSVPIFFPGEDIKNLQYAPVLYQVNKRCRFLLEFEQEVR  185

Query  541  NELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
              L N +   HPF GQ V +SALGWAMSAVSSRAFRLYG K
Sbjct  186  RALDNNKPSDHPFGGQAVGASALGWAMSAVSSRAFRLYGKK  226



>ref|XP_007160424.1| hypothetical protein PHAVU_002G320700g [Phaseolus vulgaris]
 gb|ESW32418.1| hypothetical protein PHAVU_002G320700g [Phaseolus vulgaris]
Length=465

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 173/211 (82%), Gaps = 4/211 (2%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-ISEPYGLGVVA  210
             SLTHLRPL+CAA +A    SRL   PPDL+KWV REGGFVH +++IA +    GLG+VA
Sbjct  2    CSLTHLRPLSCAASAAA---SRLVPYPPDLVKWVTREGGFVHRALEIAQLGSSNGLGIVA  58

Query  211  SDDIPKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSF  390
             + IP+G+DLI LP HLPL+F T+E D  +  LA+Q+PEELWAMKLGLKLLQER++ GSF
Sbjct  59   KEQIPRGTDLIVLPHHLPLRFTTLEHDPLLHHLARQIPEELWAMKLGLKLLQERAKVGSF  118

Query  391  WWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDH  570
            WWPYISNLPE Y+VPIFFPGEDIKNL YAPLL+QVNKRCRFLL+FE+ V   L +V+ D 
Sbjct  119  WWPYISNLPETYTVPIFFPGEDIKNLHYAPLLHQVNKRCRFLLDFEQEVKRALVSVKPDS  178

Query  571  HPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            HPF GQ+VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  179  HPFGGQEVDASSLGWAMSAVSSRAFRLYGEK  209



>ref|XP_002525993.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36417.1| conserved hypothetical protein [Ricinus communis]
Length=473

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 176/225 (78%), Gaps = 12/225 (5%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            MP    +MA SL H RPLTCAA       +RL + PPDLIKWV+ EGGFVH +VKI+   
Sbjct  1    MPASKMVMA-SLIHRRPLTCAA-----SITRLVSHPPDLIKWVRHEGGFVHQAVKISQDG  54

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVE---ADSP---IPKLAQQVPEELWAMKL  348
              G G++ S+ IPKGS+LI LP+H+PL+FG ++   AD P   +  LAQ+VP+ELWAMKL
Sbjct  55   RNGFGLIVSEAIPKGSELIVLPDHIPLKFGPLDLEGADGPPSVLVHLAQKVPDELWAMKL  114

Query  349  GLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE  528
            GLKLLQER++ GSFWWPYISNLPE YS+PIFFPGEDIKNLQYAPLL+QVNKRCRFLL+FE
Sbjct  115  GLKLLQERAKVGSFWWPYISNLPEAYSIPIFFPGEDIKNLQYAPLLHQVNKRCRFLLDFE  174

Query  529  KFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            K V + L N++   HP+ GQ VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  175  KEVEHTLKNLKPSDHPYGGQHVDASSLGWAMSAVSSRAFRLYGNK  219



>gb|KHG01953.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=505

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 173/245 (71%), Gaps = 32/245 (13%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            L+  +L+H RPLTCAA  +    +RL   PPDL+KW+KREGGFVH +V I     YGLG+
Sbjct  6    LLIPTLSHFRPLTCAAAVSATNPARLVPHPPDLLKWIKREGGFVHEAVTITQDTTYGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTV---EADSPIPKLAQQVP-----------------  324
            VAS  IPKGSDLI LPEH+PL+F +    EADS +  L+ +VP                 
Sbjct  66   VASGGIPKGSDLIVLPEHVPLKFQSDKDDEADSVLLPLSNRVPALSLFRNLMLFPRKQIS  125

Query  325  ------------EELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNL  468
                        EELWAMKLGLKLLQER++ GSFWWPYISNLPE Y+VPIFF GEDIKNL
Sbjct  126  TVLNWTIWEHLTEELWAMKLGLKLLQERAKVGSFWWPYISNLPETYTVPIFFSGEDIKNL  185

Query  469  QYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFR  648
            QYAPLLYQVNKRCRFLLEFE+ V N L N++   HPF GQDVD+S+LGWAMSAVSSRAFR
Sbjct  186  QYAPLLYQVNKRCRFLLEFEQEVKNVLKNLKPSEHPFGGQDVDASSLGWAMSAVSSRAFR  245

Query  649  LYGGK  663
            LYG K
Sbjct  246  LYGKK  250



>ref|XP_010043959.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Eucalyptus 
grandis]
 gb|KCW85967.1| hypothetical protein EUGRSUZ_B02671 [Eucalyptus grandis]
Length=477

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYS--SRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            ASL H RPLTCAA ++   S  +RL    PDLIKWV+REGGFVH +V+IA  E  GLG+ 
Sbjct  9    ASLIHYRPLTCAASASASASQPARLVPHAPDLIKWVRREGGFVHEAVRIAQDELSGLGLA  68

Query  208  ASDDIPKGSDLIALPEHLPLQFGTVE-ADSPIPKLAQQVPEELWAMKLGLKLLQERSRKG  384
            A+D IPKGSDLIALP H+PL+F     A+S +  LA +VPEELWAMKLGLKLL ER++ G
Sbjct  69   AADKIPKGSDLIALPHHVPLRFQPDGWAESVLADLASKVPEELWAMKLGLKLLGERAKIG  128

Query  385  SFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVER  564
            SFWWPYISNLPE Y VPIFFPGEDIKNLQYAPLLYQVNKRCRFLL+FEK V N +S+   
Sbjct  129  SFWWPYISNLPETYGVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLDFEKEVKNAISDFNM  188

Query  565  DHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
              HPF GQD+++S+LGWAMSAVSSRAFRLYG K L
Sbjct  189  MDHPFGGQDINASSLGWAMSAVSSRAFRLYGKKSL  223



>ref|XP_002281246.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Vitis vinifera]
 emb|CBI26837.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 175/218 (80%), Gaps = 10/218 (5%)
 Frame = +1

Query  40   LTHLRPLTCAAVSATL---YSSRLATQPPDLIKWVKREGGFVHPSVKIAIS-EPYGLGVV  207
            LT  RPLTCAA +AT    +  RL   PPDLIKWV+REGGFVH +V IA S +  GLG+V
Sbjct  10   LTQFRPLTCAAATATATACHPGRLVPHPPDLIKWVRREGGFVHQAVTIAPSADSCGLGLV  69

Query  208  ASDDIPKGSDLIALPEHLPLQFGTVEA------DSPIPKLAQQVPEELWAMKLGLKLLQE  369
            AS DIPKGSDLIALP H+PL+F ++E+      DS +  LA+QVPEELWAM+LGLKLLQE
Sbjct  70   ASQDIPKGSDLIALPHHIPLRFSSLESEGVDTIDSVLVNLARQVPEELWAMRLGLKLLQE  129

Query  370  RSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNEL  549
            R+  GSFWW YISNLPE YSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLL+FEK V   L
Sbjct  130  RASIGSFWWAYISNLPETYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLDFEKEVKRVL  189

Query  550  SNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
             N++ D HPF GQDVD+S+LGWAMSAVSSRAFRL+G K
Sbjct  190  KNLKPDDHPFRGQDVDASSLGWAMSAVSSRAFRLHGKK  227



>ref|XP_010681928.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Beta vulgaris 
subsp. vulgaris]
Length=491

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 167/215 (78%), Gaps = 8/215 (4%)
 Frame = +1

Query  37   SLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASD  216
            S  H RPLTC+A+S   Y SRL   PPDL+KWV++EGGFVH S+  A    YGLG+VAS 
Sbjct  26   SRAHFRPLTCSAIS---YPSRLVLYPPDLLKWVRKEGGFVHDSINFAHIPSYGLGLVASH  82

Query  217  DIPKGSDLIALPEHLPLQF-----GTVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRK  381
            DIP+G DLIALP HLPL+F     G+V +   +  LA +VPEELWAM+LGLKLLQER++ 
Sbjct  83   DIPQGCDLIALPPHLPLKFDELADGSVSSSPILTDLANRVPEELWAMRLGLKLLQERAKT  142

Query  382  GSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVE  561
            GSFWWPYISNLPE YSVPIFF G+DIKNLQYAP++ QVNKRCRFLLEFEK V   +SN++
Sbjct  143  GSFWWPYISNLPETYSVPIFFGGQDIKNLQYAPIVNQVNKRCRFLLEFEKQVKRAVSNIK  202

Query  562  RDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
               HPF GQD+D+++LGWAMSA SSRAFRL G K 
Sbjct  203  PGDHPFRGQDIDAASLGWAMSAASSRAFRLRGDKH  237



>ref|XP_006415823.1| hypothetical protein EUTSA_v10007532mg [Eutrema salsugineum]
 gb|ESQ34176.1| hypothetical protein EUTSA_v10007532mg [Eutrema salsugineum]
Length=474

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 174/223 (78%), Gaps = 5/223 (2%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T  T MA+    +RP TC A S     SRLA  P DL++W+KREGGFVH +VK++   
Sbjct  1    MATSKTAMASLAAQIRPFTCLAAS---QPSRLAPHPADLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--DSPIPKLAQQVPEELWAMKLGLKL  360
            P+G+G+++++ I +G+DLIALP H+PL+F + +A   S +  LA++VPEELWAMKLGL+L
Sbjct  58   PFGIGLISTEKIREGTDLIALPPHVPLRFESDDAPSSSLLAALARRVPEELWAMKLGLRL  117

Query  361  LQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVV  540
            LQER+   SFWWPYISNLPE YSVPIFFPGEDIKNLQYAPLL+QVNKRCRFLLEFE+ + 
Sbjct  118  LQERANADSFWWPYISNLPETYSVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLEFEQEIR  177

Query  541  NELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
              L +V+   HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  178  RILEDVKASDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  220



>ref|XP_009420293.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 176/225 (78%), Gaps = 8/225 (4%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T ++  AASL H R LTC A ++   +SRL   P DLI+WV+REGGFVHP+++IA  +
Sbjct  9    MLTAVSTSAASLAHRRSLTCRATASAGTASRLVPHPSDLIRWVRREGGFVHPNLRIADGD  68

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFG-TVEAD-------SPIPKLAQQVPEELWAM  342
            PYGLGVVA+++IP GS+LIALP HL L+F  + E+D       S + +LA++VP+ELWAM
Sbjct  69   PYGLGVVATNEIPPGSELIALPSHLLLRFDRSPESDGASDGPHSTLVELARRVPDELWAM  128

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            +LGLKLLQER+   S WWPYISNLPE + +PIFF G+DIKNL YAPL++QVNKRCRFLLE
Sbjct  129  RLGLKLLQERATARSIWWPYISNLPETFCIPIFFSGDDIKNLHYAPLIHQVNKRCRFLLE  188

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
            FEK + N L NV   +HPF GQDV+SS+LGWAMSAVSSRAF+LYG
Sbjct  189  FEKEIKNILDNVSLRNHPFGGQDVNSSSLGWAMSAVSSRAFQLYG  233



>ref|XP_010556222.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Tarenaya 
hassleriana]
Length=477

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 174/224 (78%), Gaps = 9/224 (4%)
 Frame = +1

Query  13   TKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPY  192
            +KM L + +L H+RPLTC A S     SRLA  PPDLI WVKREGGFVH S+K++     
Sbjct  4    SKMALASLAL-HIRPLTCMAASQP---SRLAPHPPDLILWVKREGGFVHHSLKLSDDGSS  59

Query  193  GLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSP-----IPKLAQQVPEELWAMKLGLK  357
            GLG+V+S+ IP+GSDLI+LP H+PL+F +   D       +  LA+++P+ELWAMKLG++
Sbjct  60   GLGLVSSEKIPQGSDLISLPPHVPLRFESESDDDAASFAVLADLARRIPDELWAMKLGMR  119

Query  358  LLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFV  537
            LLQER++  SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLLYQVN+RCRFLLEFE+ +
Sbjct  120  LLQERAKIDSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLYQVNRRCRFLLEFEQEI  179

Query  538  VNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
               L  ++   HPF GQDVD+S+LGWAMSAVSSRAFRL+G K L
Sbjct  180  RRTLEGIKPSDHPFRGQDVDASSLGWAMSAVSSRAFRLHGKKLL  223



>emb|CDY27575.1| BnaA09g28320D [Brassica napus]
Length=475

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 178/224 (79%), Gaps = 6/224 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    + +   H+RP TC+A S     SRLA  PPDL++W+KREGGFVH +VK++   
Sbjct  1    MATSKLAITSLAAHIRPFTCSAAS---QPSRLAPHPPDLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVE-ADSPI-PKLAQQVPEELWAMKLGLKL  360
            P+G+G+++++ IP+G+DLI+LP H+PL+F + E A SP+   LA++VPEELWAMKLGL+L
Sbjct  58   PFGIGLISTEQIPQGTDLISLPPHVPLRFESDETAPSPLLAALARRVPEELWAMKLGLRL  117

Query  361  LQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLY-QVNKRCRFLLEFEKFV  537
            LQER+   SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLL+ QVNKRCRFLL+FE+ +
Sbjct  118  LQERASADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLHQQVNKRCRFLLDFEREI  177

Query  538  VNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
             + L +V+   HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  178  RHTLEDVKATDHPFSGQDVNASALGWTMSAVSTRAFRLHGDKKL  221



>ref|XP_009113827.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Brassica rapa]
Length=474

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 176/223 (79%), Gaps = 5/223 (2%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    + +   H+RP TC+A S     SRLA  PPDL++W+KREGGFVH +VK++   
Sbjct  1    MATSKLAITSLAAHIRPFTCSAAS---QPSRLAPHPPDLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVE-ADSPI-PKLAQQVPEELWAMKLGLKL  360
            P+G+G+++++ IP+G+DLI+LP H+PL+F + E A SP+   LA++VPEELWAMKLGL+L
Sbjct  58   PFGIGLISTEQIPQGTDLISLPPHVPLRFESDETAPSPLLAALARRVPEELWAMKLGLRL  117

Query  361  LQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVV  540
            LQER+   SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLL+QVNKRCRFLL+FE+ + 
Sbjct  118  LQERANADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLDFEREIR  177

Query  541  NELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
              L +V+   HPF GQDV++SALGW MSAVS+ AFRL+G +++
Sbjct  178  QTLEDVKASDHPFSGQDVNASALGWTMSAVSTIAFRLHGNRKV  220



>ref|XP_010906939.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Elaeis guineensis]
Length=492

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 174/221 (79%), Gaps = 8/221 (4%)
 Frame = +1

Query  19   MTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGL  198
            +T   +SLTH RPLTC+A +  + ++R+   PPDL++WV+REGG VHP +KIA    +GL
Sbjct  17   VTSSTSSLTHRRPLTCSAPATAVAAARIVPHPPDLVRWVRREGGLVHPKLKIADHPSHGL  76

Query  199  GVVASDDIPKGSDLIALPEHLPLQF--------GTVEADSPIPKLAQQVPEELWAMKLGL  354
            GVVA+++IP+GS+L+ LP HLPL+F        G   ADS + +LA++VPEELWAM+LGL
Sbjct  77   GVVATEEIPQGSELVVLPSHLPLRFRRDPESDGGGEGADSVLNQLARRVPEELWAMRLGL  136

Query  355  KLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKF  534
            +LLQER+  GSFWWPYISNLPE +SVPIFF  EDIKNLQYAPLL+QVNKRCRFLLEFEK 
Sbjct  137  RLLQERATVGSFWWPYISNLPEAFSVPIFFSREDIKNLQYAPLLHQVNKRCRFLLEFEKE  196

Query  535  VVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
            +   L +V    HPF GQDV++S+LGWAMSAVSSRAFRL+G
Sbjct  197  IKIMLEDVALQDHPFGGQDVNASSLGWAMSAVSSRAFRLHG  237



>ref|XP_007045258.1| Rubisco methyltransferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY01090.1| Rubisco methyltransferase family protein isoform 2 [Theobroma 
cacao]
Length=609

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 175/267 (66%), Gaps = 56/267 (21%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++  SLT  RPLTCAA  A  Y +RL   PPDL+KWVKREGGFVH +VKIA     GLG+
Sbjct  91   MLIPSLTKFRPLTCAA--AAFYPTRLVPHPPDLVKWVKREGGFVHEAVKIAQDTTLGLGL  148

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVE---ADSPIPKLAQQVP-----------------  324
            VAS +IPKGSDLI LP+H+PL+F + E   ADS +  L+ QVP                 
Sbjct  149  VASGEIPKGSDLIVLPDHVPLKFQSDEQNGADSVLLHLSHQVPDLNLSDSGVALWVFLNW  208

Query  325  ----------------------------------EELWAMKLGLKLLQERSRKGSFWWPY  402
                                              EELWAMKLGLKLLQER++ GSFWWPY
Sbjct  209  VTDHSKSLSLYERAQLLCLSSNRVLNWTLWEHVTEELWAMKLGLKLLQERAKVGSFWWPY  268

Query  403  ISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFE  582
            ISNLPE YSVPIFF GEDIKNLQYAPLLYQVNKRCRFLLEFE+ V N L +++   HPF 
Sbjct  269  ISNLPETYSVPIFFTGEDIKNLQYAPLLYQVNKRCRFLLEFEQEVKNALKDLKLSEHPFG  328

Query  583  GQDVDSSALGWAMSAVSSRAFRLYGGK  663
            GQDVD+S+LGWAMSAVSSRAFRLYG K
Sbjct  329  GQDVDASSLGWAMSAVSSRAFRLYGKK  355



>ref|XP_009113825.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Brassica rapa]
 ref|XP_009113826.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Brassica rapa]
Length=474

 Score =   284 bits (727),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 174/223 (78%), Gaps = 5/223 (2%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    + +   H+RP TC+A S     SRLA  PPDL++W+KREGGFVH +VK++   
Sbjct  1    MATSKLAITSLAAHIRPFTCSAAS---QPSRLAPHPPDLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVE-ADSPI-PKLAQQVPEELWAMKLGLKL  360
            P+G+G+++++ IP+G+DLI+LP H+PL+F + E A SP+   LA++VPEELWAMKLGL+L
Sbjct  58   PFGIGLISTEQIPQGTDLISLPPHVPLRFESDETAPSPLLAALARRVPEELWAMKLGLRL  117

Query  361  LQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVV  540
            LQER+   SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLL+QVNKRCRFLL+FE+ + 
Sbjct  118  LQERANADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLDFEREIR  177

Query  541  NELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
              L +V+   HPF GQDV +SAL   MSAVS+RAFRL+G K+L
Sbjct  178  RTLEDVKATDHPFSGQDVKASALVSTMSAVSTRAFRLHGDKKL  220



>ref|XP_004503402.1| PREDICTED: histone-lysine N-methyltransferase setd3-like, partial 
[Cicer arietinum]
Length=490

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 170/218 (78%), Gaps = 10/218 (5%)
 Frame = +1

Query  16   KMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-ISEPY  192
            K  ++ +SL+H+RPLT A       SSRL  QP DLIKWV REGGFVH +VKI+      
Sbjct  27   KAAMLMSSLSHVRPLTYA-------SSRLVPQPHDLIKWVTREGGFVHRAVKISQFDSSN  79

Query  193  GLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQER  372
            GLG++ +++IP G+DLI LP+H+PL F   ++DS + + A  VP+ELWAMKLGLKLL ER
Sbjct  80   GLGLIVNEEIPIGTDLIVLPQHIPLHF--TDSDSLLLQFANHVPDELWAMKLGLKLLHER  137

Query  373  SRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELS  552
            ++ GSFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLL+QVNKRCRFLL+FE+ V   L 
Sbjct  138  AKLGSFWWPYISNLPESYTVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLDFEQQVKRALV  197

Query  553  NVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
             +  D HPF GQ+VD+S+LGWAMSAVSSRAFRL+G K+
Sbjct  198  GLAPDKHPFGGQEVDASSLGWAMSAVSSRAFRLHGNKQ  235



>gb|KFK44512.1| hypothetical protein AALP_AA1G266300 [Arabis alpina]
Length=475

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 175/226 (77%), Gaps = 11/226 (5%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    MA+  +H+RP +C      L +SRLA  PPDLI+W+KREGGFVH SVK++   
Sbjct  1    MATSKMAMASLSSHIRPFSC------LAASRLAPHPPDLIRWIKREGGFVHHSVKLSHHT  54

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF----GTVEADSPIPKLAQQVPEELWAMKLGL  354
            P GL ++++D IP G++LI+LP HLPL+F     T  + S +  LA++VPEELWAMKLGL
Sbjct  55   PLGLTLISTDLIPHGTNLISLPPHLPLRFQSHNDTSSSSSLLSALARRVPEELWAMKLGL  114

Query  355  KLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKF  534
            +LLQER+   SFWWPYISNLPE YSVPIFFPGEDIKNLQYAPLL+QVNKRCRFLLEFE+ 
Sbjct  115  RLLQERANVDSFWWPYISNLPETYSVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLEFEQE  174

Query  535  VVNELSNVE-RDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            +   L NV+  D+HPF GQDV++SALGW MSAVS+RAFRL+G K++
Sbjct  175  IRRVLENVKASDNHPFSGQDVNASALGWTMSAVSTRAFRLHGDKKI  220



>ref|XP_003630935.1| SET domain-containing protein [Medicago truncatula]
 gb|AET05411.1| histone-lysine N-methyltransferase setd3-like protein [Medicago 
truncatula]
Length=482

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 181/224 (81%), Gaps = 5/224 (2%)
 Frame = +1

Query  1    GSMPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-  177
            GS  T M LM++SL+H+RPLTC++ +++  SSR+A  P DLIKWV REGGFVH +VKIA 
Sbjct  7    GSWKTAM-LMSSSLSHVRPLTCSSSTSS--SSRIAPHPHDLIKWVTREGGFVHRAVKIAQ  63

Query  178  ISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVE-ADSPIPKLAQQVPEELWAMKLGL  354
            +    GLG+VA +DIP G+DLIALP+H+PL F   + + S + +L   VP+ELW+MKLGL
Sbjct  64   LDSSNGLGLVAKEDIPIGTDLIALPQHIPLHFNHDDNSHSLLLQLTSHVPDELWSMKLGL  123

Query  355  KLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKF  534
            KLL ER++ GSFWWPYISNLP+ Y++PIFFPGEDIKNLQYAP+L+QVNKRCRFLL+FE+ 
Sbjct  124  KLLLERAKLGSFWWPYISNLPQTYTLPIFFPGEDIKNLQYAPILHQVNKRCRFLLDFEQK  183

Query  535  VVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
            V + L  +  D HPF GQ+VD+S+LGWAMSAVSSRAF+L+G K+
Sbjct  184  VKHALVGLTPDKHPFGGQEVDASSLGWAMSAVSSRAFKLHGNKQ  227



>ref|XP_008467098.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Cucumis melo]
Length=481

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 174/224 (78%), Gaps = 10/224 (4%)
 Frame = +1

Query  13   TKMTLMAASLTHLRPLTCAAVSATL--YSSRLATQPPDLIKWVKREGGFVHPSVKIAIS-  183
            +K+ +   SLTH RP + A++ +    +SSRL   PPDLIKWV+REGGFVH ++ IA S 
Sbjct  4    SKIAVATLSLTHFRPFSSASMPSLSPSFSSRLVPHPPDLIKWVRREGGFVHHALNIAPSP  63

Query  184  -EPYGLGVVASDDIPKGSDLIALPEHLPLQF------GTVEADSPIPKLAQQVPEELWAM  342
                GLG++ASD IPKGS+LI LP +LPL+F       + EADS +  LA+QVPEELW+M
Sbjct  64   DAHTGLGLLASDHIPKGSELIILPHNLPLRFESPEAGDSDEADSVLINLARQVPEELWSM  123

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            KLGLKLL+ER++ GSFWW YI NLPE ++VPIFF G+DIKNLQYAPLLYQVNKRCRFLL+
Sbjct  124  KLGLKLLKERAKVGSFWWAYIGNLPEVFTVPIFFSGDDIKNLQYAPLLYQVNKRCRFLLD  183

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLY  654
            FEK V   L +++ ++HPF GQ VD+S+LGWAM+AVSSRAFRLY
Sbjct  184  FEKEVKRTLDSIKPENHPFGGQTVDASSLGWAMAAVSSRAFRLY  227



>ref|XP_008467097.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Cucumis melo]
Length=483

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 174/224 (78%), Gaps = 10/224 (4%)
 Frame = +1

Query  13   TKMTLMAASLTHLRPLTCAAVSATL--YSSRLATQPPDLIKWVKREGGFVHPSVKIAIS-  183
            +K+ +   SLTH RP + A++ +    +SSRL   PPDLIKWV+REGGFVH ++ IA S 
Sbjct  4    SKIAVATLSLTHFRPFSSASMPSLSPSFSSRLVPHPPDLIKWVRREGGFVHHALNIAPSP  63

Query  184  -EPYGLGVVASDDIPKGSDLIALPEHLPLQF------GTVEADSPIPKLAQQVPEELWAM  342
                GLG++ASD IPKGS+LI LP +LPL+F       + EADS +  LA+QVPEELW+M
Sbjct  64   DAHTGLGLLASDHIPKGSELIILPHNLPLRFESPEAGDSDEADSVLINLARQVPEELWSM  123

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            KLGLKLL+ER++ GSFWW YI NLPE ++VPIFF G+DIKNLQYAPLLYQVNKRCRFLL+
Sbjct  124  KLGLKLLKERAKVGSFWWAYIGNLPEVFTVPIFFSGDDIKNLQYAPLLYQVNKRCRFLLD  183

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLY  654
            FEK V   L +++ ++HPF GQ VD+S+LGWAM+AVSSRAFRLY
Sbjct  184  FEKEVKRTLDSIKPENHPFGGQTVDASSLGWAMAAVSSRAFRLY  227



>gb|EPS70598.1| hypothetical protein M569_04159, partial [Genlisea aurea]
Length=458

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 167/221 (76%), Gaps = 14/221 (6%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEP------  189
            M + L H RPL C      L ++RL   PPDL+KW++REGGF+H SV+++  E       
Sbjct  3    MPSLLNHSRPLAC------LSTARLVPSPPDLVKWIRREGGFLHDSVRVSPLEDEKQVVG  56

Query  190  YGLGVVASDDIPKGSDLIALPEHLPLQF--GTVEADSPIPKLAQQVPEELWAMKLGLKLL  363
             GLG+VA DDI KG++LIALP H+PL+F  G  + DS +  LA+ +PEELW MKLGLKLL
Sbjct  57   LGLGLVALDDIAKGTELIALPPHIPLRFECGARDDDSLLVDLARHIPEELWQMKLGLKLL  116

Query  364  QERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVN  543
            QER+R GSFWWPYISNLPE +SVPIFF GEDIK LQYAPL++QVNKRCRFL E EK +  
Sbjct  117  QERARTGSFWWPYISNLPETFSVPIFFSGEDIKELQYAPLVHQVNKRCRFLHELEKVIKC  176

Query  544  ELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
            +  NVER+ HPF GQ VD+S+LGWAMSAVSSRAFRL+G K+
Sbjct  177  KFENVEREAHPFGGQKVDASSLGWAMSAVSSRAFRLHGIKQ  217



>ref|XP_006307219.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 ref|XP_006307220.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 gb|EOA40117.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 gb|EOA40118.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
Length=532

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 174/227 (77%), Gaps = 8/227 (4%)
 Frame = +1

Query  4    SMPTKMTLMAASLT-HLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAI  180
            SM     +  ASL   +RP TC A S     SRLA  PPDL++W+KREGGFVH +VK++ 
Sbjct  55   SMAANSKMAIASLAAQIRPFTCLAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQ  111

Query  181  SEPYGLGVVASDDIPKGSDLIALPEHLPLQF----GTVEADSPIPKLAQQVPEELWAMKL  348
               +G+G+++++ IP+G++LI+LP H+PL+F     +  + S +  LA++VPEELWAMKL
Sbjct  112  ETQFGIGLISTEQIPQGTNLISLPPHIPLRFESDDASSSSSSLLTALARRVPEELWAMKL  171

Query  349  GLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE  528
            GL+LLQER+   SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE
Sbjct  172  GLRLLQERANGDSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE  231

Query  529  KFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            + +   L +VE   HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  232  QEIRRTLEDVEVSDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  278



>ref|NP_564222.1| rubisco methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAF97974.1|AC000103_24 F21J9.27 [Arabidopsis thaliana]
 gb|AEE30553.1| rubisco methyltransferase-like protein [Arabidopsis thaliana]
Length=476

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 170/225 (76%), Gaps = 7/225 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M      +A+    +RP TC A S     SRLA  PPDLI+W+KREGGFVH +VK++   
Sbjct  1    MANSKMAIASLAAQIRPFTCLAAS---LPSRLAPHPPDLIRWIKREGGFVHHAVKLSQET  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF----GTVEADSPIPKLAQQVPEELWAMKLGL  354
             +G+G+++++ I  G+DLI+LP H+PL+F     +  + S +  LA++VPEELWAMKLGL
Sbjct  58   QFGIGLISTEQISPGTDLISLPPHVPLRFESDDSSSSSSSLLSALARRVPEELWAMKLGL  117

Query  355  KLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKF  534
            +LLQER+   SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLL+QVNKRCRFLLEFE+ 
Sbjct  118  RLLQERANADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLEFEQE  177

Query  535  VVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            +   L +V+   HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  178  IRRTLEDVKASDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  222



>ref|XP_007045257.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01089.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=630

 Score =   281 bits (718),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 175/280 (63%), Gaps = 69/280 (25%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++  SLT  RPLTCAA  A  Y +RL   PPDL+KWVKREGGFVH +VKIA     GLG+
Sbjct  84   MLIPSLTKFRPLTCAA--AAFYPTRLVPHPPDLVKWVKREGGFVHEAVKIAQDTTLGLGL  141

Query  205  VASDDIPKGSDLIALPEHLPLQFGTVE---ADSPIPKLAQQVP-----------------  324
            VAS +IPKGSDLI LP+H+PL+F + E   ADS +  L+ QVP                 
Sbjct  142  VASGEIPKGSDLIVLPDHVPLKFQSDEQNGADSVLLHLSHQVPDLNLSDSGVALWVFLNW  201

Query  325  ----------------------------------EELWAMKLGLKLLQERSRKGSFWWPY  402
                                              EELWAMKLGLKLLQER++ GSFWWPY
Sbjct  202  VTDHSKSLSLYERAQLLCLSSNRVLNWTLWEHVTEELWAMKLGLKLLQERAKVGSFWWPY  261

Query  403  ISNLPEKYSVPIFFPGEDIKNLQYAPLLY-------------QVNKRCRFLLEFEKFVVN  543
            ISNLPE YSVPIFF GEDIKNLQYAPLLY             QVNKRCRFLLEFE+ V N
Sbjct  262  ISNLPETYSVPIFFTGEDIKNLQYAPLLYQLALKLIVIFFPNQVNKRCRFLLEFEQEVKN  321

Query  544  ELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
             L +++   HPF GQDVD+S+LGWAMSAVSSRAFRLYG K
Sbjct  322  ALKDLKLSEHPFGGQDVDASSLGWAMSAVSSRAFRLYGKK  361



>ref|XP_004150615.1| PREDICTED: uncharacterized protein LOC101210959 [Cucumis sativus]
 gb|KGN51466.1| hypothetical protein Csa_5G561260 [Cucumis sativus]
Length=483

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 173/224 (77%), Gaps = 10/224 (4%)
 Frame = +1

Query  13   TKMTLMAASLTHLRPLTCAAVSATL--YSSRLATQPPDLIKWVKREGGFVHPSVKIAIS-  183
            +K  + + S TH RP + A++ +    +SSRL   PPDLIKWV+REGGFVH ++ IA + 
Sbjct  4    SKTAMASLSFTHFRPFSSASMPSLSPSFSSRLVPHPPDLIKWVRREGGFVHHALNIAPAP  63

Query  184  -EPYGLGVVASDDIPKGSDLIALPEHLPLQF------GTVEADSPIPKLAQQVPEELWAM  342
                GLG++AS  IPKGS+LI LP +LPL+F       + EADS +  LA+QVPEELW+M
Sbjct  64   GAHTGLGLLASHHIPKGSELIILPHNLPLRFESPEAGDSDEADSVLVNLARQVPEELWSM  123

Query  343  KLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            KLGLKLL+ER++ GSFWW YI NLPE ++VPIFFPG+DIKNLQYAPLLYQVNKRCRFLL+
Sbjct  124  KLGLKLLKERAKVGSFWWAYIGNLPEVFTVPIFFPGDDIKNLQYAPLLYQVNKRCRFLLD  183

Query  523  FEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLY  654
            FEK V   L +++ ++HPF GQ VD+S+LGWAM+AVSSRAFRLY
Sbjct  184  FEKEVKRTLDSIKPENHPFGGQTVDASSLGWAMAAVSSRAFRLY  227



>ref|XP_010477988.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
 ref|XP_010477989.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
 ref|XP_010477990.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
Length=479

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 171/219 (78%), Gaps = 8/219 (4%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            MA+    +RP TC A S     SRLA  PPDL++W+KREGGFVH +VK++    +G+G++
Sbjct  9    MASLAAQIRPFTCLAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQETQFGIGLI  65

Query  208  ASDDIPKGSDLIALPEHLPLQF----GTVEADSPIPKLAQQVPEELWAMKLGLKLLQERS  375
            +++ IP+G+DLI+LP H+PL+F     +  + S +  LA++VPEELWAMKLGL+LLQER+
Sbjct  66   STERIPQGTDLISLPPHIPLRFESDDASSSSSSLLTALARRVPEELWAMKLGLRLLQERA  125

Query  376  RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSN  555
               SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE+ +   L +
Sbjct  126  NGDSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEQEIRRTLED  185

Query  556  VE-RDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            V+    HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  186  VKASSDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  224



>ref|XP_010460423.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
 ref|XP_010460424.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
 ref|XP_010460425.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=479

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 170/219 (78%), Gaps = 8/219 (4%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            MA+    +RP TC A S     SRLA  PPDL++W+KREGGFVH +VK++    +G+G++
Sbjct  9    MASLAAQIRPFTCLAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQETQFGIGLI  65

Query  208  ASDDIPKGSDLIALPEHLPLQFGTVEADSPIPKLA----QQVPEELWAMKLGLKLLQERS  375
            +++ IP+G++LI+LP H+PL+F + +A S    L     ++VPEELWAMKLGL+LLQER+
Sbjct  66   STEQIPQGTNLISLPPHIPLRFESNDASSSSSSLLTALARRVPEELWAMKLGLRLLQERA  125

Query  376  RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSN  555
               SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE+ +   L +
Sbjct  126  NADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEQEIRRTLED  185

Query  556  VE-RDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            V+    HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  186  VKASSDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  224



>emb|CDX84966.1| BnaC05g20890D [Brassica napus]
Length=471

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 170/222 (77%), Gaps = 6/222 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    + +   H+RP TC+  S     SRLA  PPDL++W+KREGGFVH +VK++   
Sbjct  1    MATSKLAITSLAAHIRPFTCSVAS---QPSRLAPHPPDLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQ  366
            P+G+G+++++ I +G+DLI+LP H+PL+F + E  +P P LA  +  ELWAMKLGL+LLQ
Sbjct  58   PFGIGLISTEQIAQGTDLISLPPHVPLRFRSDET-APSPLLAA-LARELWAMKLGLRLLQ  115

Query  367  ERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLY-QVNKRCRFLLEFEKFVVN  543
            ER+   SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLL+ QVNKRCRFLL+FE+ +  
Sbjct  116  ERANADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLHQQVNKRCRFLLDFEREIRQ  175

Query  544  ELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
             L +V+   HPF GQDV++SALGW MSAVS+RAFRL+G +++
Sbjct  176  TLEDVKASDHPFSGQDVNASALGWTMSAVSTRAFRLHGNRKV  217



>ref|XP_002890701.1| hypothetical protein ARALYDRAFT_472886 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66960.1| hypothetical protein ARALYDRAFT_472886 [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 169/218 (78%), Gaps = 7/218 (3%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            MA+    +RP TC A S     SRLA  PPDLI+W+KREGGFVH ++K++    +G+G++
Sbjct  3    MASLAAQIRPFTCLAASQ---PSRLAPHPPDLIRWIKREGGFVHHAIKLSQETQFGIGLI  59

Query  208  ASDDIPKGSDLIALPEHLPLQF----GTVEADSPIPKLAQQVPEELWAMKLGLKLLQERS  375
            +++ I  G+DLI+LP H+PL+F     +  + S +  LA++VPEELWAMKLGL+LLQER+
Sbjct  60   STEQISPGTDLISLPPHVPLRFESDDASSSSSSLLSALARRVPEELWAMKLGLRLLQERA  119

Query  376  RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSN  555
               SFWWPYISNLPE ++VPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE+ +   L +
Sbjct  120  NVDSFWWPYISNLPETFTVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEQEIRRTLED  179

Query  556  VERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            V+   HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  180  VKASDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  217



>gb|AAM65946.1| unknown [Arabidopsis thaliana]
Length=471

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 168/218 (77%), Gaps = 7/218 (3%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            +A+    +RP TC A S     SRLA  PPDLI+W+KREGGFVH +VK++    +G+G++
Sbjct  3    IASLAAQIRPFTCLAAS---LPSRLAPHPPDLIRWIKREGGFVHHAVKLSQETQFGIGLI  59

Query  208  ASDDIPKGSDLIALPEHLPLQF----GTVEADSPIPKLAQQVPEELWAMKLGLKLLQERS  375
            +++ I  G+DLI+LP H+PL+F     +  + S +  LA++VPEELWAMKLGL+LLQER+
Sbjct  60   STEQISPGTDLISLPPHVPLRFESDDSSSSSSSLLSALARRVPEELWAMKLGLRLLQERA  119

Query  376  RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSN  555
               SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLL+QVNK CRFLLEFE+ +   L +
Sbjct  120  NADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLHQVNKICRFLLEFEQEIRRTLED  179

Query  556  VERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            V+   HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  180  VKASDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  217



>ref|XP_010499150.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Camelina sativa]
 ref|XP_010499151.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Camelina sativa]
Length=479

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 170/219 (78%), Gaps = 8/219 (4%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            MA+    +RP TC A S     SRLA  PPDL++W+KREGGFVH +VK++    +G+G++
Sbjct  9    MASLAAQIRPFTCLAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQETQFGIGLI  65

Query  208  ASDDIPKGSDLIALPEHLPLQF----GTVEADSPIPKLAQQVPEELWAMKLGLKLLQERS  375
            +++ IP+G+DLI+LP H+PL+F     +  + S +  LA++VPEELWAMKLGL+LLQER+
Sbjct  66   STEQIPQGTDLISLPPHIPLRFESDDASSSSSSLLTALARRVPEELWAMKLGLRLLQERA  125

Query  376  RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSN  555
               SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFE+ +   L +
Sbjct  126  NADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEQEIRRTLED  185

Query  556  VE-RDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
             +    HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  186  GKASSDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  224



>ref|XP_008809406.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Phoenix 
dactylifera]
Length=491

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 168/221 (76%), Gaps = 9/221 (4%)
 Frame = +1

Query  19   MTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGL  198
            +T   +SLTH R LT +A   T  ++R+   PPDL++WV+REGG +HP +KIA    +GL
Sbjct  17   VTSSTSSLTHRRQLTSSAPPVT-AAARIVPHPPDLVRWVRREGGLLHPKLKIADHPYHGL  75

Query  199  GVVASDDIPKGSDLIALPEHLPLQF--------GTVEADSPIPKLAQQVPEELWAMKLGL  354
            GVVA+DDIP+ S+L+ LP HLPL+         G    DS + +LA++VPEELWAM+LGL
Sbjct  76   GVVATDDIPQRSELVVLPSHLPLRLRRDPEPDGGGEGPDSVLSQLARRVPEELWAMRLGL  135

Query  355  KLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKF  534
            +LLQER+  GSFWWPYISNLPE ++VPIFF  EDIKNLQYAPLL+QVNKRCRFLLEFEK 
Sbjct  136  RLLQERAMVGSFWWPYISNLPEAFNVPIFFSREDIKNLQYAPLLHQVNKRCRFLLEFEKE  195

Query  535  VVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
            +   L +V    HPF GQDV++S+LGWA+SAVSSRAFRL+G
Sbjct  196  IKLMLEDVALKDHPFGGQDVNASSLGWALSAVSSRAFRLHG  236



>ref|NP_001151430.1| SET domain containing protein [Zea mays]
 gb|ACG42857.1| SET domain containing protein [Zea mays]
 gb|AFW63825.1| SET domain containing protein [Zea mays]
Length=491

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 161/207 (78%), Gaps = 9/207 (4%)
 Frame = +1

Query  58   LTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASD-----DI  222
            L+C+A  A   ++RLA QPPDL++WV+REGGFVH ++++A    +GLG+ AS      DI
Sbjct  41   LSCSA--AFTAATRLAPQPPDLVRWVQREGGFVHRALRVANHPEHGLGISASSAAAYGDI  98

Query  223  PKGSDLIALPEHLPLQFG--TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWW  396
            P G  LIALP  LPL+    T  AD  + +LAQQVP+ELWAMKLGL+LLQER++  SFWW
Sbjct  99   PIGDVLIALPSQLPLRLRRPTSAADDVLVQLAQQVPDELWAMKLGLRLLQERAKSDSFWW  158

Query  397  PYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHP  576
            PYI+NLPE ++VPIFFPGEDIKNLQYAP+L+QVNKRCRFLLEFEK V  +L  V    HP
Sbjct  159  PYIANLPETFTVPIFFPGEDIKNLQYAPILHQVNKRCRFLLEFEKEVQQKLHTVPLVDHP  218

Query  577  FEGQDVDSSALGWAMSAVSSRAFRLYG  657
            F GQDV+SS+LGWAMSA SSRAFRL+G
Sbjct  219  FYGQDVNSSSLGWAMSAASSRAFRLHG  245



>ref|XP_003570495.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brachypodium 
distachyon]
Length=485

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 162/205 (79%), Gaps = 7/205 (3%)
 Frame = +1

Query  58   LTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASD---DIPK  228
            L C+A SAT  + R+A QPPDL++WV+REGGFVHP+++++    YGLGV A+    DIP 
Sbjct  37   LACSAASAT--APRIAPQPPDLLRWVQREGGFVHPALRVSDHPEYGLGVSATGADGDIPP  94

Query  229  GSDLIALPEHLPLQFG--TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPY  402
            G+ LI LP  +PL+       AD+ + +LA QVPEELWAM+LGL+LLQER++  SFWWPY
Sbjct  95   GTVLIDLPGRIPLRLRRPAGAADAVLMQLADQVPEELWAMRLGLRLLQERTKSDSFWWPY  154

Query  403  ISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFE  582
            I+NLPE ++VPIFFPGEDIKNLQYAPLL+Q+NKRCRFLLEFEK V ++L  V    HPF 
Sbjct  155  IANLPETFTVPIFFPGEDIKNLQYAPLLHQINKRCRFLLEFEKEVQHKLGTVPLADHPFC  214

Query  583  GQDVDSSALGWAMSAVSSRAFRLYG  657
            GQDV+SS+LGWAMSA SSRAFRL+G
Sbjct  215  GQDVNSSSLGWAMSAASSRAFRLHG  239



>ref|XP_006647850.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Oryza 
brachyantha]
Length=486

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP++++     +GLGV    A  DIP G  LIALP  LPL
Sbjct  49   RIAPQPPDLLRWVQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPL  108

Query  268  QFG--TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIF  441
            +       AD+ + +LA QVPEELWAM+LGL LLQER++  SFWWPYI+NLPE ++VPIF
Sbjct  109  RLRRPAAAADAVLTQLADQVPEELWAMRLGLSLLQERAKSDSFWWPYIANLPETFTVPIF  168

Query  442  FPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAM  621
            FPGEDIKNLQYAPLL+QVNKRCRFLLEFEK   ++LS V  + HPF GQDV+SS+LGWAM
Sbjct  169  FPGEDIKNLQYAPLLHQVNKRCRFLLEFEKEAKHKLSTVPLEDHPFCGQDVNSSSLGWAM  228

Query  622  SAVSSRAFRLYG  657
            SA SSRAFRL+G
Sbjct  229  SAASSRAFRLHG  240



>gb|EEE57758.1| hypothetical protein OsJ_08284 [Oryza sativa Japonica Group]
Length=437

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 153/192 (80%), Gaps = 5/192 (3%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP++++     +GLGV    A  DIP G  LIALP  LPL
Sbjct  49   RIAPQPPDLLRWVQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPL  108

Query  268  QFG--TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIF  441
            +       AD+ + +LA QVPEELWAM+LGL+LLQER++  SFWWPYI+NLPE ++VPIF
Sbjct  109  RLRRPAGAADAVLVQLADQVPEELWAMRLGLRLLQERAKSDSFWWPYIANLPETFTVPIF  168

Query  442  FPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAM  621
            FPGEDIKNLQYAPLL+QVNKRCRFLLEFEK V ++L  V  + HPF GQDV+SS+LGWAM
Sbjct  169  FPGEDIKNLQYAPLLHQVNKRCRFLLEFEKEVKHKLGTVPLEDHPFCGQDVNSSSLGWAM  228

Query  622  SAVSSRAFRLYG  657
            SA S+RAFRL+G
Sbjct  229  SAASTRAFRLHG  240



>ref|XP_002454330.1| hypothetical protein SORBIDRAFT_04g028760 [Sorghum bicolor]
 gb|EES07306.1| hypothetical protein SORBIDRAFT_04g028760 [Sorghum bicolor]
Length=490

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 151/188 (80%), Gaps = 5/188 (3%)
 Frame = +1

Query  109  QPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVAS---DDIPKGSDLIALPEHLPLQFG-  276
            QPPDL++WV+REGGFVHP++++A    +GLGV A+    DIP G  LIALP  LPL+   
Sbjct  57   QPPDLVRWVQREGGFVHPALRVANHPEHGLGVSAAAPDGDIPPGDVLIALPGRLPLRLRR  116

Query  277  -TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGE  453
             T  AD  + +LAQQVPEELWAMKLGL+LLQER++  SFWWPYI+NLPE ++VPIFFPGE
Sbjct  117  PTGAADDVLVQLAQQVPEELWAMKLGLRLLQERAKSDSFWWPYIANLPETFTVPIFFPGE  176

Query  454  DIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVS  633
            DIKNLQYAPLL+QVNKRCRFLLEFEK +  +L  V    HPF GQDV+SS+LGWAMSA S
Sbjct  177  DIKNLQYAPLLHQVNKRCRFLLEFEKEIQQKLHTVPSVDHPFYGQDVNSSSLGWAMSAAS  236

Query  634  SRAFRLYG  657
            SRAFRL+G
Sbjct  237  SRAFRLHG  244



>ref|XP_011628004.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Amborella trichopoda]
 gb|ERM95848.1| hypothetical protein AMTR_s00060p00101960 [Amborella trichopoda]
Length=480

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 161/201 (80%), Gaps = 5/201 (2%)
 Frame = +1

Query  67   AAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIA  246
            AAVSA++ S RL   PPDL+ WV REGGFVH  ++IA  E  GL ++AS DI  GSDLI+
Sbjct  24   AAVSASM-SKRLVPNPPDLVSWVVREGGFVHKGLRIADGEASGLCLMASSDIEAGSDLIS  82

Query  247  LPEHLPLQFGTVEA----DSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNL  414
            LP+H+PL F +  +    D+ + ++AQ+VPEELWAM+LGLKLL ER++ GSFWWPYISNL
Sbjct  83   LPKHIPLSFPSSGSGQKWDASLFRIAQKVPEELWAMRLGLKLLHERAKVGSFWWPYISNL  142

Query  415  PEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDV  594
            PE +++PIFF GE IK+LQYAPL++QVNKRCRFLL+FEK V + L +V  + HPF GQ+V
Sbjct  143  PETFNIPIFFSGEGIKDLQYAPLIHQVNKRCRFLLDFEKQVKSILKDVGPEEHPFGGQEV  202

Query  595  DSSALGWAMSAVSSRAFRLYG  657
            ++S+LGWAMSAVSSRAFRL+G
Sbjct  203  NASSLGWAMSAVSSRAFRLHG  223



>ref|XP_011628008.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Amborella trichopoda]
Length=477

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 161/201 (80%), Gaps = 5/201 (2%)
 Frame = +1

Query  67   AAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIA  246
            AAVSA++ S RL   PPDL+ WV REGGFVH  ++IA  E  GL ++AS DI  GSDLI+
Sbjct  24   AAVSASM-SKRLVPNPPDLVSWVVREGGFVHKGLRIADGEASGLCLMASSDIEAGSDLIS  82

Query  247  LPEHLPLQFGTVEA----DSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNL  414
            LP+H+PL F +  +    D+ + ++AQ+VPEELWAM+LGLKLL ER++ GSFWWPYISNL
Sbjct  83   LPKHIPLSFPSSGSGQKWDASLFRIAQKVPEELWAMRLGLKLLHERAKVGSFWWPYISNL  142

Query  415  PEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDV  594
            PE +++PIFF GE IK+LQYAPL++QVNKRCRFLL+FEK V + L +V  + HPF GQ+V
Sbjct  143  PETFNIPIFFSGEGIKDLQYAPLIHQVNKRCRFLLDFEKQVKSILKDVGPEEHPFGGQEV  202

Query  595  DSSALGWAMSAVSSRAFRLYG  657
            ++S+LGWAMSAVSSRAFRL+G
Sbjct  203  NASSLGWAMSAVSSRAFRLHG  223



>gb|EEC73951.1| hypothetical protein OsI_08832 [Oryza sativa Indica Group]
Length=486

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 153/192 (80%), Gaps = 5/192 (3%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP++++     +GLGV    A  DIP G  LIALP  LPL
Sbjct  49   RIAPQPPDLLRWVQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPL  108

Query  268  QFG--TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIF  441
            +       AD+ + +LA QVPEELWAM+LGL+LLQER++  SFWWPYI+NLPE ++VPIF
Sbjct  109  RLRRPAGAADAVLVQLADQVPEELWAMRLGLRLLQERAKSDSFWWPYIANLPETFTVPIF  168

Query  442  FPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAM  621
            FPGEDIKNLQYAPLL+QVNKRCRFLLEFEK V ++L  V  + HPF GQDV+SS+LGWAM
Sbjct  169  FPGEDIKNLQYAPLLHQVNKRCRFLLEFEKEVKHKLGTVPLEDHPFCGQDVNSSSLGWAM  228

Query  622  SAVSSRAFRLYG  657
            SA S+RAFRL+G
Sbjct  229  SAASTRAFRLHG  240



>ref|NP_001048036.1| Os02g0733800 [Oryza sativa Japonica Group]
 dbj|BAD16153.1| SET domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF09950.1| Os02g0733800 [Oryza sativa Japonica Group]
 dbj|BAH00588.1| unnamed protein product [Oryza sativa Japonica Group]
Length=486

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 153/192 (80%), Gaps = 5/192 (3%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP++++     +GLGV    A  DIP G  LIALP  LPL
Sbjct  49   RIAPQPPDLLRWVQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPL  108

Query  268  QFG--TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIF  441
            +       AD+ + +LA QVPEELWAM+LGL+LLQER++  SFWWPYI+NLPE ++VPIF
Sbjct  109  RLRRPAGAADAVLVQLADQVPEELWAMRLGLRLLQERAKSDSFWWPYIANLPETFTVPIF  168

Query  442  FPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAM  621
            FPGEDIKNLQYAPLL+QVNKRCRFLLEFEK V ++L  V  + HPF GQDV+SS+LGWAM
Sbjct  169  FPGEDIKNLQYAPLLHQVNKRCRFLLEFEKEVKHKLGTVPLEDHPFCGQDVNSSSLGWAM  228

Query  622  SAVSSRAFRLYG  657
            SA S+RAFRL+G
Sbjct  229  SAASTRAFRLHG  240



>ref|XP_006828432.2| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Amborella trichopoda]
Length=483

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 161/201 (80%), Gaps = 5/201 (2%)
 Frame = +1

Query  67   AAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIA  246
            AAVSA++ S RL   PPDL+ WV REGGFVH  ++IA  E  GL ++AS DI  GSDLI+
Sbjct  24   AAVSASM-SKRLVPNPPDLVSWVVREGGFVHKGLRIADGEASGLCLMASSDIEAGSDLIS  82

Query  247  LPEHLPLQFGTVEA----DSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNL  414
            LP+H+PL F +  +    D+ + ++AQ+VPEELWAM+LGLKLL ER++ GSFWWPYISNL
Sbjct  83   LPKHIPLSFPSSGSGQKWDASLFRIAQKVPEELWAMRLGLKLLHERAKVGSFWWPYISNL  142

Query  415  PEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDV  594
            PE +++PIFF GE IK+LQYAPL++QVNKRCRFLL+FEK V + L +V  + HPF GQ+V
Sbjct  143  PETFNIPIFFSGEGIKDLQYAPLIHQVNKRCRFLLDFEKQVKSILKDVGPEEHPFGGQEV  202

Query  595  DSSALGWAMSAVSSRAFRLYG  657
            ++S+LGWAMSAVSSRAFRL+G
Sbjct  203  NASSLGWAMSAVSSRAFRLHG  223



>ref|XP_004953834.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Setaria 
italica]
Length=485

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 149/188 (79%), Gaps = 5/188 (3%)
 Frame = +1

Query  109  QPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPLQFG-  276
            QPPDL++WV+REGGFVHP+++++    +GLGV    A  DIP G  LI LP  LPL+   
Sbjct  52   QPPDLVRWVQREGGFVHPALRVSDHPEHGLGVSAAAADGDIPPGEVLITLPGRLPLRLRR  111

Query  277  -TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGE  453
             T  AD  + +LAQQVPEELWAMKLGL+LLQER+R  SFWWPYI+NLPE ++VPIFFPG+
Sbjct  112  PTGAADDVLVQLAQQVPEELWAMKLGLRLLQERARPDSFWWPYIANLPETFTVPIFFPGD  171

Query  454  DIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVS  633
            DIKNLQYAPLL+QVNKRC FLLEFEK V   L  +  +HHPF GQDV+SS+LGWAMSA S
Sbjct  172  DIKNLQYAPLLHQVNKRCCFLLEFEKKVQWMLDTLPLEHHPFYGQDVNSSSLGWAMSASS  231

Query  634  SRAFRLYG  657
            SRAFRL+G
Sbjct  232  SRAFRLHG  239



>dbj|BAK03360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 150/192 (78%), Gaps = 5/192 (3%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP+++++    YGLGV    A   IP G+ LI LP  +PL
Sbjct  48   RIAQQPPDLLRWVQREGGFVHPALRVSDHPEYGLGVSATAADGAIPPGAVLIDLPGRIPL  107

Query  268  QFG--TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIF  441
            +       AD+ + +LA QVPEELWAM+LGL+LLQER++  SFWWPYI+NLPE ++VPIF
Sbjct  108  RLRRPADAADAVLMQLADQVPEELWAMRLGLRLLQERTKFDSFWWPYIANLPETFTVPIF  167

Query  442  FPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAM  621
            FPGEDIKNLQYAPLL+Q+NKRCRFLLEFEK V  +L  V    HPF GQDV SS+LGWAM
Sbjct  168  FPGEDIKNLQYAPLLHQINKRCRFLLEFEKEVKQKLGTVPSGDHPFCGQDVHSSSLGWAM  227

Query  622  SAVSSRAFRLYG  657
            SA SSRAFRL+G
Sbjct  228  SAASSRAFRLHG  239



>ref|XP_009113823.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=468

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = +1

Query  19   MTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGL  198
            M  + A++T L+      + A+    RL+  PPDL++W++REGGFVH +VK++   P+G 
Sbjct  1    MATLKAAITFLKANIRGLICASQRPPRLSHHPPDLVRWIEREGGFVHHAVKLSQDTPFGF  60

Query  199  GVVASDDIPKGSDLIALPEHLPLQFGTVEAD-SPI-PKLAQQVPEELWAMKLGLKLLQER  372
            G+++++ IP+G+DLI LP H+PL+F + +A  SP+   L+++VPEELWAMKLGL+LLQER
Sbjct  61   GLISTEQIPQGTDLITLPPHVPLRFESDDAPPSPLLAALSRRVPEELWAMKLGLRLLQER  120

Query  373  SRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELS  552
            +   SFWWPYISNLP  Y+VPIFF  EDI+NL   P  YQ ++RCRFLL FE+ V   L 
Sbjct  121  ANADSFWWPYISNLPVTYTVPIFFHPEDIENLPLKPFQYQFDERCRFLLHFEEEVRETLE  180

Query  553  NVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
             V+   HPF GQDV++S L WA+SAVS+RAFRL+G +++
Sbjct  181  GVQASDHPFRGQDVNASDLRWALSAVSTRAFRLHGNRKV  219



>gb|KHN21605.1| Histone-lysine N-methyltransferase setd3 [Glycine soja]
Length=423

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 142/211 (67%), Gaps = 44/211 (21%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-ISEPYGLGVVA  210
             SLT LRPLTCAA +            PDLIKWV REGGFVH +VKIA +    GLG+V 
Sbjct  2    CSLTQLRPLTCAASA------------PDLIKWVAREGGFVHRAVKIAQLDSSNGLGLVT  49

Query  211  SDDIPKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSF  390
             ++IP+G                               +ELWAMKLGLKLLQER++ GSF
Sbjct  50   KEEIPRG-------------------------------KELWAMKLGLKLLQERAKVGSF  78

Query  391  WWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDH  570
            WWPYI+NLPE Y+VPIFFPGEDIKNL YA LL+QVNKRCRFLL+FE+ V   L ++  D 
Sbjct  79   WWPYITNLPETYNVPIFFPGEDIKNLHYASLLHQVNKRCRFLLDFEREVKRALVSLTPDK  138

Query  571  HPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            HPF GQ+VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  139  HPFGGQEVDASSLGWAMSAVSSRAFRLYGEK  169



>ref|XP_006580887.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine 
max]
Length=419

 Score =   226 bits (576),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 135/211 (64%), Gaps = 50/211 (24%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-ISEPYGLGVVA  210
             SLT LRPLTCAA              PDLIKWV REGGFVH +VKIA +    GLG+  
Sbjct  2    CSLTQLRPLTCAA------------SAPDLIKWVAREGGFVHRAVKIAQLDSSNGLGL--  47

Query  211  SDDIPKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSF  390
                                                + EELWAMKLGLKLLQER++ GSF
Sbjct  48   -----------------------------------HLAEELWAMKLGLKLLQERAKVGSF  72

Query  391  WWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDH  570
            WWPYI+NLPE Y+VPIFFPGEDIKNL YA LL+QVNKRCRFLL+FE+ V   L ++  D 
Sbjct  73   WWPYITNLPETYTVPIFFPGEDIKNLHYASLLHQVNKRCRFLLDFEREVKRALVSLTPDK  132

Query  571  HPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            HPF GQ+VD+S+LGWAMSAVSSRAFRLYG K
Sbjct  133  HPFGGQEVDASSLGWAMSAVSSRAFRLYGEK  163



>gb|KCW85968.1| hypothetical protein EUGRSUZ_B02671 [Eucalyptus grandis]
Length=380

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  319  VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVN  498
            + EELWAMKLGLKLL ER++ GSFWWPYISNLPE Y VPIFFPGEDIKNLQYAPLLYQVN
Sbjct  10   LAEELWAMKLGLKLLGERAKIGSFWWPYISNLPETYGVPIFFPGEDIKNLQYAPLLYQVN  69

Query  499  KRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            KRCRFLL+FEK V N +S+     HPF GQD+++S+LGWAMSAVSSRAFRLYG K L
Sbjct  70   KRCRFLLDFEKEVKNAISDFNMMDHPFGGQDINASSLGWAMSAVSSRAFRLYGKKSL  126



>ref|XP_002964620.1| hypothetical protein SELMODRAFT_81798 [Selaginella moellendorffii]
 gb|EFJ34953.1| hypothetical protein SELMODRAFT_81798 [Selaginella moellendorffii]
Length=464

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 134/188 (71%), Gaps = 9/188 (5%)
 Frame = +1

Query  118  DLIKWVKREGGFVHPSVKIAIS-EPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVE---  285
            DL  WVK +GGFV   + +  S   +G+G+VA+ D+P+GS +I LP  +P+     E   
Sbjct  21   DLRGWVKNQGGFVWSGLHVVHSGSSHGMGLVATQDLPQGSTIITLPRRVPMPMPDPENAA  80

Query  286  ----ADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGE  453
                ++  I ++A +VPEELWAM+LGLKLL ER++KGS+WWPYIS LP  +++PIFF G 
Sbjct  81   VLAPSEGVICEIANRVPEELWAMRLGLKLLYERAQKGSYWWPYISMLPHSFTLPIFFSGV  140

Query  454  DIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVS  633
            DI+++ YAP+ +QV KRCRFLL+F   +  +L ++  + HPF GQ VDS ALGWAM+AVS
Sbjct  141  DIESIDYAPVTHQVKKRCRFLLQFSAELA-KLESLPEEVHPFAGQSVDSGALGWAMAAVS  199

Query  634  SRAFRLYG  657
            SRAFR++G
Sbjct  200  SRAFRIHG  207



>ref|XP_002989522.1| hypothetical protein SELMODRAFT_129980 [Selaginella moellendorffii]
 gb|EFJ09398.1| hypothetical protein SELMODRAFT_129980 [Selaginella moellendorffii]
Length=464

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 134/188 (71%), Gaps = 9/188 (5%)
 Frame = +1

Query  118  DLIKWVKREGGFVHPSVKIAIS-EPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVE---  285
            DL  WVK +GGFV   + +  S   +G+G+VA+ D+P+GS +I LP  +P+     E   
Sbjct  21   DLRGWVKNQGGFVWSGLHVVHSGSSHGMGLVATQDLPQGSTIITLPRRIPMPMPDPENAA  80

Query  286  ----ADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGE  453
                ++  I ++A +VPEELWAM+LGLKLL ER++KGS+WWPYIS LP  +++PIFF G 
Sbjct  81   VLAPSEGVICEIANRVPEELWAMRLGLKLLYERAQKGSYWWPYISMLPHSFTLPIFFSGV  140

Query  454  DIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVS  633
            DI+++ YAP+ +QV KRCRFLL+F   +  +L ++  + HPF GQ VDS ALGWAM+AVS
Sbjct  141  DIESIDYAPVTHQVKKRCRFLLQFSSELA-KLESLPEEIHPFAGQFVDSGALGWAMAAVS  199

Query  634  SRAFRLYG  657
            SRAFR++G
Sbjct  200  SRAFRIHG  207



>ref|XP_011463173.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=387

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  316  QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQV  495
             + +ELWAMKLGLKLLQER+R GSFWWPYI NLPE +SVPIFFPGEDIKNLQYAP+LYQV
Sbjct  16   HLADELWAMKLGLKLLQERARVGSFWWPYIGNLPEAFSVPIFFPGEDIKNLQYAPVLYQV  75

Query  496  NKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            NKRCRFLLEFE+ V   L N +   HPF GQ V +SALGWAMSAVSSRAFRLYG K
Sbjct  76   NKRCRFLLEFEQEVRRALDNNKPSDHPFGGQAVGASALGWAMSAVSSRAFRLYGKK  131



>gb|KJB50381.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=362

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  340  MKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLL  519
            MKLGLKLLQER++ GSFWWPYISNLPE Y+VPIFF GEDIKNLQYAPLLYQVNKRCRFLL
Sbjct  1    MKLGLKLLQERAKVGSFWWPYISNLPETYTVPIFFSGEDIKNLQYAPLLYQVNKRCRFLL  60

Query  520  EFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            EFE+ V N L N++   HPF GQDVD+S+LGWAMSAVSSRAFRLYG K
Sbjct  61   EFEQEVKNVLKNLKPSEHPFGGQDVDASSLGWAMSAVSSRAFRLYGKK  108



>gb|AAK68776.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL66947.1| unknown protein [Arabidopsis thaliana]
Length=364

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  340  MKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLL  519
            MKLGL+LLQER+   SFWWPYISNLPE Y+VPIFFPGEDIKNLQYAPLL+QVNKRCRFLL
Sbjct  1    MKLGLRLLQERANADSFWWPYISNLPETYTVPIFFPGEDIKNLQYAPLLHQVNKRCRFLL  60

Query  520  EFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            EFE+ +   L +V+   HPF GQDV++SALGW MSAVS+RAFRL+G K+L
Sbjct  61   EFEQEIRRTLEDVKASDHPFSGQDVNASALGWTMSAVSTRAFRLHGNKKL  110



>ref|XP_006448172.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 ref|XP_006448173.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61412.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61413.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=362

 Score =   182 bits (463),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +1

Query  340  MKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLL  519
            MKLGLKLLQER+R GSFWWPYISNLPE YSVPIFF GEDIKNLQYAPLLYQVNKRCRFLL
Sbjct  1    MKLGLKLLQERARLGSFWWPYISNLPETYSVPIFFQGEDIKNLQYAPLLYQVNKRCRFLL  60

Query  520  EFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            +F++ V + L++V+ + HPF GQ++++S+LGWAMSAVSSRAFRL+G K
Sbjct  61   DFDQEVRHALASVKPNDHPFGGQELNASSLGWAMSAVSSRAFRLHGKK  108



>ref|XP_008467099.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Cucumis melo]
Length=423

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  325  EELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKR  504
            EELW+MKLGLKLL+ER++ GSFWW YI NLPE ++VPIFF G+DIKNLQYAPLLYQVNKR
Sbjct  58   EELWSMKLGLKLLKERAKVGSFWWAYIGNLPEVFTVPIFFSGDDIKNLQYAPLLYQVNKR  117

Query  505  CRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
            CRFLL+FEK V   L +++ ++HPF GQ VD+S+LGWAM+AVSSRAFRLY 
Sbjct  118  CRFLLDFEKEVKRTLDSIKPENHPFGGQTVDASSLGWAMAAVSSRAFRLYS  168



>gb|ACF87938.1| unknown [Zea mays]
Length=352

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  340  MKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLL  519
            MKLGL+LLQER++  SFWWPYI+NLPE ++VPIFFPGEDIKNLQYAP+L+QVNKRCRFLL
Sbjct  1    MKLGLRLLQERAKSDSFWWPYIANLPETFTVPIFFPGEDIKNLQYAPILHQVNKRCRFLL  60

Query  520  EFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
            EFEK V  +L  V    HPF GQDV+SS+LGWAMSA SSRAFRL+G
Sbjct  61   EFEKEVQQKLHTVPLVDHPFYGQDVNSSSLGWAMSAASSRAFRLHG  106



>emb|CDY66565.1| BnaAnng22450D [Brassica napus]
Length=366

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +1

Query  340  MKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLY-QVNKRCRFL  516
            MKLGL+LLQER+   SFWWPYISNLP  Y+VPIFF  EDI+NL   P  Y Q ++RCRFL
Sbjct  1    MKLGLRLLQERANADSFWWPYISNLPVTYTVPIFFHPEDIENLPLKPFQYQQFDERCRFL  60

Query  517  LEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKRL  669
            L FE+ V   L  V+   HPF GQDV++S L WA+SAVS+RAFRL+G +++
Sbjct  61   LHFEEEVRETLEGVQASDHPFRGQDVNASDLRWALSAVSTRAFRLHGNRKV  111



>gb|EMT12546.1| hypothetical protein F775_52053 [Aegilops tauschii]
Length=500

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 107/195 (55%), Gaps = 17/195 (9%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKI-AISEPYGLGVV-----ASDDIPKGSDLIALPEH  258
            R+A QPPDL++WV+REGGFVHP++++     P   G+      A   IP G+ LI LP  
Sbjct  48   RIAQQPPDLLRWVQREGGFVHPALRVYGARSPLAAGLGGPAPGADGIIPPGAVLIDLPGR  107

Query  259  LPLQFG--TVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSV  432
            +PL+       AD+ + +LA +VP    +  L L +          W    S L   +SV
Sbjct  108  IPLRLRRPADAADALLMQLADRVPGIGPSDYLPLVV--------DSWAKLCSEL-LLFSV  158

Query  433  PIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALG  612
                   +   L    L   +NKRCRFLLEFEK V  +L  V    HPF GQDV SS+LG
Sbjct  159  GNCQLSNNNMKLITLQLTTVINKRCRFLLEFEKEVKQKLGTVPSGDHPFCGQDVHSSSLG  218

Query  613  WAMSAVSSRAFRLYG  657
            WAMSA SSRAFRL+G
Sbjct  219  WAMSAASSRAFRLHG  233



>ref|XP_002955706.1| hypothetical protein VOLCADRAFT_106928 [Volvox carteri f. nagariensis]
 gb|EFJ43131.1| hypothetical protein VOLCADRAFT_106928 [Volvox carteri f. nagariensis]
Length=542

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 102/186 (55%), Gaps = 8/186 (4%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISE---PYGLGVVASDDIPKGSDLIALPEHLPLQFGTVE  285
            P+L++W++  GG V       ++      G G+ AS D+  G  LI LP    L +G  +
Sbjct  70   PELMRWLQLNGGRVDGVTLANLAGRDGASGWGLQASQDLEPGRRLIVLPAACHLTYGAKD  129

Query  286  ADSPIPKLAQQVPEELWAMKLGLKLLQERSRKG-SFWWPYISNLPEKY-SVPIFFPGEDI  459
             D  +  L ++VP ELW  KL L+LL +R R   S +  YISNLP     +P+FF    +
Sbjct  130  -DPRLLALIEKVPNELWGAKLALQLLSQRLRGADSLFAAYISNLPRGIPGIPMFFSKRAL  188

Query  460  KNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSR  639
              + Y P+  QV KRCR+L  F + V+ +L     D  PF G  VD +ALGWA++ V+SR
Sbjct  189  DLIDYPPVTQQVQKRCRWLHTFSQQVMAKLPGSPED--PFGGVTVDINALGWALACVTSR  246

Query  640  AFRLYG  657
            AFR  G
Sbjct  247  AFRTRG  252



>ref|XP_001421544.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99837.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=488

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 107/198 (54%), Gaps = 11/198 (6%)
 Frame = +1

Query  79   ATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEH  258
            A + S  LAT       W    GG +H  V++     +G  + A  DI  G  L++LP  
Sbjct  47   ARVQSGVLAT----FATWFDHRGGKIHERVRMTYRPNFGWSLEADGDIADGERLVSLPPK  102

Query  259  LPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQER-SRKGSFWWPYISNLPEKY-SV  432
            L L+  + +   P+  +  +VP E W+ K+GL LL+ER +   S + PYI+ LP  +   
Sbjct  103  LMLRCDSDDVSEPLKNVVDRVPNEFWSSKVGLVLLRERVAGAHSAFAPYITLLPAVHEGS  162

Query  433  PIFFPGEDIKNLQYAPLLYQVNKRCRFLLEF--EKFVVNELSNVERDHHPFEGQ---DVD  597
            P FFP + ++ L+YAP++ Q+NKR RFL  F      V++  +   + HP   +    +D
Sbjct  163  PTFFPPDAVRALEYAPIVQQINKRARFLGTFAGNALTVDDGESYVDEAHPGRQRVEMTID  222

Query  598  SSALGWAMSAVSSRAFRL  651
            ++ALGWA +  SSRAF++
Sbjct  223  ANALGWATACASSRAFKV  240



>ref|XP_005644202.1| SET domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19658.1| SET domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 105/184 (57%), Gaps = 9/184 (5%)
 Frame = +1

Query  121  LIKWVKREGGFVHPSVKIAISEP-YGLGVVASDDIPKGSDLIALPEHLPLQF-GTVEADS  294
            L++WV   GG V P+V ++  +   G G+ AS     G  L++LP    L + G+ E + 
Sbjct  44   LVQWVSSSGGTVSPTVHVSPPDSVMGAGLRASKACRSGELLVSLPRSCQLSYDGSTEPN-  102

Query  295  PIPKLAQQVPEELWAMKLGLKLLQERSRK-GSFWWPYISNLPEKY-SVPIFFPGEDIKNL  468
             + +L  +VPEELW  KL L++L+ER     S +  YI NLP     +P+FF  + I+ L
Sbjct  103  -LLQLISKVPEELWGAKLALRVLKERIMGPDSPFHSYIDNLPMGVPGIPMFFSPDAIRAL  161

Query  469  -QYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAF  645
             QY PL  QV KRCR+LL F    ++ L     D  PF G  VD++ LGWA++  +SRAF
Sbjct  162  EQYPPLSEQVKKRCRWLLSFSSEHLSALPGSPAD--PFLGTPVDANILGWALAMTTSRAF  219

Query  646  RLYG  657
            R+ G
Sbjct  220  RVQG  223



>ref|XP_002506068.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO67326.1| set domain protein [Micromonas sp. RCC299]
Length=513

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 106/201 (53%), Gaps = 25/201 (12%)
 Frame = +1

Query  127  KWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFG----------  276
            +W +  GG     + +  +   G G+ AS D+  G  LI LP  L + +           
Sbjct  52   RWFEAYGG-TTSGISMVQTPSIGWGLTASRDVDVGERLILLPRVLQMTYSLQDRESTSSS  110

Query  277  -------TVEADSPI--PKLAQQVPEELWAMKLGLKLLQERSRKG-SFWWPYISNLPEKY  426
                     E D+P+   +L  Q+P+ELW+++LGL LL ER+  G S ++ YIS LP  +
Sbjct  111  DQATAELDREPDTPLYLKELIAQIPDELWSVRLGLALLHERALGGKSPFFQYISLLPAMH  170

Query  427  -SVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELS---NVERDHHPFEGQDV  594
              +P+FF  E +  LQY PL+ QV +R RFL+++    +  ++   N E +  PF G  V
Sbjct  171  RGLPLFFGPEAVDALQYLPLVVQVKRRSRFLIDYSSGPLKNVTAGKNGETESVPFNGYSV  230

Query  595  DSSALGWAMSAVSSRAFRLYG  657
             + ALGWA +  SSRAFR+ G
Sbjct  231  GADALGWAFACASSRAFRVAG  251



>ref|XP_001703025.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96670.1| predicted protein [Chlamydomonas reinhardtii]
Length=471

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 5/149 (3%)
 Frame = +1

Query  217  DIPKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKG-SFW  393
            D+ +G  LI LP    L +G  + D  +  L ++VP ELW  KL L+L+ +R + G S +
Sbjct  30   DVQQGHRLITLPNAAHLTYGAND-DPRLLALIEKVPSELWGAKLALQLIAQRLQGGESQF  88

Query  394  WPYISNLPEKY-SVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDH  570
              Y++ LP+ +  +P+FFP   +  + Y P   QV KRC++L EF   V+  L     D 
Sbjct  89   ASYVAELPKGFPGIPVFFPRTALDMIDYPPCSQQVKKRCKWLYEFSTEVLARLPGSPED-  147

Query  571  HPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
             PF G  VD +ALGWAM+AVSSRAFR  G
Sbjct  148  -PFGGVAVDINALGWAMAAVSSRAFRTRG  175



>emb|CEG00242.1| Rubisco LS methyltransferase, substrate-binding domain [Ostreococcus 
tauri]
Length=527

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 98/184 (53%), Gaps = 10/184 (5%)
 Frame = +1

Query  130  WVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSPIPKL  309
            W     G +HP+VK+      G  + A+++I     L+ LP  L L+         + ++
Sbjct  83   WFANRSGTIHPAVKMTYRPQSGWLLEANENIQANERLVFLPSTLMLRCDGENISEALRRV  142

Query  310  AQQVPEELWAMKLGLKLLQER-SRKGSFWWPYISNLPEKY-SVPIFFPGEDIKNLQYAPL  483
             + VP E W+ KLGL LL+ER + + S + PY++ LP  +   P FF  E I+ LQYAPL
Sbjct  143  IEGVPGEFWSSKLGLVLLRERVAGQHSAFAPYVNLLPSVHEGSPTFFQPEAIQELQYAPL  202

Query  484  LYQVNKRCRFLLEFEK-----FVVNELSNVERDHHPFEGQ---DVDSSALGWAMSAVSSR  639
            + QVNKR RFL  F +       V++      + HP   +    +D++ALGWA    SSR
Sbjct  203  VAQVNKRARFLASFFRAAGGAMTVDDGEAYVNESHPERRRVEMTIDANALGWATVCASSR  262

Query  640  AFRL  651
            AFR+
Sbjct  263  AFRV  266



>ref|XP_011399030.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
 gb|KFM26134.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
Length=370

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +1

Query  103  ATQPPDLIK-WVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGT  279
            +T P  L+  WV   GG VH ++ +  S   GLG+  S  +  G+ L+ LP    L    
Sbjct  5    STSPGALLSSWVVLRGGSVHSALHVRTSPTAGLGLGVSSAVSPGTILVRLPLAAQLGA-G  63

Query  280  VEADSPIPKLAQQVPEELWAMKLGLKLLQERS---RKGSFWWPYISNLPEKY-SVPIFFP  447
              ADS +  L  +VP ELW  +LGL  L+ER+     G+FW PYI+ LP  +  VP+FFP
Sbjct  64   GAADSDLQTLLDRVPAELWGARLGLHALRERAVGEGAGAFW-PYIAALPSAFPGVPLFFP  122

Query  448  GEDIKNLQYAPLLYQVNKRCRFLLEFEK  531
            GE ++ LQY P++ Q+NKR R+L+ F +
Sbjct  123  GEAVEALQYPPIVQQINKRSRWLVSFAR  150



>ref|XP_005843772.1| hypothetical protein CHLNCDRAFT_139898 [Chlorella variabilis]
 gb|EFN51670.1| hypothetical protein CHLNCDRAFT_139898 [Chlorella variabilis]
Length=543

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 96/186 (52%), Gaps = 28/186 (15%)
 Frame = +1

Query  118  DLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSP  297
            DL+ WV+  GG     V +  +E  G G+ AS D   GS L++LP+   L +     DS 
Sbjct  49   DLVAWVESSGGSAA-GVAVRRNE-AGFGLAASRDCGAGSTLVSLPQRCHLTY----DDSS  102

Query  298  IPKL----AQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYS-VPIFFPGEDIK  462
             P+L     Q V   L                 S + PYISNL    + +P+FF G+ + 
Sbjct  103  DPRLLALIGQVVAHRLQGAT-------------SPFAPYISNLLLGVAGLPMFFGGDALA  149

Query  463  NLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDH-HPFEGQDVDSSALGWAMSAVSSR  639
             LQY P+  QV +RCR+LL F +    EL+   R    PF G DVD++ALGWA++ V+SR
Sbjct  150  ALQYPPVTEQVKRRCRWLLAFAQ---RELAAARRGGGDPFGGADVDANALGWALAVVTSR  206

Query  640  AFRLYG  657
            AFR  G
Sbjct  207  AFRTRG  212



>gb|KIY97203.1| hypothetical protein MNEG_10760 [Monoraphidium neglectum]
Length=231

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 86/149 (58%), Gaps = 4/149 (3%)
 Frame = +1

Query  217  DIPKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRK-GSFW  393
            D+P G+ LI LP    L +   + D  +  L  QVPEELW  +L L LL  R+    S +
Sbjct  25   DLPAGARLIELPRRCLLTYDPSDCDPGLLALIGQVPEELWGGRLALALLAHRAAGPSSPF  84

Query  394  WPYISNLPEKY-SVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDH  570
             PYI+ LP  +  VP+FF  E ++ + Y P++ QV KRCR+L  F    +  L+    D 
Sbjct  85   APYIAQLPRGFPGVPMFFSREALEAIDYPPVVEQVKKRCRWLHRFSTDALAPLAGTAAD-  143

Query  571  HPFEGQDVDSSALGWAMSAVSSRAFRLYG  657
             PF G  VD ++LGW ++AV+SRAFR+ G
Sbjct  144  -PFGGVRVDINSLGWGLAAVTSRAFRVRG  171



>ref|XP_003062743.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53562.1| predicted protein [Micromonas pusilla CCMP1545]
Length=628

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 114/241 (47%), Gaps = 41/241 (17%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKRE-GGFVHPSVKIAISEPYGLGV  204
            ++A     RP++ A +   + SSRL    P      + E  G     V++  +     G+
Sbjct  5    LSAPFVRSRPVSGADI--IIISSRLVAPLPQPQHPAQLESNGAKTNGVRMVQTRAMNWGL  62

Query  205  VASDDIPKGSDLIALPEHLPLQF-----------GTVEADSP--IPKLAQQVPEELWAMK  345
             AS D+ +G+ L  LP  L L +            +    +P  + +L  QVP +LW+ K
Sbjct  63   TASRDVDEGARLARLPRRLQLSYRHDDGDDDFDDASASTSTPPSLTRLIDQVPADLWSAK  122

Query  346  LGLKLLQERSRKG-SFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLE  522
            LGL LL+ER+    S + PY         +P+FF   +   LQY P+  Q+ +R RFL++
Sbjct  123  LGLALLRERALGAKSRFAPY--------GIPLFFSPANAAALQYPPVAAQLRRRARFLMD  174

Query  523  F-------------EKFVVNE---LSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLY  654
            F             +K ++ E    SNV     PF+G  V++ ALGWA +  SSRAFR+ 
Sbjct  175  FADGPLKQAYAEEKKKRLLQEEDGTSNVAYASSPFDGYAVEADALGWATACASSRAFRVR  234

Query  655  G  657
            G
Sbjct  235  G  235



>ref|XP_010046478.1| PREDICTED: uncharacterized protein LOC104435421 [Eucalyptus grandis]
Length=400

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  490  QVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            +VNKRCRFLL+FEK V N +S+   + HPF GQ++++S+LGWAMSAVSSRAFRLYG K
Sbjct  87   KVNKRCRFLLDFEKEVKNAISDFNMEDHPFGGQNINASSLGWAMSAVSSRAFRLYGKK  144



>emb|CBJ25550.1| set domain protein [Ectocarpus siliculosus]
Length=694

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 104/215 (48%), Gaps = 28/215 (13%)
 Frame = +1

Query  91   SSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPL-  267
             +R+   P  L +W    GG + P V +  +  +G G+ A  DI  G  L  +P  + + 
Sbjct  62   DNRIDPNPEALQQWFSSVGGAIGP-VGLEETPRFGWGLKAERDIELGEKLATIPRCMCIG  120

Query  268  -------------QFGTVEADSP------IPKLAQQVPEELWAMKLGLKLLQERSRKGSF  390
                           G +E D        +  L ++VP     ++LGL LL ER + GS 
Sbjct  121  STAAVQGEEGADDNNGVLEEDKSWMGPPELQALVEKVPRTYPDLRLGLVLLHERYKTGSS  180

Query  391  --WWPYISNLPEKY-SVPIF-FPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNV  558
              W  YISNLP+++  VP+  F   +++ +Q   L  ++++RC+F++ F K V++ L+  
Sbjct  181  SEWESYISNLPKRFKGVPLASFGAVEMRGMQDMALAGKIDQRCKFMMSFIKRVLDPLT--  238

Query  559  ERDHHPFEGQDVDSSALGWAMSAVSSRAF-RLYGG  660
                 PF    V    L WA +AVSSRAF RL GG
Sbjct  239  PGPGSPFGEHRVGFGDLAWATAAVSSRAFTRLDGG  273



>gb|ABF73022.1| putative ribulose-1,5 bisphosphate carboxylase protein precursor 
[Karenia brevis]
Length=268

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 82/156 (53%), Gaps = 10/156 (6%)
 Frame = +1

Query  76   SATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE-PYGLGVVASDDIPKGSDLIALP  252
            SA +Y    A +P  L  W+   GGF       +I E P GLG++A++D+P+G   + L 
Sbjct  75   SACMYE---ALEPNPLGDWITTNGGFAK---GCSIGEVPNGLGLIATEDVPEGHVFVKLT  128

Query  253  EHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRK-GSFWWPYISNLPEKYS  429
                L   + EA +  P        +LW+ +LGL LL ER +   S + PYI  LP +++
Sbjct  129  PECMLSASSPEAATVKPLCDAIDSADLWSCRLGLLLLSERIKGPTSRFSPYIGLLPGRFT  188

Query  430  VPIFFPGEDIKNLQ--YAPLLYQVNKRCRFLLEFEK  531
            VP F+  + ++ +   + P+  QV+KR RF+  F K
Sbjct  189  VPQFWGPDAVQRVHEYFGPVWEQVDKRARFMSSFAK  224



>gb|ADE75732.1| unknown [Picea sitchensis]
Length=320

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 5/68 (7%)
 Frame = +1

Query  481  LLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLY--  654
            +++QVNKRC+ LL FE  V  E++ +  + HPF GQ VD++ALGWAMSAVS+RAFRL   
Sbjct  1    MIHQVNKRCKCLLSFEGHVNTEVNGLAPERHPFGGQHVDAAALGWAMSAVSTRAFRLQVD  60

Query  655  ---GGKRL  669
                GKR+
Sbjct  61   IMSDGKRV  68



>ref|XP_004513627.1| PREDICTED: uncharacterized protein LOC101503917 [Cicer arietinum]
Length=228

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  493  VNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGKR  666
            VNKRC+FLL+FE+ V   L  +  D HPF  Q+VD+S+LGWA+SAVSSR F L G K+
Sbjct  65   VNKRCQFLLDFEQQVKRALVGLAPDKHPFGSQEVDASSLGWAISAVSSREFWLNGNKQ  122



>ref|XP_003083454.1| N-methyltransferase (ISS) [Ostreococcus tauri]
Length=492

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 84/184 (46%), Gaps = 21/184 (11%)
 Frame = +1

Query  130  WVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSPIPKL  309
            W     G +HP+VK+      G  + A+++I     L+ LP  L L+             
Sbjct  59   WFANRSGTIHPAVKMTYRPQSGWLLEANENIQANERLVFLPSTLMLRCD-----------  107

Query  310  AQQVPEELWAMKLGLKLLQER-SRKGSFWWPYISNLPEKY-SVPIFFPGEDIKNLQYAPL  483
             + + E L  ++ G + L+ER + + S +      LP  +   P FF  E  K+    PL
Sbjct  108  GENISEALRRLQAGTRALRERFAGQHSAFRAIREPLPSVHEGSPTFFQPERFKSYNTRPL  167

Query  484  LYQVNKRCRFLLEFEK-----FVVNELSNVERDHHPFEGQ---DVDSSALGWAMSAVSSR  639
            + QVNKR RFL  F +       V++      + HP   +    +D++ALGWA    SSR
Sbjct  168  VAQVNKRARFLASFFRAAGGAMTVDDGEAYVNESHPERRRVEMTIDANALGWATVCASSR  227

Query  640  AFRL  651
            AFR+
Sbjct  228  AFRV  231



>dbj|GAM26057.1| hypothetical protein SAMD00019534_092320 [Acytostelium subglobosum 
LB1]
Length=451

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 92/200 (46%), Gaps = 12/200 (6%)
 Frame = +1

Query  73   VSATLYSSRLATQP----PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDL  240
            +S+TL ++  + Q        I W+   G F+  S+ I   + YG  +VA+ DI K + L
Sbjct  24   ISSTLVTAESSQQQQGDLTSFITWLTDNGVFMSDSLNIVHIDGYGRSIVANKDIEKSTKL  83

Query  241  IALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKL---GLKLLQERSRKGSFWWPYISN  411
            I +P  + +    V  D  IPK   ++ ++    +     + L+  R    +FW+PY S 
Sbjct  84   IEVPTGIMMAKDGV--DKHIPKEIVELMKQSEIARTDAQAIYLMYSRLNTDAFWYPYASV  141

Query  412  LPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQD  591
            LPE ++  ++F  E++  LQ + L      R + +      + + L  V   +  F+  +
Sbjct  142  LPETFTTTLYFNDEEMAALQRSKLRDFAMGRSKGIQHHYDTIFDHLKTV---NDEFKKPE  198

Query  592  VDSSALGWAMSAVSSRAFRL  651
                   WA+S + SRAF L
Sbjct  199  YTFELFRWALSCIWSRAFSL  218



>gb|ADE77120.1| unknown [Picea sitchensis]
Length=191

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  88   YSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPL  267
            YS RL+   PDL++W++ EGGFVH  +K+      GLG+V+S  I  G+++I+LP H+PL
Sbjct  35   YSPRLSPNAPDLVQWIRDEGGFVHEGLKLENESFTGLGLVSSTPISAGTEIISLPRHIPL  94

Query  268  QFGTVEADS  294
                V A S
Sbjct  95   SLPLVGAPS  103



>gb|EFA80143.1| hypothetical protein PPL_06965 [Polysphondylium pallidum PN500]
Length=417

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 90/184 (49%), Gaps = 18/184 (10%)
 Frame = +1

Query  127  KWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSPIPK  306
            +W+  EG +++PS+ I   E YG  ++A+  I +G  LI +P ++ +    +E    IPK
Sbjct  16   QWMDDEGIYLNPSLDIVKLEDYGRSIIANTLIKEGDVLIRVPRNVMMSRTGIEL--HIPK  73

Query  307  LAQQVPE---------ELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDI  459
              + + +         +  A+ L   LL     K S+W  Y S LP++++  I+F  +++
Sbjct  74   EIRSIIDSNRDDIGSTDGQAVYLMYSLLN----KDSYWHQYTSILPKQFTTSIYFDQDEM  129

Query  460  KNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSR  639
            K LQ + L Y    R   +      +  +LS++   +  F+ ++       WA+S + SR
Sbjct  130  KELQLSKLRYFTESRLSGIERHYNVIFKKLSSL---NDEFKKKEYTFELFKWALSCIWSR  186

Query  640  AFRL  651
            AF L
Sbjct  187  AFSL  190



>ref|XP_002839331.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83522.1| unnamed protein product [Tuber melanosporum]
Length=541

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 79/176 (45%), Gaps = 14/176 (8%)
 Frame = +1

Query  130  WVKREGGFVHPSVKIAISEP-YGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSPIPK  306
            W+   GGF+H S+     +  YG  V+   DIP  S LI+ P  L + +    +      
Sbjct  18   WLVSHGGFIHGSLTFTPPDSKYGSRVITCTDIPSHSQLISCPHTLTINYTKARSAFSADF  77

Query  307  LAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQYAPLL  486
            +          M L L+ L+    K SFWWPY+  LP ++  P++F  ED++ LQ    L
Sbjct  78   ITNTTQHAALCMFLCLEWLK---GKESFWWPYLCVLPREFDTPLYFSDEDLQFLQGCN-L  133

Query  487  YQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALG---WAMSAVSSRAF  645
                   R L+  E+F    +S ++R     EG D +        WA +  +SR+F
Sbjct  134  EATEVEARKLIWREEFEA-AVSILQR-----EGYDTEYYTWELYLWASTIFTSRSF  183



>ref|XP_004886528.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Heterocephalus glaber]
Length=403

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI  G   + +P  L +   + +   
Sbjct  82   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAGELFLWVPRKLVMTVESAKNSV  140

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ +Q
Sbjct  141  LGPLYSQDRILQAMGNIALAFHLLCERASPSSFWLPYIQTLPSEYDTPLYFEEEEVRCIQ  200

Query  472  YAPLLYQV  495
                ++ V
Sbjct  201  STQAIHDV  208



>ref|XP_006827327.1| PREDICTED: fructose-bisphosphate aldolase-lysine N-methyltransferase, 
chloroplastic [Amborella trichopoda]
 gb|ERM94564.1| hypothetical protein AMTR_s00010p00267610 [Amborella trichopoda]
Length=490

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 19/190 (10%)
 Frame = +1

Query  121  LIKWVKREGGFVHPSVKIAISEP--YGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            L KW   +GG V P+V+  + E   +GLG+VA   + +   ++ +P+ L +   TV A S
Sbjct  59   LWKWGCEKGGAVAPAVRAEMVETPHFGLGLVAKRSLSQNQVVLEVPKKLWINSDTVAA-S  117

Query  295  PIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQY  474
             I ++   +    W       + +E+ + GS W PY+  LP+K   P+++  E++  +Q 
Sbjct  118  EIGRVCGGLKP--WISVALFIITEEKKKNGSPWCPYLDILPQKLDSPLYWSEEELTEIQG  175

Query  475  APLLYQVNKRCRFLLEFEKFVVNELSNVER-----DHHPFEGQDVDSSALGWAMSAVSSR  639
              LL          L  +++V +E S VE      + H F    VD     WA   + SR
Sbjct  176  TQLLSTT-------LGVKEYVQSEFSKVEEEIILPNKHLFPSMTVDD--FLWAFGILRSR  226

Query  640  AFRLYGGKRL  669
            AF    GK L
Sbjct  227  AFSQLRGKDL  236



>ref|XP_004886527.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Heterocephalus glaber]
Length=597

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI  G   + +P  L +   + +   
Sbjct  84   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAGELFLWVPRKLVMTVESAKNSV  142

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ +Q
Sbjct  143  LGPLYSQDRILQAMGNIALAFHLLCERASPSSFWLPYIQTLPSEYDTPLYFEEEEVRCIQ  202

Query  472  YAPLLYQV  495
                ++ V
Sbjct  203  STQAIHDV  210



>ref|XP_011547874.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Plutella 
xylostella]
Length=494

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 71/125 (57%), Gaps = 4/125 (3%)
 Frame = +1

Query  118  DLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSP  297
            + +KW+  E G  +  V+IA  + Y LG+ A+ D  +GS ++ +P  + +       +S 
Sbjct  88   EFLKWLN-ENGAQYEGVEIASFKGYDLGLKATKDFKEGSLMLTIPRKVMMSEQDAR-ESI  145

Query  298  IPKLAQQVP--EELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
            + K  +  P  + +  + L L LL E+S+  SFW PYI+ LPE+YS  ++F  E++  L+
Sbjct  146  LGKFIEVDPLLQNMPNITLALFLLMEKSKPDSFWAPYIAVLPERYSTILYFTPEELAELK  205

Query  472  YAPLL  486
             +P+L
Sbjct  206  PSPVL  210



>gb|EFB14212.1| hypothetical protein PANDA_005835, partial [Ailuropoda melanoleuca]
Length=585

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEEEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  CTQAIHDV  206



>ref|XP_008940006.1| PREDICTED: histone-lysine N-methyltransferase setd3-like, partial 
[Merops nubicus]
Length=159

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW  + G       +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  14   PELIKWATQNGASTE-GFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  69

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  70   NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  129

Query  463  NLQYAPLLYQV  495
             LQ A  ++ V
Sbjct  130  YLQSAQAIHDV  140



>ref|XP_002917505.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Ailuropoda 
melanoleuca]
Length=591

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEEEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  CTQAIHDV  206



>ref|XP_004665660.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Jaculus jaculus]
 ref|XP_004665661.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Jaculus jaculus]
Length=615

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFETVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_008696086.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Ursus maritimus]
Length=409

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006749425.1| PREDICTED: histone-lysine N-methyltransferase setd3-like, partial 
[Leptonychotes weddellii]
Length=244

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010607434.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Fukomys damarensis]
Length=291

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWLPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_004520416.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Ceratitis 
capitata]
Length=544

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 92/202 (46%), Gaps = 16/202 (8%)
 Frame = +1

Query  49   LRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPK  228
            LR  TC   +    S+R+A    +  +W   E G  +  V+IA  E Y LG+ A+ DI +
Sbjct  104  LRRHTCNPNA----SARMAN-IENFYRWAT-ENGLRYDGVRIAQFEGYELGLEATRDIAE  157

Query  229  GSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMKLGLKLLQERSRKGSFWWPYIS  408
               L ++P  L L    ++ ++   +        +  +KL   L+ E  +  SFW PYI 
Sbjct  158  EEVLFSIPRKLILSEENMDLENSPAQFGS-----MTNLKLSYALMLEALKPNSFWKPYID  212

Query  409  NLPEKYSVPIFFPGEDIKNLQYAPLLYQVNKRCRFLLEFEKFVVNELSNVER-DHHPFEG  585
             LPEKY+  ++F  ++++ L+ +  L    K+C+ +     F+ N      R D     G
Sbjct  213  LLPEKYNTVLYFTTKEMEMLRGSNALSSALKQCKAIARQYAFLYNCTVQAPRTDKFNSMG  272

Query  586  Q----DVDSSALGWAMSAVSSR  639
            Q      +     WA+S V +R
Sbjct  273  QAFKEQFNYELYRWAVSTVMTR  294



>ref|XP_003787079.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Otolemur 
garnettii]
Length=595

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI +LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQSLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                +Y V
Sbjct  199  STQAIYDV  206



>ref|XP_005623849.1| PREDICTED: SET domain containing 3 isoform X1 [Canis lupus familiaris]
Length=625

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_004754773.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Mustela putorius furo]
 ref|XP_004796774.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Mustela putorius furo]
Length=599

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  90   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  148

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  149  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  208

Query  472  YAPLLYQV  495
                ++ V
Sbjct  209  STQAIHDV  216



>ref|XP_007518442.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Erinaceus 
europaeus]
Length=593

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVDGFEMVNFKEE-GFGLKATRDIKAEELFLWVPRKLLMTVESAKHSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  AQ ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYAQDRILQAMGNITLAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEEEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAVHDV  206



>ref|XP_004395593.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform 1 
[Odobenus rosmarus divergens]
Length=596

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_004754774.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Mustela putorius furo]
 ref|XP_004754775.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Mustela putorius furo]
 ref|XP_004754776.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Mustela putorius furo]
 ref|XP_004796775.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Mustela putorius furo]
 ref|XP_004796776.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Mustela putorius furo]
 ref|XP_004796777.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Mustela putorius furo]
Length=589

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>sp|E2RBS6.1|SETD3_CANFA RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=SET domain-containing protein 3 [Canis lupus familiaris]
Length=588

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_008763130.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Rattus 
norvegicus]
Length=398

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  29   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSI  87

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  88   LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  147

Query  472  YAPLLYQV  495
                ++ V
Sbjct  148  STQAIHDV  155



>ref|XP_547974.2| PREDICTED: SET domain containing 3 isoform X2 [Canis lupus familiaris]
Length=589

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_008696078.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Ursus maritimus]
Length=591

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006933177.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Felis catus]
Length=564

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_004395594.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform 2 
[Odobenus rosmarus divergens]
Length=589

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_007094975.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Panthera 
tigris altaica]
Length=601

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRDLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010607433.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Fukomys damarensis]
 gb|KFO21328.1| Histone-lysine N-methyltransferase setd3 [Fukomys damarensis]
Length=588

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWLPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005390471.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Chinchilla lanigera]
Length=602

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  89   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  147

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  148  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWLPYIQTLPSEYDTPLYFEEEEVRCLQ  207

Query  472  YAPLLYQV  495
                ++ V
Sbjct  208  STQAIHDV  215



>gb|AAH09054.2| SETD3 protein, partial [Homo sapiens]
Length=228

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  12   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  70

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  71   LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  130

Query  472  YAPLLYQV  495
                ++ V
Sbjct  131  STQAIHDV  138



>ref|XP_005390470.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Chinchilla lanigera]
Length=631

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  118  PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  176

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  177  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWLPYIQTLPSEYDTPLYFEEEEVRCLQ  236

Query  472  YAPLLYQV  495
                ++ V
Sbjct  237  STQAIHDV  244



>ref|XP_010115374.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Chlamydotis 
macqueenii]
Length=232

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            PDL+KW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PDLVKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_002424484.1| SET domain-containing protein, putative [Pediculus humanus corporis]
 gb|EEB11746.1| SET domain-containing protein, putative [Pediculus humanus corporis]
Length=492

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 85/178 (48%), Gaps = 7/178 (4%)
 Frame = +1

Query  118  DLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSP  297
            +LI W+K  GG V  +V I      G G+ A+ D+ +   + A+P+++ +    V+  SP
Sbjct  87   NLISWIKENGG-VADNVTIKHFNEMGYGLEAAKDLEESELICAIPKNVMMTLDNVKV-SP  144

Query  298  IPKLAQQVP--EELWAMKLGLKLLQERSR-KGSFWWPYISNLPEKYSVPIFFPGEDIKNL  468
            +  L +  P  + +  + L L L+ E  + + SFW  YIS+LP  Y+  ++F   D   +
Sbjct  145  LKYLYENNPILKNMGNVALALFLILEHVKNENSFWHHYISSLPSDYNTVLYFDLNDFLEM  204

Query  469  QYAPLLYQVNKRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSAL-GWAMSAVSSR  639
            + +P      K C+ +     +  N   N   D      ++V +  L  WA+S V +R
Sbjct  205  KNSPTFEMATKHCKNIARQYAYFNNLFQN-SNDEASLILRNVFTYQLYRWAVSTVMTR  261



>ref|XP_005390472.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Chinchilla lanigera]
 ref|XP_005390473.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X5 
[Chinchilla lanigera]
 ref|XP_005390474.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X6 
[Chinchilla lanigera]
Length=593

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWLPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005333959.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Ictidomys 
tridecemlineatus]
Length=597

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010286760.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Phaethon 
lepturus]
Length=242

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  +  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFQEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANSNSFWLPYIQTLPSEYDTPLYFEEEEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_006516143.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Mus musculus]
Length=561

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  47   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  105

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  106  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  165

Query  472  YAPLLYQV  495
                ++ V
Sbjct  166  STQAIHDV  173



>ref|XP_010587146.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Loxodonta africana]
Length=604

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEVVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRHLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_003408672.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Loxodonta africana]
Length=597

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEVVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRHLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005390469.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Chinchilla lanigera]
Length=633

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  120  PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  178

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  179  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWLPYIQTLPSEYDTPLYFEEEEVRCLQ  238

Query  472  YAPLLYQV  495
                ++ V
Sbjct  239  STQAIHDV  246



>ref|XP_006516142.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Mus musculus]
Length=601

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  146  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>gb|ERE72919.1| histone-lysine N-methyltransferase setd3 [Cricetulus griseus]
Length=241

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005343587.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Microtus 
ochrogaster]
Length=577

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005438913.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Falco cherrug]
Length=593

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            PDLIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PDLIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_005230640.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Falco peregrinus]
Length=593

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            PDLIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PDLIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_009673764.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Struthio 
camelus australis]
 gb|KFV81588.1| Histone-lysine N-methyltransferase setd3 [Struthio camelus australis]
Length=593

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            PDLIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PDLIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPNEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_008823863.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Nannospalax galili]
Length=538

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  22   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  80

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  81   LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  140

Query  472  YAPLLYQV  495
                ++ +
Sbjct  141  STQAIHDI  148



>ref|NP_082538.2| histone-lysine N-methyltransferase setd3 [Mus musculus]
 sp|Q91WC0.1|SETD3_MOUSE RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=Endothelial differentiation inhibitory protein D10; 
AltName: Full=SET domain-containing protein 3 [Mus musculus]
 gb|AAH16123.1| SET domain containing 3 [Mus musculus]
 gb|AAH19973.1| Setd3 protein [Mus musculus]
 dbj|BAC27371.1| unnamed protein product [Mus musculus]
 dbj|BAE27425.1| unnamed protein product [Mus musculus]
 dbj|BAE38861.1| unnamed protein product [Mus musculus]
 gb|EDL18723.1| mCG18357, isoform CRA_a [Mus musculus]
Length=594

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>gb|EDL18726.1| mCG18357, isoform CRA_d, partial [Mus musculus]
Length=597

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  83   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  141

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  142  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  201

Query  472  YAPLLYQV  495
                ++ V
Sbjct  202  STQAIHDV  209



>ref|XP_003503762.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Cricetulus 
griseus]
 ref|XP_007629165.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Cricetulus 
griseus]
 gb|EGW10775.1| SET domain-containing protein 3 [Cricetulus griseus]
Length=577

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_004635281.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Octodon 
degus]
Length=580

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATKDIKAEELFLWVPRKLLMTVESAKNSI  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWLPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>dbj|BAB27964.1| unnamed protein product [Mus musculus]
 gb|AAS82953.1| endothelial differentiation inhibitory protein D10 [Mus musculus]
Length=594

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>gb|EDL18725.1| mCG18357, isoform CRA_c [Mus musculus]
Length=536

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_001448054.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK80657.1| unnamed protein product [Paramecium tetraurelia]
Length=581

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 86/182 (47%), Gaps = 21/182 (12%)
 Frame = +1

Query  121  LIKWVKREGGFVHPSVKI-AISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSP  297
            L++W+K  G    P +KI   SE Y  GV A   I     ++ +P+   +     + ++P
Sbjct  139  LLEWLKH-GKAQFPKIKIECYSESYR-GVNAKQKINAKELILFIPKSHMITLEMAK-ETP  195

Query  298  IPKLAQQVPEELWAMK---LGLKLLQERSRKGSFWWPYISNLPEKY-SVPIFFPGEDIKN  465
            + K   Q   +L + K   L   LLQE+SR  SFW PY+  LP+ Y S PIFF   D++ 
Sbjct  196  VAKKMIQFRLDLLSPKHSFLSTFLLQEKSRPNSFWKPYLDILPQSYPSFPIFFNNYDLEW  255

Query  466  LQYAPLLYQVNKRCRFLLEFEKFVVNELSNV--ERDHHPFEGQDVDSSALGWAMSAVSSR  639
            LQ +P L Q+N +   L    K   N++ NV  E   + F           WA    SSR
Sbjct  256  LQGSPFLKQINDKLSDL----KKDYNDICNVAPEFSQYSF-------YEFCWARMTASSR  304

Query  640  AF  645
             F
Sbjct  305  IF  306



>gb|EDL97578.1| rCG27725, isoform CRA_b [Rattus norvegicus]
Length=538

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSI  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_002726820.2| PREDICTED: histone-lysine N-methyltransferase setd3 [Rattus norvegicus]
 ref|XP_216781.6| PREDICTED: histone-lysine N-methyltransferase setd3 [Rattus norvegicus]
 gb|EDL97577.1| rCG27725, isoform CRA_a [Rattus norvegicus]
Length=596

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSI  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_003928891.2| PREDICTED: histone-lysine N-methyltransferase setd3 [Saimiri 
boliviensis boliviensis]
Length=595

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005000549.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Cavia porcellus]
 ref|XP_005000550.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Cavia porcellus]
Length=586

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSI  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEEEVQCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>gb|ACA35060.1| SET domain containing 3 isoform a (predicted), partial [Callithrix 
jacchus]
Length=597

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  82   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  140

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  141  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRYLQ  200

Query  472  YAPLLYQV  495
                ++ V
Sbjct  201  STQAVHDV  208



>ref|XP_002754318.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Callithrix 
jacchus]
Length=610

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  95   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  153

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  154  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRYLQ  213

Query  472  YAPLLYQV  495
                ++ V
Sbjct  214  STQAVHDV  221



>ref|XP_006971758.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Peromyscus 
maniculatus bairdii]
Length=579

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVDGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>sp|B0VX69.2|SETD3_CALJA RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=SET domain-containing protein 3 [Callithrix jacchus]
Length=595

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAVHDV  206



>ref|XP_005683982.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Capra 
hircus]
Length=471

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEIVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKTSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_006037453.1| PREDICTED: histone-lysine N-methyltransferase setd3-like, partial 
[Alligator sinensis]
Length=236

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            PDL+KW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  91   PDLMKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  146

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y+ P++F  ++++
Sbjct  147  NSVLASLYSQDRILQAMGNITLAFHLLCERASPNSFWLPYIQTLPSEYNTPLYFEEDEVQ  206

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  207  YLQSTQAIHDV  217



>ref|XP_008823862.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nannospalax galili]
Length=596

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ +
Sbjct  199  STQAIHDI  206



>ref|XP_004699177.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Echinops 
telfairi]
Length=591

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            P+L++W   E G      ++A  E  G G+ A+ DI      + +P  L +   + ++  
Sbjct  80   PELMRWAS-ENGASADGFEMARFEEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKSSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERTNPDSFWQPYIQTLPSEYDTPLYFEEEEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006184218.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelus 
ferus]
 ref|XP_010967070.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelus 
bactrianus]
Length=594

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPNEYDTPLYFEEDEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006409802.1| hypothetical protein EUTSA_v10017450mg [Eutrema salsugineum]
 gb|ESQ51255.1| hypothetical protein EUTSA_v10017450mg [Eutrema salsugineum]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  499  KRCRFLLEFEKFVVNELSNVERDHHPFEGQDVDSSALGWAMSAVSSRAFRLYGGK  663
            K    L EFE+ + + L +V+   HPF GQDV++SALG  MSAVS+RAF L+G K
Sbjct  49   KDSLLLPEFEQEIRSTLEDVKASDHPFSGQDVNASALGSTMSAVSTRAFHLHGDK  103



>ref|XP_007455709.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Lipotes 
vexillifer]
Length=601

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_010823267.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Bos taurus]
 ref|XP_010815631.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Bos taurus]
Length=570

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  56   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  114

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  115  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  174

Query  472  YAPLLYQV  495
                ++ V
Sbjct  175  STQAIHDV  182



>ref|XP_001925323.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Sus scrofa]
 ref|XP_005666494.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Sus scrofa]
Length=595

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASDNGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  AQ ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYAQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_009935125.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Opisthocomus 
hoazin]
 gb|KFR12537.1| Histone-lysine N-methyltransferase setd3 [Opisthocomus hoazin]
Length=593

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEEEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_007178938.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Balaenoptera acutorostrata scammoni]
Length=501

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  86   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  144

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  145  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  204

Query  472  YAPLLYQV  495
                ++ V
Sbjct  205  STQAIHDV  212



>ref|XP_010163308.1| PREDICTED: uncharacterized protein LOC104522652 [Caprimulgus 
carolinensis]
Length=480

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            PDLIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PDLIKWAT-ENGASTEGFEIAKFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_006261107.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Alligator 
mississippiensis]
Length=594

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            PDL+KW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PDLMKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y+ P++F  ++++
Sbjct  136  NSVLASLYSQDRILQAMGNITLAFHLLCERASPNSFWLPYIQTLPSEYNTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>gb|ABG67019.1| hypothetical protein LOC84193 [Bos taurus]
Length=488

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_010351976.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Rhinopithecus roxellana]
Length=296

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_007127406.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Physeter catodon]
Length=502

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_005483256.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Zonotrichia 
albicollis]
Length=593

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
            +LQ    ++ V
Sbjct  196  HLQSTQAIHDV  206



>ref|XP_010985881.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelus 
dromedarius]
Length=594

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_011939307.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Cercocebus atys]
Length=595

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006839672.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Chrysochloris 
asiatica]
Length=591

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 65/128 (51%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            P+L+KW    G  V     ++  E  G G+ A+ DI      + +P  L +   + ++  
Sbjct  80   PELMKWASENGASVEGFEMVSFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKSSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L  +LL ER+   SFW PYI +LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFQLLCERANPDSFWQPYIQSLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  CTQAIHDV  206



>ref|NP_001162549.1| histone-lysine N-methyltransferase setd3 [Papio anubis]
 sp|A9X1D0.1|SETD3_PAPAN RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=SET domain-containing protein 3 [Papio anubis]
 gb|ABY40825.1| SET domain containing 3, isoform 1 (predicted) [Papio anubis]
Length=595

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_011715339.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Macaca nemestrina]
 ref|XP_011715340.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Macaca nemestrina]
Length=603

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_009426713.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Pan troglodytes]
 dbj|BAK62099.1| SET domain containing 3 isoform a [Pan troglodytes]
Length=492

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>gb|KIJ49632.1| hypothetical protein M422DRAFT_225528 [Sphaerobolus stellatus 
SS14]
Length=492

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 10/130 (8%)
 Frame = +1

Query  130  WVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSPIP-K  306
            W K +GG VHP+V I      G G VA +DI +G+ L  LP  L L   T    S +P K
Sbjct  13   WFKSQGGNVHPAVGITSFPGMGRGAVALEDIKEGTILFTLPRSLTLSMRT----SSLPAK  68

Query  307  LAQQVPEELWAMK----LGLKLLQERS-RKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              ++  ++L   K    L L LL E S  +GS W PY+ +LP+K+  P+F+   +++ L+
Sbjct  69   FGEKEWKKLKLHKGWVGLILCLLWENSLGEGSQWEPYLKSLPDKFEAPMFWSENELQELE  128

Query  472  YAPLLYQVNK  501
               +  +V +
Sbjct  129  GTAIFDKVGR  138



>gb|EHH63882.1| hypothetical protein EGM_16943 [Macaca fascicularis]
Length=595

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_004584591.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Ochotona 
princeps]
Length=583

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 63/128 (49%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            P+L+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + ++  
Sbjct  80   PELMKWASENGASVEGFETVHFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKSSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  +++++LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPSSFWQPYIQTLPSEYDTPLYFDEDEVRHLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_009866147.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Apaloderma 
vittatum]
Length=232

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_009501524.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Phalacrocorax 
carbo]
Length=232

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_006786319.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Neolamprologus 
brichardi]
Length=641

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 2/119 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+ W K E G       +A     G G+ A+ DI      + +P  + +   + +   
Sbjct  80   PDLMSWAK-ENGASCECFTVANFGKEGYGLRATRDIKAEELFLWIPRKMLMTVESAQNSI  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNL  468
              P  +Q ++ + +  + L L LL ER+   SFW PYI +LP++Y +P+++  ED++ L
Sbjct  139  LAPLYSQDRILQAMGNVTLALHLLCERANPASFWLPYIRSLPQEYDIPLYYQQEDVQLL  197



>ref|XP_011847041.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Mandrillus 
leucophaeus]
Length=595

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|NP_001247800.1| SET domain containing 3 [Macaca mulatta]
 ref|XP_005562241.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Macaca fascicularis]
 ref|XP_011715341.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Macaca nemestrina]
 gb|EHH28163.1| hypothetical protein EGK_18532 [Macaca mulatta]
Length=595

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005000551.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Cavia porcellus]
Length=358

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSI  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  E+++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEEEVQCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_011954424.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
setd3 isoform X2 [Ovis aries]
Length=589

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006209111.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Vicugna 
pacos]
Length=594

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRCLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_011373557.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pteropus 
vampyrus]
Length=310

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVDFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010351975.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Rhinopithecus roxellana]
 ref|XP_011806876.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Colobus 
angolensis palliatus]
Length=595

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_007985990.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Chlorocebus 
sabaeus]
Length=595

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>gb|AAH66931.1| SETD3 protein [Homo sapiens]
 gb|AIC60918.1| SETD3, partial [synthetic construct]
Length=292

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|NP_954574.1| histone-lysine N-methyltransferase setd3 isoform b [Homo sapiens]
 ref|XP_008956543.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Pan paniscus]
 ref|XP_011535537.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Homo sapiens]
 emb|CAD61911.1| unnamed protein product [Homo sapiens]
 gb|AAI20968.1| SET domain containing 3 [Homo sapiens]
 gb|AAI27625.1| SET domain containing 3 [Homo sapiens]
 gb|AAI27626.1| SET domain containing 3 [Homo sapiens]
 gb|EAW81665.1| SET domain containing 3, isoform CRA_b [Homo sapiens]
 gb|AAI48252.1| SET domain containing 3 [Homo sapiens]
Length=296

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010010841.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Nestor 
notabilis]
Length=232

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_005976639.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Pantholops hodgsonii]
 ref|XP_005976640.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Pantholops hodgsonii]
Length=612

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  98   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  156

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  157  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  216

Query  472  YAPLLYQV  495
                ++ V
Sbjct  217  STQAIHDV  224



>gb|AAI20969.1| SETD3 protein [Homo sapiens]
Length=284

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005832141.1| hypothetical protein GUITHDRAFT_139093 [Guillardia theta CCMP2712]
 gb|EKX45161.1| hypothetical protein GUITHDRAFT_139093 [Guillardia theta CCMP2712]
Length=281

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 94/210 (45%), Gaps = 21/210 (10%)
 Frame = +1

Query  58   LTCAAVSATLYSS--RLATQPPDLIKWVKREGGFVHPSV---KIAISEPYGLGVVASDDI  222
            +T AA+ A + +S   +    P L  W+   GG +HPSV   +    +  GL V     +
Sbjct  5    ITTAALFAMMCTSGAMVPNSIPALQTWISSNGGSIHPSVCAKQAGDMQGVGLFVKEGKSV  64

Query  223  PKGSDLIALPEHLPLQFGTVEADSPIPKLAQQVPEELWAMK----LGLKLLQERSRKGSF  390
             +G  ++++P  L L +  V        + ++VP E W +K    L        + +G  
Sbjct  65   RRGEVMVSIPPKLHLSYEKVVGKDLNTLIDKEVPAEKWDVKLALALLSVASSASAAEGQQ  124

Query  391  WWPYISNLPEKY-SVPIFFPGEDIKNLQ--YAPLLYQVNKRCRFLLEFEKFVVNELSNVE  561
            W PY+ +LP+   ++PIF+ G  +K  +  Y  +  +V  R   L    K V + L+N  
Sbjct  125  WGPYLESLPQTLNNLPIFYKGAALKEKEETYPGISSEVVGRAALL----KTVSSSLANA-  179

Query  562  RDHHPFEGQDVDSSALGWAMSAVSSRAFRL  651
              H   EG  V    L WA    +SR+ RL
Sbjct  180  --HACLEGLSVRR--LAWAYGIATSRSVRL  205



>ref|XP_011559908.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Plutella 
xylostella]
Length=437

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = +1

Query  118  DLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADSP  297
            + +KW+  E    +  V+IA  + Y LG+ A+ D  +GS ++ +P  + +       +S 
Sbjct  88   EFLKWLS-ENEAQYEGVEIASFKGYDLGLKATKDFKEGSLMLTIPRKVMMSEQDAR-ESI  145

Query  298  IPKLAQQVP--EELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
            + K  +  P  + +  + L L LL E+S+  SFW PYI+ LPE+YS  ++F  E++  L+
Sbjct  146  LGKFIEVDPLLQNMPNITLALFLLMEKSKPDSFWAPYIAVLPERYSTILYFTPEELAELK  205

Query  472  YAPLL  486
             +P+L
Sbjct  206  PSPVL  210



>ref|XP_011968307.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Ovis aries musimon]
 ref|XP_011968308.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Ovis aries musimon]
 ref|XP_011968309.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Ovis aries musimon]
Length=594

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010160219.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Eurypyga 
helias]
Length=232

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_005695462.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Capra hircus]
Length=601

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_005506163.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Columba 
livia]
 gb|EMC87934.1| SET domain-containing protein 3 [Columba livia]
Length=593

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRRLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y+ P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYNTPLYFEEDEVR  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_005196380.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Bos taurus]
 ref|XP_005222357.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Bos taurus]
Length=594

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006925717.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pteropus 
alecto]
Length=540

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVDFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_009702461.1| PREDICTED: histone-lysine N-methyltransferase setd3-like, partial 
[Cariama cristata]
Length=234

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>gb|ELR57800.1| SET domain-containing protein 3 [Bos mutus]
Length=594

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>sp|B5FW36.1|SETD3_OTOGA RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=SET domain-containing protein 3 [Otolemur garnettii]
 gb|ACH53017.1| SET domain containing 3 isoform a (predicted) [Otolemur garnettii]
Length=595

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI +LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQSLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010849675.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
setd3 [Bison bison bison]
Length=594

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_007178937.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Balaenoptera acutorostrata scammoni]
Length=594

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006079183.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Bubalus bubalis]
Length=594

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_009247749.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Pongo abelii]
Length=296

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010823268.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Bos taurus]
 ref|XP_010815632.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Bos taurus]
Length=301

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_011535533.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Homo sapiens]
Length=649

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  135  PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  193

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  194  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  253

Query  472  YAPLLYQV  495
                ++ V
Sbjct  254  STQAIHDV  261



>ref|XP_005893779.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Bos mutus]
Length=601

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_007127405.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Physeter catodon]
Length=601

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>sp|B2KI88.1|SETD3_RHIFE RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=SET domain-containing protein 3 [Rhinolophus ferrumequinum]
 gb|ACC64548.1| SET domain containing 3 isoform a (predicted) [Rhinolophus ferrumequinum]
Length=594

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     ++  E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVSFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFGEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006079181.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Bubalus bubalis]
 ref|XP_006079182.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Bubalus bubalis]
Length=601

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_004316161.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Tursiops 
truncatus]
Length=601

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_007178936.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Balaenoptera acutorostrata scammoni]
Length=600

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  86   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  144

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  145  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  204

Query  472  YAPLLYQV  495
                ++ V
Sbjct  205  STQAIHDV  212



>ref|XP_011968306.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Ovis aries musimon]
Length=601

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_004262432.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform 2 
[Orcinus orca]
Length=594

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_004262431.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform 1 
[Orcinus orca]
Length=601

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_589822.3| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Bos taurus]
 ref|XP_002696879.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Bos taurus]
 ref|XP_010823266.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Bos taurus]
 ref|XP_010815630.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Bos taurus]
 tpg|DAA17422.1| TPA: SET domain containing 3 [Bos taurus]
Length=601

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>gb|AAI42996.1| SET domain containing 3 [Homo sapiens]
Length=594

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_006079184.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Bubalus bubalis]
Length=323

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_004434307.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Ceratotherium 
simum simum]
Length=602

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  87   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  145

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  146  LGPLYSQDRILQAMGNITLAFHLLCERADPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  205

Query  472  YAPLLYQV  495
                ++ V
Sbjct  206  STQAIHDV  213



>ref|XP_011939308.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Cercocebus atys]
Length=546

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  89   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  147

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  148  LGPLYSQDRILQAMGNIALAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  207

Query  472  YAPLLYQV  495
                ++ V
Sbjct  208  STQAIHDV  215



>ref|NP_115609.2| histone-lysine N-methyltransferase setd3 isoform a [Homo sapiens]
 ref|XP_011535534.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Homo sapiens]
 sp|Q86TU7.1|SETD3_HUMAN RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=SET domain-containing protein 3 [Homo sapiens]
 emb|CAD61927.1| unnamed protein product [Homo sapiens]
 gb|EAW81664.1| SET domain containing 3, isoform CRA_a [Homo sapiens]
 gb|EAW81666.1| SET domain containing 3, isoform CRA_a [Homo sapiens]
 gb|EAW81667.1| SET domain containing 3, isoform CRA_a [Homo sapiens]
 dbj|BAG64060.1| unnamed protein product [Homo sapiens]
 dbj|BAJ20982.1| SET domain containing 3 [synthetic construct]
Length=594

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_003832895.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Pan paniscus]
 ref|XP_003832896.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Pan paniscus]
 ref|XP_009426712.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Pan troglodytes]
Length=594

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_004055723.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Gorilla 
gorilla gorilla]
Length=594

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_004376789.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Trichechus 
manatus latirostris]
Length=595

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEVVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNITLAFHLLCERANPNSFWQPYIQTLPSEYDTPLYFDEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_010199585.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Colius 
striatus]
Length=228

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRKLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPSEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_011535535.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X4 
[Homo sapiens]
Length=536

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_005020804.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Anas platyrhynchos]
Length=310

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEA--  288
            P+LIKW   E G      +IA  E  G G+ A+ +I      + +P  L +   TVE+  
Sbjct  80   PELIKWAT-ENGASTEGFEIANFEEEGFGLKATREIKAEELFLWVPRRLLM---TVESAK  135

Query  289  DSPIPKLAQQ--VPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIK  462
            +S +  L  Q  + + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++
Sbjct  136  NSVLGSLYSQDRILQAMGNITLAFHLLCERANPNSFWLPYIQTLPNEYDTPLYFEEDEVQ  195

Query  463  NLQYAPLLYQV  495
             LQ    ++ V
Sbjct  196  YLQSTQAIHDV  206



>ref|XP_008956541.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Pan paniscus]
Length=536

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_003275417.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform 1 
[Nomascus leucogenys]
 ref|XP_003275418.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform 2 
[Nomascus leucogenys]
Length=595

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>ref|XP_002825140.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Pongo abelii]
Length=595

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



>sp|B1MTJ4.2|SETD3_CALMO RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=SET domain-containing protein 3 [Callicebus moloch]
Length=595

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  115  PDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTVEADS  294
            PDL+KW    G  V     +   E  G G+ A+ DI      + +P  L +   + +   
Sbjct  80   PDLMKWASENGASVEGFEMVNFKEE-GFGLRATRDIKAEELFLWVPRKLLMTVESAKNSV  138

Query  295  PIPKLAQ-QVPEELWAMKLGLKLLQERSRKGSFWWPYISNLPEKYSVPIFFPGEDIKNLQ  471
              P  +Q ++ + +  + L   LL ER+   SFW PYI  LP +Y  P++F  ++++ LQ
Sbjct  139  LGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQ  198

Query  472  YAPLLYQV  495
                ++ V
Sbjct  199  STQAIHDV  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1105426564043