BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5008

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB14250.1|  hypothetical protein B456_002G115900                    394   1e-132   Gossypium raimondii
gb|KHG25152.1|  Catalase isozyme 1                                      393   2e-132   Gossypium arboreum [tree cotton]
gb|ACJ11733.1|  catalase                                                392   6e-132   Gossypium hirsutum [American cotton]
ref|NP_001289779.1|  catalase isozyme 1                                 392   7e-132   Nelumbo nucifera [Indian lotus]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      392   7e-132   Fragaria vesca subsp. vesca
gb|KJB57963.1|  hypothetical protein B456_009G187600                    392   9e-132   Gossypium raimondii
ref|XP_007018034.1|  Catalase 2                                         392   1e-131   
gb|ACJ71244.1|  catalase 2                                              387   3e-131   Vigna unguiculata
gb|ACJ71245.1|  catalase 2                                              387   3e-131   Vigna unguiculata
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      388   3e-131   Nelumbo nucifera [Indian lotus]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          390   4e-131   Soldanella alpina
gb|AET97564.1|  catalase                                                390   4e-131   Ziziphus jujuba [Chinese jujube]
gb|AJE26131.1|  catalase                                                390   6e-131   Salix matsudana [tortured willow]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      390   7e-131   Nelumbo nucifera [Indian lotus]
ref|XP_007046520.1|  Catalase 2                                         389   7e-131   Theobroma cacao [chocolate]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               389   8e-131   Gossypium hirsutum [American cotton]
ref|NP_001237556.1|  catalase-1/2                                       389   9e-131   Glycine max [soybeans]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 389   1e-130   Cucumis melo [Oriental melon]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      389   1e-130   
gb|AIA61608.1|  catalase                                                389   2e-130   Gynostemma pentaphyllum [jiaogulan]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      389   2e-130   
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 389   2e-130   Populus euphratica
ref|NP_001235974.1|  catalase-3                                         389   2e-130   Glycine max [soybeans]
gb|ABF93811.1|  Catalase-1, putative, expressed                         384   2e-130   Oryza sativa Japonica Group [Japonica rice]
gb|AAR84577.1|  catalase 1b                                             387   3e-130   Lotus japonicus
gb|KJB17474.1|  hypothetical protein B456_003G002800                    386   3e-130   Gossypium raimondii
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             387   4e-130   Prunus persica
emb|CAD42908.1|  catalase                                               387   5e-130   Prunus persica
gb|KHG12976.1|  Catalase isozyme 2                                      387   5e-130   Gossypium arboreum [tree cotton]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    387   5e-130   Gossypium raimondii
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               387   5e-130   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               387   5e-130   Gossypium hirsutum [American cotton]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             387   5e-130   Phaseolus vulgaris [French bean]
ref|NP_001237571.1|  catalase-4                                         387   6e-130   Glycine max [soybeans]
ref|XP_002301920.1|  catalase family protein                            387   6e-130   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               387   6e-130   Populus deltoides
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              387   8e-130   Cicer arietinum [garbanzo]
gb|ABY21704.1|  catalase-1 precursor                                    387   8e-130   Panax ginseng [Asiatic ginseng]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      387   8e-130   Prunus mume [ume]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      387   9e-130   
gb|AAR84578.1|  catalase 1a                                             387   1e-129   Lotus japonicus
gb|EPS69543.1|  catalase                                                386   1e-129   Genlisea aurea
gb|AFU90823.1|  catalase                                                384   2e-129   Populus x beijingensis
ref|XP_002306976.2|  catalase family protein                            385   2e-129   
gb|KEH36313.1|  catalase heme-binding enzyme                            383   3e-129   Medicago truncatula
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      385   3e-129   Populus euphratica
ref|XP_002521709.1|  catalase, putative                                 385   3e-129   Ricinus communis
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           385   3e-129   
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      385   4e-129   Solanum tuberosum [potatoes]
emb|CDP07287.1|  unnamed protein product                                385   4e-129   Coffea canephora [robusta coffee]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           385   4e-129   Sesamum indicum [beniseed]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 385   4e-129   Musa acuminata subsp. malaccensis [pisang utan]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          385   5e-129   Vigna radiata var. radiata [golden gram]
gb|AAC19397.1|  leaf catalase                                           385   5e-129   Mesembryanthemum crystallinum
gb|ADZ45555.1|  catalase                                                385   5e-129   Vigna radiata [mung bean]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         385   5e-129   Oryza brachyantha
gb|AFU90822.1|  catalase                                                385   5e-129   Populus tomentosa [Chinese white poplar]
gb|ADC95629.1|  catalase                                                385   5e-129   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 385   6e-129   Phoenix dactylifera
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             382   6e-129   
gb|ADZ45556.1|  catalase                                                384   6e-129   Vigna radiata [mung bean]
gb|ABK24453.1|  unknown                                                 384   7e-129   Picea sitchensis
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      384   7e-129   Cucumis melo [Oriental melon]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      384   8e-129   Vitis vinifera
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      384   9e-129   Nicotiana tomentosiformis
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      384   9e-129   Elaeis guineensis
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         384   9e-129   Tarenaya hassleriana [spider flower]
tpg|DAA43177.1|  TPA: catalase2                                         384   1e-128   
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         384   1e-128   Tarenaya hassleriana [spider flower]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             382   1e-128   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                384   1e-128   Erythranthe guttata [common monkey flower]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      384   1e-128   Nicotiana sylvestris
ref|NP_001240021.1|  catalase                                           384   1e-128   Glycine max [soybeans]
ref|NP_001291326.1|  catalase isozyme 1                                 384   1e-128   Sesamum indicum [beniseed]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    384   1e-128   
gb|AAF19965.1|AF207906_1  catalase 1                                    384   1e-128   Zantedeschia aethiopica [arum-lily]
ref|XP_010530333.1|  PREDICTED: catalase-2                              384   1e-128   Tarenaya hassleriana [spider flower]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             384   2e-128   Phaseolus vulgaris [French bean]
gb|AGV54297.1|  peroxisomal catalase                                    383   2e-128   Phaseolus vulgaris [French bean]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      383   2e-128   Phoenix dactylifera
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                383   3e-128   Erythranthe guttata [common monkey flower]
ref|NP_001048861.1|  Os03g0131200                                       383   3e-128   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     382   3e-128   Eucalyptus grandis [rose gum]
gb|KEH36312.1|  catalase heme-binding enzyme                            383   3e-128   Medicago truncatula
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             383   3e-128   Populus trichocarpa [western balsam poplar]
gb|AAX88799.1|  catalase                                                383   3e-128   Euphorbia characias
tpg|DAA43178.1|  TPA: catalase2                                         384   4e-128   
ref|XP_011654267.1|  PREDICTED: catalase isozyme 1                      382   5e-128   Cucumis sativus [cucumbers]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             383   7e-128   
gb|ACB11496.1|  catalase                                                382   7e-128   Pinus sylvestris [Scotch pine]
dbj|BAJ90861.1|  predicted protein                                      382   7e-128   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001234186.1|  catalase isozyme 2                                 382   7e-128   
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              382   8e-128   Populus euphratica
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 382   9e-128   Solanum tuberosum [potatoes]
dbj|BAH37035.1|  catalase 1                                             382   1e-127   Pisum sativum [garden pea]
gb|AAM97542.1|  catalase 3                                              381   1e-127   Capsicum annuum
ref|XP_003558892.1|  PREDICTED: catalase-1                              381   1e-127   Brachypodium distachyon [annual false brome]
gb|AFD29285.1|  catalase                                                381   1e-127   Vicia faba [broad bean]
gb|AAO17721.1|  catalase                                                381   1e-127   Hypericum perforatum
gb|ACL35349.1|  catalase                                                381   1e-127   Picea glauca
ref|XP_010094556.1|  Catalase isozyme 1                                 381   2e-127   Morus notabilis
ref|NP_001031791.1|  catalase 2                                         380   2e-127   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19523.1|  AT4G35090                                              380   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             381   2e-127   
ref|NP_195235.1|  catalase 2                                            380   2e-127   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64220.1|  catalase                                               380   2e-127   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72514.1|  BnaC07g45360D                                          380   2e-127   
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      380   2e-127   Solanum lycopersicum
gb|AAK96854.1|  catalase                                                380   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061175.1|  PREDICTED: catalase-like                           380   3e-127   Eucalyptus grandis [rose gum]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      380   3e-127   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD17935.1|  catalase                                                380   3e-127   Brassica juncea [brown mustard]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             380   3e-127   Eutrema salsugineum [saltwater cress]
gb|ACL27272.1|  catalase                                                380   3e-127   Nicotiana benthamiana
gb|AAF71742.1|AF248491_1  catalase                                      380   4e-127   Raphanus sativus
ref|XP_009138342.1|  PREDICTED: catalase-2                              380   4e-127   Brassica rapa
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      380   4e-127   Elaeis guineensis
gb|AIZ77475.1|  catalase                                                380   4e-127   Triticum aestivum [Canadian hard winter wheat]
dbj|BAA34205.1|  catalase                                               380   4e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             380   5e-127   Eutrema salsugineum [saltwater cress]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      380   5e-127   Nicotiana sylvestris
gb|KFK30147.1|  catalase                                                380   5e-127   Arabis alpina [alpine rockcress]
gb|AIS20825.1|  CAT                                                     380   5e-127   Pyrus x bretschneideri [bai li]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    380   5e-127   Arabis alpina [alpine rockcress]
dbj|BAJ33995.1|  unnamed protein product                                380   5e-127   Eutrema halophilum
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       377   5e-127   Cucumis sativus [cucumbers]
gb|AAD17933.1|  catalase                                                380   5e-127   Brassica juncea [brown mustard]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             380   6e-127   Eutrema salsugineum [saltwater cress]
emb|CCP37650.1|  catalase-1                                             379   6e-127   Nicotiana tabacum [American tobacco]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      379   6e-127   Phoenix dactylifera
ref|XP_006828715.1|  PREDICTED: catalase-1/2                            379   7e-127   Amborella trichopoda
gb|AFN81243.1|  catalase 1                                              379   7e-127   Brassica rapa subsp. pekinensis [bai cai]
gb|AAB71764.1|  catalase 1                                              379   7e-127   Nicotiana tabacum [American tobacco]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     382   8e-127   Eucalyptus grandis [rose gum]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         379   8e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              379   9e-127   Camelina sativa [gold-of-pleasure]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       379   1e-126   Triticum aestivum [Canadian hard winter wheat]
dbj|BAA34714.1|  catalase                                               379   1e-126   Oryza sativa [red rice]
emb|CDY01363.1|  BnaA07g11360D                                          379   1e-126   
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         379   2e-126   Camelina sativa [gold-of-pleasure]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             378   2e-126   Capsella rubella
gb|AGI65617.1|  catalase                                                377   2e-126   Fragaria x ananassa
emb|CDP01803.1|  unnamed protein product                                378   2e-126   Coffea canephora [robusta coffee]
gb|AHA50082.1|  catalase                                                378   2e-126   Eleutherococcus senticosus
ref|XP_009103333.1|  PREDICTED: catalase-1                              378   2e-126   Brassica rapa
emb|CDY31877.1|  BnaC07g15270D                                          378   2e-126   Brassica napus [oilseed rape]
ref|XP_011654421.1|  PREDICTED: catalase isozyme 1-like                 376   2e-126   Cucumis sativus [cucumbers]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 378   3e-126   Elaeis guineensis
ref|XP_012065377.1|  PREDICTED: catalase-2                              378   3e-126   Jatropha curcas
gb|AFU48609.1|  catalase 1                                              377   3e-126   Nicotiana benthamiana
gb|ACA50528.1|  putative catalase 2                                     377   5e-126   Brassica napus [oilseed rape]
gb|ADU56199.1|  catalase                                                377   5e-126   Hevea brasiliensis [jebe]
ref|XP_010692546.1|  PREDICTED: catalase                                377   5e-126   Beta vulgaris subsp. vulgaris [field beet]
gb|AAD17936.1|  catalase                                                377   5e-126   Brassica juncea [brown mustard]
gb|ACV92695.1|  catalase                                                377   6e-126   Brassica oleracea
gb|ACH63223.1|  catalase                                                377   6e-126   Rheum australe [Himalayan rhubarb]
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              377   6e-126   Brassica rapa
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            377   6e-126   Pisum sativum [garden pea]
gb|AHB72694.1|  catalase                                                377   9e-126   Beta vulgaris subsp. maritima [sea beet]
emb|CAG23920.1|  catalase                                               376   9e-126   Festuca arundinacea [tall fescue]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              376   1e-125   
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             376   1e-125   Citrus clementina [clementine]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      376   1e-125   Nicotiana tomentosiformis
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      376   1e-125   Citrus sinensis [apfelsine]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          376   1e-125   Helianthus annuus
prf||1803522A  catalase                                                 376   1e-125
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              375   1e-125   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               376   2e-125   Zea mays [maize]
gb|AAK67359.2|AF390210_1  catalase                                      376   2e-125   Suaeda salsa
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              376   2e-125   
emb|CDX69111.1|  BnaC01g03420D                                          375   2e-125   
gb|AAF61732.1|AF243517_1  catalase 2                                    375   3e-125   Helianthus annuus
prf||1906388A  catalase                                                 375   3e-125
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         375   4e-125   Setaria italica
prf||2104177A  catalase                                                 374   6e-125
gb|AIP93616.1|  CAT1                                                    374   7e-125   Bassia scoparia [burning bush]
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             374   9e-125   Selaginella moellendorffii
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          374   1e-124   
ref|XP_010477308.1|  PREDICTED: catalase-1                              374   1e-124   Camelina sativa [gold-of-pleasure]
gb|AIU99488.1|  catalase                                                374   1e-124   Saccharum hybrid cultivar ROC22
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               374   1e-124   Ricinus communis
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         374   1e-124   Camelina sativa [gold-of-pleasure]
ref|NP_001241808.1|  catalase isozyme B                                 373   2e-124   Zea mays [maize]
gb|AAB86582.2|  catalase                                                373   2e-124   Raphanus sativus
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               373   2e-124   Zea mays [maize]
ref|NP_564121.1|  catalase 1                                            373   2e-124   Arabidopsis thaliana [mouse-ear cress]
gb|AAC17731.1|  catalase 1                                              373   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105415.1|  catalase isozyme 1                                 373   2e-124   
gb|AIM43584.1|  catalase                                                373   2e-124   Saccharum hybrid cultivar Yacheng05-179
emb|CAA45564.1|  catalase                                               373   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012073648.1|  PREDICTED: catalase isozyme 1                      373   2e-124   Jatropha curcas
gb|AIU99486.1|  catalase                                                373   3e-124   Saccharum spontaneum [fodder cane]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             372   3e-124   
ref|XP_009106100.1|  PREDICTED: catalase-2                              373   3e-124   Brassica rapa
ref|NP_001105310.1|  catalase isozyme 2                                 372   3e-124   
gb|AIU99480.1|  catalase                                                372   3e-124   Saccharum spontaneum [fodder cane]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 372   3e-124   Oryza brachyantha
gb|AIU99481.1|  catalase                                                372   4e-124   Saccharum spontaneum [fodder cane]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 372   4e-124   Nicotiana sylvestris
gb|AIU99487.1|  catalase                                                372   6e-124   Saccharum hybrid cultivar ROC22
gb|AIU99479.1|  catalase                                                372   6e-124   Saccharum arundinaceum
emb|CAA42720.1|  catalase-1                                             372   7e-124   Zea mays [maize]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               372   7e-124   Cucurbita pepo
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 372   8e-124   Nicotiana tomentosiformis
gb|AAB07026.1|  catalase 1                                              371   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         371   2e-123   Camelina sativa [gold-of-pleasure]
ref|NP_001058635.1|  Os06g0727200                                       370   2e-123   
gb|AAB62892.1|  catalase-1                                              370   2e-123   Nicotiana glutinosa
dbj|BAJ88747.1|  predicted protein                                      372   2e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    370   2e-123   Oryza sativa Indica Group [Indian rice]
gb|AGE15298.2|  catalase 1                                              370   2e-123   Eriobotrya japonica [loquat]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              371   2e-123   Populus euphratica
gb|AGC65520.1|  catalase                                                370   3e-123   Eriobotrya japonica [loquat]
emb|CDX76313.1|  BnaA08g10870D                                          370   3e-123   
emb|CDY17510.1|  BnaC03g65530D                                          369   4e-123   Brassica napus [oilseed rape]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 371   5e-123   
gb|AIU99484.1|  catalase                                                369   6e-123   Saccharum arundinaceum
dbj|BAA34204.1|  catalase                                               369   8e-123   Oryza sativa Japonica Group [Japonica rice]
gb|AIU99483.1|  catalase                                                369   8e-123   Saccharum hybrid cultivar ROC22
gb|AIU99482.1|  catalase                                                368   2e-122   Saccharum hybrid cultivar ROC22
gb|ABM47415.1|  catalase                                                368   2e-122   Prunus avium [gean]
emb|CDY29518.1|  BnaA06g14520D                                          368   2e-122   Brassica napus [oilseed rape]
gb|AAY59707.1|  catalase                                                368   2e-122   Oryza sativa Indica Group [Indian rice]
ref|XP_009149540.1|  PREDICTED: catalase-1                              368   2e-122   Brassica rapa
emb|CDY31490.1|  BnaC05g15990D                                          368   2e-122   Brassica napus [oilseed rape]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      367   3e-122   Brachypodium distachyon [annual false brome]
gb|AAP80622.1|AF475100_1  catalase isozyme                              359   3e-122   Triticum aestivum [Canadian hard winter wheat]
gb|AAM97541.1|  catalase 2                                              367   3e-122   Capsicum annuum
gb|AIU99485.1|  catalase                                                367   6e-122   Saccharum spontaneum [fodder cane]
emb|CDY52649.1|  BnaAnng11640D                                          365   6e-122   Brassica napus [oilseed rape]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               366   1e-121   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               365   2e-121   Hordeum vulgare [barley]
dbj|BAA05494.1|  catalase                                               365   2e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752315.1|  predicted protein                                  365   3e-121   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      365   3e-121   
ref|XP_001784759.1|  predicted protein                                  364   4e-121   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             364   8e-121   
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 363   9e-121   Prunus mume [ume]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             363   1e-120   Prunus persica
emb|CAD42909.1|  catalase                                               363   1e-120   Prunus persica
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         363   2e-120   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 361   2e-120   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 361   3e-120   
gb|AAG43363.1|AF151368_1  catalase                                      362   3e-120   Hevea brasiliensis [jebe]
gb|ADN94253.1|  catalase                                                362   5e-120   Puccinellia chinampoensis
gb|AAB70006.1|  catalase                                                362   5e-120   Chlamydomonas reinhardtii
gb|EMS61345.1|  Catalase isozyme 1                                      366   6e-120   Triticum urartu
ref|XP_001696763.1|  catalase/peroxidase                                361   8e-120   Chlamydomonas reinhardtii
gb|AII23739.1|  catalase                                                360   9e-120   Zostera marina
emb|CDP07288.1|  unnamed protein product                                360   2e-119   Coffea canephora [robusta coffee]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 360   2e-119   Eucalyptus grandis [rose gum]
gb|EMT05040.1|  Catalase-1                                              361   3e-119   
emb|CDY40645.1|  BnaA03g53180D                                          358   1e-118   Brassica napus [oilseed rape]
gb|AAR14052.2|  catalase                                                357   3e-118   Solanum tuberosum [potatoes]
emb|CAA73663.1|  catalase                                               357   4e-118   Chlamydomonas reinhardtii
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     354   4e-118   Eucalyptus grandis [rose gum]
gb|AIX10947.1|  putative catalase                                       357   4e-118   Gardenia jasminoides
gb|AHF21552.1|  catalase                                                357   5e-118   Hylocereus undatus [dragon fruit]
gb|ABK41476.1|  catalase                                                356   9e-118   Haematococcus lacustris
ref|XP_005645077.1|  catalase                                           356   1e-117   Coccomyxa subellipsoidea C-169
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      355   3e-117   Eucalyptus grandis [rose gum]
dbj|BAC79443.1|  catalase                                               354   4e-117   Acacia ampliceps
ref|NP_001268098.1|  catalase                                           354   6e-117   Vitis vinifera
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 354   7e-117   Vitis vinifera
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      353   1e-116   
ref|XP_011396830.1|  Catalase isozyme 2                                 353   1e-116   Auxenochlorella protothecoides
ref|XP_012073649.1|  PREDICTED: catalase isozyme 2                      353   2e-116   
ref|XP_002950455.1|  catalase                                           352   3e-116   Volvox carteri f. nagariensis
gb|AAF61734.1|AF243519_1  catalase 4                                    352   4e-116   Helianthus annuus
gb|AAC84138.1|  catalase                                                341   4e-116   Cichorium intybus [radicchio]
gb|AAF79625.1|AC027665_26  F5M15.5                                      365   1e-115   Arabidopsis thaliana [mouse-ear cress]
dbj|BAQ21275.1|  catalase                                               349   3e-115   Citrus tamurana
gb|AAD50974.1|AF170272_1  catalase CAT1                                 350   3e-115   Manihot esculenta [manioc]
ref|XP_006828714.1|  PREDICTED: catalase-1/2                            350   3e-115   Amborella trichopoda
ref|XP_002890395.1|  F5M15.5                                            363   3e-115   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             349   4e-115   
ref|XP_002510677.1|  catalase, putative                                 362   4e-115   
gb|AAF61733.1|AF243518_1  catalase 3                                    349   5e-115   Helianthus annuus
emb|CAE82295.1|  catalase                                               345   2e-113   Homogyne alpina
gb|ABB88582.1|  catalase                                                345   3e-113   
gb|AKA94107.1|  catalase                                                343   1e-112   
gb|ABV55108.1|  catalase 2                                              342   2e-112   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      342   2e-112   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 341   4e-112   
gb|ADB03784.1|  catalase                                                341   5e-112   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      341   5e-112   
gb|ADU56198.1|  catalase                                                341   6e-112   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      341   6e-112   
gb|ADQ28492.1|  catalase                                                341   7e-112   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      342   7e-112   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 340   1e-111   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               340   1e-111   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          340   2e-111   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      340   2e-111   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         339   3e-111   
gb|AFR53082.1|  CAT                                                     338   6e-111   
gb|ACJ76836.3|  catalase                                                337   2e-110   
ref|XP_004144240.2|  PREDICTED: catalase isozyme 3                      336   4e-110   
gb|KDD77132.1|  catalase                                                337   4e-110   
gb|AAC19398.1|  root catalase                                           336   8e-110   
gb|AHF27433.1|  catalase                                                335   9e-110   
gb|ABK24543.1|  unknown                                                 335   2e-109   
gb|AHF27430.1|  catalase                                                335   2e-109   
gb|ADM96039.1|  catalase                                                335   2e-109   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      334   4e-109   
gb|ABK24449.1|  unknown                                                 333   6e-109   
gb|ABB51561.1|  truncated catalase 2                                    331   6e-109   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               333   6e-109   
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             330   1e-108   
gb|ACL81498.1|  catalase                                                332   1e-108   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             332   2e-108   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    332   3e-108   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          332   3e-108   
ref|NP_973873.1|  catalase 3                                            329   4e-108   
emb|CDY29519.1|  BnaA06g14510D                                          330   9e-108   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               330   9e-108   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               330   1e-107   
gb|AAG61140.2|AF332973_1  catalase 2                                    330   1e-107   
gb|AAD30291.2|AF139538_1  catalase 2                                    330   1e-107   
gb|AAM65021.1|  unknown                                                 330   2e-107   
gb|AAD30292.1|AF139539_1  catalase 3                                    330   2e-107   
ref|NP_001031073.1|  catalase 3                                         329   2e-107   
ref|XP_009149539.1|  PREDICTED: catalase-3                              331   2e-107   
ref|NP_564120.1|  catalase 3                                            330   2e-107   
emb|CDY33636.1|  BnaC08g19360D                                          330   2e-107   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         330   2e-107   
ref|XP_009110221.1|  PREDICTED: catalase-3                              330   2e-107   
gb|ABN71233.2|  catalase                                                329   2e-107   
emb|CDY31878.1|  BnaC07g15280D                                          329   2e-107   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             327   2e-107   
dbj|BAH56915.1|  AT1G20620                                              329   2e-107   
ref|NP_001045673.1|  Os02g0115700                                       329   2e-107   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           329   3e-107
emb|CDY01364.1|  BnaA07g11370D                                          331   3e-107   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    328   4e-107   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               328   5e-107   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          329   5e-107
ref|NP_001274863.1|  catalase isozyme 1                                 328   6e-107   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             328   6e-107   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          328   7e-107   
ref|NP_001234827.1|  catalase isozyme 1                                 328   8e-107   
emb|CAH61266.1|  catalase                                               328   8e-107   
dbj|BAJ92414.1|  predicted protein                                      328   8e-107   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               328   1e-106   
gb|ADY02963.1|  catalase                                                328   1e-106   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               327   1e-106   
gb|AGT16310.1|  catalase                                                327   2e-106   
gb|AEQ30070.1|  catalase                                                327   2e-106   
gb|ABC01913.1|  catalase isozyme 1-like protein                         327   2e-106   
ref|XP_010692544.1|  PREDICTED: catalase-like                           327   3e-106   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      327   3e-106   
gb|AAR97905.1|  catalase                                                327   3e-106   
emb|CAA43814.1|  catalase                                               327   3e-106   
gb|AFW66787.1|  catalase3                                               327   3e-106   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    326   4e-106   
emb|CAA85470.1|  catalase                                               326   4e-106   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      326   4e-106   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      326   4e-106   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      326   6e-106   
gb|AHZ13843.1|  catalase                                                326   6e-106   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      326   8e-106   
gb|AFW66788.1|  catalase3                                               325   1e-105   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    325   1e-105   
dbj|BAF91369.1|  catalase                                               323   4e-105   
gb|AAC49807.1|  catalase 3                                              323   4e-105   
ref|XP_010498496.1|  PREDICTED: catalase-3                              323   4e-105   
gb|ABB72796.1|  catalase isozyme 1-like protein                         323   6e-105   
gb|AAC48918.1|  salicylic acid binding catalase                         323   6e-105   
gb|AHG98056.1|  catalase                                                316   1e-104   
gb|EMS51034.1|  Catalase isozyme 2                                      322   2e-104   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              321   2e-104   
gb|AFW66785.1|  catalase3 isoform 1                                     328   2e-104   
gb|AJF34884.1|  catalase                                                322   3e-104   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          322   4e-104   
gb|AGT16203.1|  catalase                                                320   1e-103   
gb|AGT16054.1|  catalase                                                320   1e-103   
gb|AGT16188.1|  catalase                                                320   2e-103   
emb|CDY31488.1|  BnaC05g15970D                                          319   3e-103   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               318   4e-103   
gb|AGT15888.1|  catalase                                                318   8e-103   
gb|EMT06167.1|  Catalase isozyme 2                                      322   2e-102   
ref|XP_001779509.1|  predicted protein                                  316   3e-102   
gb|ADI58890.1|  catalase                                                302   4e-101   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        313   9e-101   
ref|NP_001105416.1|  catalase isozyme 3                                 312   1e-100   
ref|XP_011022275.1|  PREDICTED: catalase-like                           311   1e-100   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                310   3e-100   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   312   3e-99    
emb|CBI29557.3|  unnamed protein product                                295   2e-98    
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     306   5e-98    
ref|XP_005708279.1|  catalase                                           301   2e-96    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          300   6e-96    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          288   2e-91    
ref|XP_005536240.1|  catalase                                           285   4e-90    
gb|AAL38024.1|AF443179_1  catalase                                      276   5e-90    
gb|AHF27432.1|  catalase                                                283   1e-89    
gb|AHF27429.1|  catalase                                                281   6e-89    
gb|ADR01107.1|  catalase 3                                              276   6e-88    
dbj|BAH20307.1|  AT1G20620                                              277   3e-87    
gb|ACJ71242.1|  catalase 1                                              267   2e-86    
gb|KHG11966.1|  Catalase isozyme 2                                      270   2e-86    
gb|AAD37788.1|AF149283_1  catalase 1                                    272   8e-86    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    272   9e-86    
gb|AII80275.1|  catalase                                                267   2e-85    
gb|ADU56189.1|  catalase 1                                              260   9e-85    
gb|ABR16304.1|  unknown                                                 271   9e-85    
gb|AEG89525.1|  catalase                                                262   7e-83    
gb|AIR77003.1|  catalase                                                259   1e-82    
gb|AEB22071.1|  catalase 2                                              254   2e-82    
emb|CAB16750.1|  catalase                                               258   3e-82    
ref|XP_005647994.1|  catalase-domain-containing protein                 261   9e-81    
ref|XP_005642928.1|  catalase                                           260   2e-80    
gb|ACJ71243.1|  catalase 2                                              248   2e-79    
ref|XP_005644653.1|  catalase-domain-containing protein                 259   3e-79    
ref|XP_006380544.1|  hypothetical protein POPTR_0007s08910g             250   3e-79    
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             247   4e-79    
emb|CAC37634.1|  catalase 1                                             249   9e-79    
gb|AAO12509.1|  catalase                                                243   2e-77    
gb|AEQ94083.1|  putative catalase                                       244   1e-76    
dbj|GAE06714.1|  catalase                                               242   2e-76    
ref|XP_005712277.1|  unnamed protein product                            249   4e-76    
emb|CAP74531.1|  putative Td650 protein                                 241   9e-76    
ref|WP_040574212.1|  catalase                                           248   9e-76    
gb|EJF09706.1|  catalase                                                248   1e-75    
emb|CDP01802.1|  unnamed protein product                                246   2e-75    
ref|WP_036667842.1|  catalase                                           247   2e-75    
ref|WP_036612802.1|  catalase                                           246   4e-75    
ref|WP_024632816.1|  MULTISPECIES: catalase                             246   6e-75    
ref|WP_015737807.1|  catalase                                           245   7e-75    
ref|WP_034700019.1|  catalase                                           246   7e-75    
ref|WP_036662024.1|  catalase                                           245   7e-75    
ref|WP_009590324.1|  catalase                                           245   9e-75    
ref|WP_006207005.1|  catalase                                           245   1e-74    
ref|WP_002617638.1|  catalase                                           246   1e-74    
ref|WP_036640075.1|  catalase                                           245   1e-74    
ref|WP_018976489.1|  catalase                                           245   1e-74    
ref|WP_017691823.1|  catalase                                           244   2e-74    
ref|WP_025606320.1|  catalase                                           245   2e-74    
emb|CDW92180.1|  putative catalase                                      238   2e-74    
ref|WP_045670628.1|  catalase                                           244   3e-74    
ref|WP_028402967.1|  catalase                                           244   3e-74    
ref|WP_035405433.1|  catalase                                           244   3e-74    
emb|CDW92181.1|  putative catalase                                      237   5e-74    
ref|WP_002978792.1|  catalase                                           243   7e-74    
ref|WP_044186614.1|  catalase                                           243   1e-73    
ref|WP_043068684.1|  catalase                                           242   2e-73    
ref|WP_011983963.1|  catalase                                           242   2e-73    
ref|WP_035957730.1|  catalase                                           243   2e-73    
ref|WP_007128851.1|  catalase                                           241   3e-73    
ref|WP_028404102.1|  catalase                                           241   5e-73    
ref|WP_026975362.1|  catalase                                           241   5e-73    
ref|WP_002162341.1|  catalase                                           240   6e-73    
ref|WP_034663722.1|  catalase                                           240   7e-73    
ref|WP_037289104.1|  catalase                                           240   8e-73    
gb|AAS40190.1|  catalase                                                239   8e-73    
ref|WP_043072359.1|  catalase                                           240   8e-73    
ref|WP_044333630.1|  catalase                                           240   8e-73    
ref|WP_003211348.1|  catalase                                           240   8e-73    
ref|WP_002638677.1|  catalase                                           241   9e-73    
ref|WP_024425295.1|  MULTISPECIES: catalase                             240   1e-72    
ref|WP_012009409.1|  catalase                                           240   1e-72    
ref|WP_041109904.1|  catalase                                           240   1e-72    
ref|WP_041089594.1|  catalase                                           240   1e-72    
ref|WP_034282264.1|  catalase                                           240   1e-72    
ref|WP_024426596.1|  catalase                                           240   1e-72    
ref|WP_035435964.1|  catalase                                           240   1e-72    
ref|WP_001069185.1|  catalase                                           240   1e-72    
ref|WP_001069175.1|  catalase                                           240   1e-72    
ref|WP_039177466.1|  catalase                                           240   1e-72    
ref|WP_001069181.1|  MULTISPECIES: catalase                             239   1e-72    
ref|WP_000184219.1|  catalase                                           239   1e-72    
ref|WP_008359888.1|  catalase                                           239   1e-72    
ref|WP_001069180.1|  MULTISPECIES: catalase                             239   2e-72    
ref|WP_038413367.1|  catalase                                           239   2e-72    
ref|WP_001069170.1|  catalase                                           239   2e-72    
ref|WP_002194469.1|  catalase                                           239   2e-72    
ref|WP_001069173.1|  catalase                                           239   2e-72    
ref|WP_024719958.1|  MULTISPECIES: catalase                             239   2e-72    
ref|WP_000184218.1|  catalase                                           239   2e-72    
ref|WP_001069169.1|  MULTISPECIES: catalase                             239   2e-72    
ref|WP_029279140.1|  catalase                                           240   2e-72    
ref|WP_001069174.1|  catalase                                           239   2e-72    
ref|WP_041091807.1|  catalase                                           239   2e-72    
ref|WP_001069172.1|  catalase                                           239   2e-72    
ref|WP_045034838.1|  catalase                                           239   2e-72    
ref|WP_008348997.1|  MULTISPECIES: catalase                             239   2e-72    
ref|WP_035703421.1|  catalase                                           239   2e-72    
ref|WP_001069171.1|  catalase                                           239   2e-72    
ref|WP_038700758.1|  catalase                                           239   2e-72    
ref|WP_031412803.1|  catalase                                           239   2e-72    
ref|WP_001069178.1|  catalase                                           239   2e-72    
ref|WP_016088914.1|  catalase                                           239   2e-72    
ref|WP_001069177.1|  MULTISPECIES: catalase                             239   2e-72    
ref|WP_001069176.1|  catalase                                           239   2e-72    
ref|WP_016122096.1|  catalase                                           239   2e-72    
ref|WP_007497088.1|  catalase                                           239   2e-72    
ref|WP_001069179.1|  MULTISPECIES: catalase                             239   2e-72    
ref|WP_006266515.1|  catalase                                           239   2e-72    
ref|WP_032086373.1|  catalase                                           239   2e-72    
ref|WP_006263075.1|  catalase                                           239   2e-72    



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/191 (99%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/191 (98%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVI+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/191 (98%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISH+TCADFLRAPGVQTPVI+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   392 bits (1007),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 187/191 (98%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPS+AF SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   392 bits (1007),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+ SPFWTTNSGAPVWNNNSSLT+G RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   392 bits (1006),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 187/191 (98%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/191 (98%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   387 bits (994),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   387 bits (994),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   388 bits (997),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 191/191 (100%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFW+TNSGAPVWNNNSSLTVGTRGPI+LEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   390 bits (1002),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/191 (97%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+R SSAF++PFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   390 bits (1002),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SP+WTTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   390 bits (1001),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAFS+P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 191/191 (100%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFW+TNSGAPVWNNNSSLTVGTRGPI+LEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   389 bits (1000),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 186/191 (97%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPV+NNNSSL+VG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   389 bits (1000),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 187/191 (98%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RG  LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   389 bits (1000),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 191/191 (100%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA+++PFWTTNSGAPVWNNNS+LT+G+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLLD  191



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 191/191 (100%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFP FF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLLD  191



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAFS+P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 191/191 (100%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   384 bits (987),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWRILDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   387 bits (993),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   387 bits (995),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPFWTTNSGAPVWNNNSS+TVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 191/191 (100%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPS+AF+SPFWTTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   387 bits (994),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   387 bits (994),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF +P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   387 bits (994),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF +P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   387 bits (993),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+ DGMKFPDMVHALKPNPKSHIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   387 bits (993),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF+S +WTTNSGAPVWNNNSSLTVGTRGPILLEDY LVEK+ANFDRERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   387 bits (993),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   387 bits (993),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL CADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFP FF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLLD  191



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTNSGAPVWNNN SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLT ADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNP+SHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPRSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  72   DPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPE  251
            DPYK+RPSSAF +P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  252  RVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  431
            RVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  432  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  611
            FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  612  SLHMFTFLFD  641
            SLHMF+FLFD
Sbjct  181  SLHMFSFLFD  190



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SP+WTTNSGA VWNNNSSLTVG+RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+L+CADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   383 bits (984),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA++SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+ DGM FPDMVHALKPNPKSHIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SP+WTTNSGA VWNNNSSLTVG+RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+L+CADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA++SPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTH+ISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPS AF+SPF TTNSGAPVWNNN SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNNSSLTVG RGP+LLEDYHLVEKLANFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP K+RPSSAF+SPFWTTNSGA VWNNNSSLTVGTRGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPS AF+SPF TTNSGAPVWNNN SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS ++SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 191/191 (100%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SP++TTNSGAPV+NNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +3

Query  72   DPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPE  251
            DPYK+RPSSAF +P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  252  RVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  431
            RVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  432  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  611
            FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  612  SLHMFTFLFD  641
            SLHMF+FLFD
Sbjct  181  SLHMFSFLFD  190



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWT NSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   385 bits (988),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVT+D+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDG+KFPDMVH+LKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   382 bits (982),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FL D
Sbjct  181  ESLHMFSFLLD  191



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   384 bits (987),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   384 bits (987),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA++SPFWTTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEK+A FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCAD LRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   384 bits (987),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSS +++PFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   384 bits (987),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFE THDIS+LTCADFLRAPGVQTPVI+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   384 bits (987),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPF TTNSGAPVWNNNSS+TVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   384 bits (987),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDG+KFPDMVH+LKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   384 bits (986),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF++P+WTTNSGAPVWNN+SSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA SSPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHER SPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FL D
Sbjct  181  ESLHMFSFLLD  191



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPF TTNSGAPVWNNNSS+TVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP+K+RPSSAF++ FWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSAF+SPFWTTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDG+KFPDMVHALKPNPK+HIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+ +SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPV+NNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPV+NNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLR PGVQTPVIVRFSTVIHERGSPE++RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWRILDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   382 bits (982),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP+K+RPSSAF++ FWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA++SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+ DGM FPDMVHALKPNPKSHIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FL D
Sbjct  181  ESLHMFSFLLD  191



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA++S F+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFF+VTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   384 bits (986),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF++P+WTTNSGAPVWNN+SSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_011654267.1| PREDICTED: catalase isozyme 1 [Cucumis sativus]
 gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSS +++PFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   383 bits (983),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FL D
Sbjct  181  ESLHMFSFLLD  191



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTN+GAPVWNNNSSLT+G+RGPILLEDYHLVEK+A FDRER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRA GVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+SP W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   382 bits (980),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHE GSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   382 bits (980),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPF TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   382 bits (980),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA +SP+WTTNSGAPV+NNNSSLTVG RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNN++SLTVG RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPV++N+ SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQE+WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA++SPFWTTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEK+A FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCAD LRAPGVQTP+IVRFSTVIHERGSPET RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETPRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDG+KFPDMVHALKPNPKSHIQE WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQEFWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPF TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   380 bits (977),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA  S FWTTNSGAPVWNNN+SLTVGTRGP+LLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS ++SPFWTTNSGAPVWNNN+S+TVG+RGPILLEDYHLVEK+A FDRERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSA  SPF+TTNSGAPVWNNNSSL+VGTRGPILLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVI RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGPILLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   380 bits (976),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   380 bits (976),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSS  ++PFWTTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+F++P W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRILDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
             FA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWRILDFFSHHP
Sbjct  121  VFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPV NNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHE GSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLSD  191



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +3

Query  78   YKH-RPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPER  254
            Y H RPSSAF +PFWTTNSGAPVWNNNS+LT+G+RGPILLEDYHLVEKLANFDRERIPER
Sbjct  2    YSHQRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPER  61

Query  255  VVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGF  434
            VVHARGASAKGFFEVTHDI+HLTCADFLRAPG QTPVIVRFSTVIHERGSPETLRDPRGF
Sbjct  62   VVHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPETLRDPRGF  121

Query  435  AVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPES  614
            AVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPES
Sbjct  122  AVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPES  181

Query  615  LHMFTFLFD  641
            LHMFTFLFD
Sbjct  182  LHMFTFLFD  190



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   380 bits (977),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   379 bits (974),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   379 bits (973),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  ++PFWTTNSGAPVWNNNSSLTVG+RGP+ LEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDG+KFPDMVHALKPNPKSH+QENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHLQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_006828715.1| PREDICTED: catalase-1/2 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   379 bits (974),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA + PF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVH+LKPNPK+HIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHSLKPNPKTHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   379 bits (974),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   379 bits (974),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   382 bits (981),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = +3

Query  42   NLLSHLSSSMDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKL  221
            +++S   ++MDPYK+RPSSA  S FWTTNSGAPVWNNN+SLTVGTRGP+LLEDYHL+EK+
Sbjct  84   SVVSRPPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKI  143

Query  222  ANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERG  401
            ANFDRERIPERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERG
Sbjct  144  ANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERG  203

Query  402  SPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR  581
            SPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR
Sbjct  204  SPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWR  263

Query  582  ILDFFSHHPESLHMFTFLFD  641
            I+DFFSHHPESLHMF+FLFD
Sbjct  264  IVDFFSHHPESLHMFSFLFD  283



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   379 bits (974),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   379 bits (973),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   379 bits (973),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+F++P W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGA+AKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRILDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWRILDF SHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFLSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLT GTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   379 bits (972),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  90   PSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVVHAR  269
            PSSA+ SPFWTTNSGAPVWNNNSSLT+G RGPILLEDYHLVEKLANFDRERIPERVVHAR
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  270  GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  449
            GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY
Sbjct  61   GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  450  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFT  629
            TREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFT
Sbjct  121  TREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFT  180

Query  630  FLFD  641
            FLFD
Sbjct  181  FLFD  184



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA++S F+TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SP+WTTNSGAP WNNNSSLTVGTRGPILLEDY LVE +ANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFS VIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISKLTCADFLRAPGVQTPVIVRFSIVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKP+PKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPSPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLLD  191



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLT GTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLT GTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_011654421.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=431

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 185/189 (98%), Gaps = 1/189 (1%)
 Frame = +3

Query  78   YKH-RPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPER  254
            Y H RPSSAF +PFWTTNSGAPVWNNNS+LT+G+RGPILLEDYHLVEKLANFDRERIPER
Sbjct  2    YSHQRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPER  61

Query  255  VVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGF  434
            VVHARGASAKGFFEVTHDI+HLTCADFLRAPG QTPVIVRFSTVIHERGSPETLRDPRGF
Sbjct  62   VVHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPETLRDPRGF  121

Query  435  AVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPES  614
            AVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPES
Sbjct  122  AVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPES  181

Query  615  LHMFTFLFD  641
            LHMFTFLFD
Sbjct  182  LHMFTFLFD  190



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFL APGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_012065377.1| PREDICTED: catalase-2 [Jatropha curcas]
 gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +SPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQE+WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQESWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFL D
Sbjct  181  ESLNMFTFLLD  191



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  72   DPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPE  251
            DPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGPILLEDYHLVEKLANFDRER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  252  RVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  431
            RVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  432  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  611
            FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPE  180

Query  612  SLHMFTFLFD  641
            SLHMFTFLFD
Sbjct  181  SLHMFTFLFD  190



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVK YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKSYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/191 (95%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +S F+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGAS+KGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDG+KFPDMVHALKPNPKSHIQE WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQETWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA ++P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADF+RAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTN GAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   377 bits (968),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENW +LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWGVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   377 bits (968),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA  SP+WTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAK FFEVTHD+SHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   377 bits (969),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+T NSGAPVWNNNS +TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   377 bits (968),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWRILDFF + P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFYNFP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   377 bits (967),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA ++P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADF+RAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   376 bits (966),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+F+ P W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFA+KFYTREGN+DL GNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLAGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/187 (96%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  81   KHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVV  260
            +HRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  261  HARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  440
            HARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  125

Query  441  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  620
            KFYTREGNFDLVGNNFPVFF+ DGMKFPDMVHALKPNPKSHIQENWRILDFFSH PESLH
Sbjct  126  KFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFPESLH  185

Query  621  MFTFLFD  641
            MF+FLFD
Sbjct  186  MFSFLFD  192



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RP+S+F++PF+TTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+S+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+S F TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RP+S+F++PF+TTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+S+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+R SSA+++PFWTTNSGAPV+NNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQE+WRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLLD  191



>prf||1803522A catalase
Length=491

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 188/191 (98%), Gaps = 1/191 (1%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF++P+WTTNSGAPVWNN+SSLTVG RGPILLEDYH  EKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWRILDFFSHHP
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  180  ESLHMFSFLFD  190



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+T NSGAPVWNNNS +TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 188/191 (98%), Gaps = 1/191 (1%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF++P+WTTNSGAPVWNN+SSLTVG RGPILLEDYH  EKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWRILDFFSHHP
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  180  ESLHMFSFLFD  190



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +SP++T NSGAPVWNNN+SLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLR+PGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+T NSGAPVWNNNS +TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVK YT EGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKLYTGEGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   375 bits (963),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+++PFWTTN GAPV+NN+SSLTVGTRGPILLEDYH VEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVH+LKPNPKSHIQE+WRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHSLKPNPKSHIQEDWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLQD  191



>prf||1906388A catalase
Length=492

 Score =   375 bits (963),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 189/191 (99%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPD+VHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA + P W+TNSGAPVW+N+ SLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>prf||2104177A catalase
Length=492

 Score =   374 bits (961),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+R SSA+++PFWTTNSGAPV+NNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTPVIVR STVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRLSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQE+WRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLLD  191



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   374 bits (961),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +SP +TTNSGAPVWN+NSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFE THDISHLTCADFLR+PGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   374 bits (960),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++S  +TTN+GAPVWNNN+SLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNP++HIQENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHIQENWRIMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFL D
Sbjct  181  ESLHMFTFLLD  191



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK  PSSA  SPF+TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY++RPSS F++PFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPD+VHA KPNPKSH+QENWRI DF SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHLQENWRIFDFLSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHM TFL D
Sbjct  181  ESLHMLTFLLD  191



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/191 (94%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK  PSSA  SPF+TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKVVPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 189/191 (99%), Gaps = 1/191 (1%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+T NSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  120  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  179

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  180  ESLNMFTFLFD  190



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+ LT ADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+ LT ADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIH RGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPD+VHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|XP_012073648.1| PREDICTED: catalase isozyme 1 [Jatropha curcas]
Length=492

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF +PFWTTNSGAP+WNNNSS+TVG RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFDTPFWTTNSGAPIWNNNSSMTVGQRGPILLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPD+VHA KPNPKSHIQE+WRI DF SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDLVHAFKPNPKSHIQESWRIFDFLSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHM TFLFD
Sbjct  181  ESLHMLTFLFD  191



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  81   KHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVV  260
            ++RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIPERVV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  261  HARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  440
            HARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV
Sbjct  63   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  122

Query  441  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  620
            KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH
Sbjct  123  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  182

Query  621  MFTFLFD  641
            MF+FL D
Sbjct  183  MFSFLLD  189



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 188/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWR++DFFS HP
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSPHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 186/191 (97%), Gaps = 1/191 (1%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+ P+WTTNSGAPVWNN+SSLTVG RGPILLEDYH  EKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNPPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAV FYTREGN+DLVGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWRILDFFSHHP
Sbjct  120  GFAVNFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  180  ESLHMFSFLFD  190



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDG+KFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGLKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSASNSSFWTTNSGAPVWNNNSALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   372 bits (956),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQ PVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQAPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   372 bits (955),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNNSSLTVGTRGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLR+PGVQTPVIVRFSTV +ERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH LK NPKS+IQE+WR LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHCLKSNPKSNIQESWRSLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVK YTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKLYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PV FIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVLFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVH  KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHVFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF++PFWTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKF   VH LKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFTRHVHPLKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MF+FLFD
Sbjct  181  ESLNMFSFLFD  191



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   372 bits (954),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNNSSLTVGTRGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLR+PGVQTPVIVRFSTV +ERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVH LK NPKS+IQE+WR LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHCLKSNPKSNIQESWRSLDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+ LT ADFLR PGVQTPVIVR STVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRLSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK  PSSA  SPF+TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTH IS LTCADFLR PGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHGISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAP  NNNS LTVG RG +LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  81   KHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVV  260
            +HRPSS+F+SP W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIPERVV
Sbjct  46   QHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIPERVV  105

Query  261  HARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  440
            HARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFA+
Sbjct  106  HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAI  165

Query  441  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  620
            KFYTREGN+DLVGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHPESLH
Sbjct  166  KFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHPESLH  225

Query  621  MFTFLFD  641
            MFTFLFD
Sbjct  226  MFTFLFD  232



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTN+GAPVWNNNSSLTVG+RGP+LLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WR+LDF SHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL  F FLFD
Sbjct  181  ESLLTFAFLFD  191



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  81   KHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVV  260
            ++RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIPERVV
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  261  HARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  440
            HARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHE GSPETLRDPRGFAV
Sbjct  84   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPRGFAV  143

Query  441  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  620
            KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH
Sbjct  144  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  203

Query  621  MFTFLFD  641
            MF+FLFD
Sbjct  204  MFSFLFD  210



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   370 bits (950),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTN+GAPVWNNNSSLTVG+RGP+LLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WR+LDF SHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL  F FLFD
Sbjct  181  ESLLTFAFLFD  191



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   370 bits (949),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  81   KHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVV  260
            ++RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIPERVV
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  261  HARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  440
            HARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV
Sbjct  62   HARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  121

Query  441  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  620
            KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHPESL+
Sbjct  122  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLN  181

Query  621  MFTFLFD  641
            MFTFLFD
Sbjct  182  MFTFLFD  188



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   369 bits (948),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  81   KHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVV  260
            ++RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIPERVV
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  261  HARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  440
            HARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV
Sbjct  62   HARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  121

Query  441  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  620
            KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHPESL+
Sbjct  122  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLN  181

Query  621  MFTFLFD  641
            MFTFLFD
Sbjct  182  MFTFLFD  188



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   371 bits (953),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = +3

Query  66   SMDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERI  245
            +MDPY+HRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERI
Sbjct  55   AMDPYRHRPSSGNNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERI  114

Query  246  PERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDP  425
            PERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDP
Sbjct  115  PERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDP  174

Query  426  RGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHH  605
            RGFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHH
Sbjct  175  RGFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHH  234

Query  606  PESLHMFTFLFD  641
            PES+HMFTFLFD
Sbjct  235  PESMHMFTFLFD  246



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   369 bits (948),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRP S  +S  WTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPPSGSNSILWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   369 bits (947),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLR+PR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLREPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   369 bits (947),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLED+HL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDHHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERV HARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVAHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGA VWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGASVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PV FIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVLFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF +PFWTTNSGAPVWNN+SSLTVG+RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RD MKFPD + A KPNPKSHIQENWRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQENWRILDFFSHLP  180

Query  609  ESLHMFTFLFD  641
            ESLH F F +D
Sbjct  181  ESLHTFAFFYD  191



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP + RPSSA  SPFWTTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+L+CADFLR  GVQTPVI RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN DLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGS ETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSSETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP + RPSSA  SPFWTTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+L+CADFLR  GVQTPVI RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN DLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP + RPSSA  SPFWTTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+L+CADFLR  GVQTPVI RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN DLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   367 bits (943),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  ++ FW+TNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGANAGFWSTNSGAPVWNNNNALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>gb|AAP80622.1|AF475100_1 catalase isozyme, partial [Triticum aestivum]
Length=268

 Score =   359 bits (922),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +3

Query  78   YKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERV  257
            YKHRP+S  +S +WTTNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIPERV
Sbjct  18   YKHRPTSGANSGYWTTNSGAPVWNNNNALTVGQRGPILLEDYHLIEKLAQFDRERIPERV  77

Query  258  VHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFA  437
            VHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPRGFA
Sbjct  78   VHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPRGFA  137

Query  438  VKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESL  617
            VKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHPESL
Sbjct  138  VKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHPESL  197

Query  618  HMFTFLFD  641
            HMFTFLFD
Sbjct  198  HMFTFLFD  205



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   367 bits (942),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/183 (96%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = +3

Query  93   SSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVVHARG  272
            SSAF+SPF TTNSGAPVWNNNSSLTVG RGP+LLEDYHLVEKLANFDRERI ERVVHARG
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARG  60

Query  273  ASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  452
            ASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT
Sbjct  61   ASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  120

Query  453  REGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTF  632
            REGNFDLVGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSHHPESLHMFTF
Sbjct  121  REGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVLDFFSHHPESLHMFTF  180

Query  633  LFD  641
            LFD
Sbjct  181  LFD  183



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   367 bits (941),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EK A FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKPAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLR PR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRGPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   365 bits (937),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +3

Query  84   HRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVVH  263
            +RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIPERVVH
Sbjct  43   YRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVH  102

Query  264  ARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVK  443
            ARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPRGFAVK
Sbjct  103  ARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVK  162

Query  444  FYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHM  623
            FYTREGNFDLVGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHPESL+M
Sbjct  163  FYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSHHPESLNM  222

Query  624  FTFLFD  641
            FTFLFD
Sbjct  223  FTFLFD  228



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  90   PSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVVHAR  269
            PSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+PERVVHAR
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  270  GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  449
            GASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY
Sbjct  61   GASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  450  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFT  629
            TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH PESLHMFT
Sbjct  121  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFT  180

Query  630  FLFD  641
            FLFD
Sbjct  181  FLFD  184



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRP+S  +S +WTTNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPTSGANSAYWTTNSGAPVWNNNNALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRVVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHR SS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRASSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN P FFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPGFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMF+FLFD
Sbjct  181  ESLHMFSFLFD  191



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS + +PFWTTN GAPVWNNN+SLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFD+VGNN PVFFIRDG+KFPDM+HALKPNPKSHIQE WRI+DFFSH P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEPWRIMDFFSHVP  180

Query  609  ESLHMFTFLFD  641
            E+ +MFTF+FD
Sbjct  181  EACNMFTFVFD  191



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   365 bits (938),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +3

Query  87   RPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVVHA  266
            RP+S+F++PF+TTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKLANFDRERIPERVVHA
Sbjct  27   RPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIPERVVHA  86

Query  267  RGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  446
            RGASAKGFFEVTHD+S+LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF
Sbjct  87   RGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  146

Query  447  YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMF  626
            YTREGNFDLVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWRI+DFFSHHPESLHMF
Sbjct  147  YTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMF  206

Query  627  TFLFD  641
            +FLFD
Sbjct  207  SFLFD  211



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   364 bits (935),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS +++PFWTTN G+PVWNNN+SLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE +RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFD+VGNN PVFFIRDG+KFPDM+HALKPNPKSHIQE WRI+DFFSH P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEAWRIMDFFSHVP  180

Query  609  ESLHMFTFLFD  641
            ES +MFTFLFD
Sbjct  181  ESCNMFTFLFD  191



>ref|XP_002961779.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
 ref|XP_002964850.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ33688.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ37039.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
Length=492

 Score =   364 bits (934),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKH PSSAF+S F+TTNSG PVWNNNSSLTVG+RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHTPSSAFNSSFFTTNSGTPVWNNNSSLTVGSRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKG+FEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGYFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RDG+KFPDM+HALKPNPK+H+QE WRI+D FSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFVRDGIKFPDMIHALKPNPKTHVQEPWRIMDHFSHHP  180

Query  609  ESLHMFTFLFD  641
            ES HMFTFLFD
Sbjct  181  ESCHMFTFLFD  191



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   363 bits (933),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF SP+WTTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RD MKFPD + A KPNPKSHIQE WRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  609  ESLHMFTFLFD  641
            ESLH F F +D
Sbjct  181  ESLHTFAFFYD  191



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF SP+WTTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RD MKFPD + A KPNPKSHIQE WRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  609  ESLHMFTFLFD  641
            ESLH F F +D
Sbjct  181  ESLHTFAFFYD  191



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF SP+WTTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF+RD MKFPD + A KPNPKSHIQE WRILDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  609  ESLHMFTFLFD  641
            ESLH F F +D
Sbjct  181  ESLHTFAFFYD  191



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRP+S  +S +WTTNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPTSGANSAYWTTNSGAPVWNNNNALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+ K+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSSKTNMQENWRVVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WR+LDF SHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL  F FLFD
Sbjct  181  ESLLTFAFLFD  191



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   361 bits (927),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGN+DLVGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WR+LDF SHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL  F FLFD
Sbjct  181  ESLLTFAFLFD  191



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+ PS+A++  FWTTNSGAPVWNNNSSLTVG RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKNLPSNAYNCSFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTH++S LTCADFLRAPGVQTPVIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNVSQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPD+VHA KPNPKSHIQE+WRI DF SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHIQESWRIFDFLSHVP  180

Query  609  ESLHMFTFLFD  641
            ESLHM TFLFD
Sbjct  181  ESLHMLTFLFD  191



>gb|ADN94253.1| catalase [Puccinellia chinampoensis]
Length=492

 Score =   362 bits (929),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRP+S  ++  WTTN GAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPTSGANAGHWTTNYGAPVWNNNSALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>gb|AAB70006.1| catalase [Chlamydomonas reinhardtii]
Length=493

 Score =   362 bits (929),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP K RPSSA+++P+WTTNSGAPVWNNN+S+TVGTRGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGA+AKGFFEVTHDIS LT ADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPKSHIQE WRI+DF SHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP  180

Query  609  ESLHMFTFLFD  641
            ES HM TFL D
Sbjct  181  ESCHMLTFLLD  191



>gb|EMS61345.1| Catalase isozyme 1 [Triticum urartu]
Length=621

 Score =   366 bits (939),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRP+S  +S +WTTNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPTSGANSGYWTTNSGAPVWNNNNALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESLHMFTFLFD
Sbjct  181  ESLHMFTFLFD  191



>ref|XP_001696763.1| catalase/peroxidase [Chlamydomonas reinhardtii]
 gb|EDP00871.1| catalase/peroxidase [Chlamydomonas reinhardtii]
Length=493

 Score =   361 bits (927),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP K RPSSA+++P+WTTNSGAPVWNNN+S+TVGTRGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGA+AKGFFEVTHDIS LT ADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPKSHIQE WRI+DF SHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP  180

Query  609  ESLHMFTFLFD  641
            ES HM TFL D
Sbjct  181  ESCHMLTFLLD  191



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   360 bits (925),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP K RPSS F+SP+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EK+A FDRERIP
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKIAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAP VQTPVIVRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPAVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNNFPVFF RDGMKFP+  HA K NPK+HIQ+NWRI+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFTRDGMKFPEKHHAKKTNPKTHIQDNWRIMDFFSHHP  180

Query  609  ESLHMFTFLFD  641
            ESL+MFTFLFD
Sbjct  181  ESLNMFTFLFD  191



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTT+SGAPVW+NNSSLTVGTRGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTSSGAPVWDNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  428
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTV+HERGSPETLRD R
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDIR  120

Query  429  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  608
            GFAVKFYTREGNFDLVGNN PVFF+RD MKFPD +HALKPNPK+HIQE WRILDFFS+HP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFVRDAMKFPDSIHALKPNPKTHIQEYWRILDFFSYHP  180

Query  609  ESLHMFTFLFD  641
            ESL  F F  D
Sbjct  181  ESLLTFAFFLD  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 998120974048