BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4998

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAB39828.1|  chaperonin-60 beta subunit                              198   1e-60   Solanum tuberosum [potatoes]
emb|CDO97994.1|  unnamed protein product                                206   2e-59   Coffea canephora [robusta coffee]
ref|XP_004235655.1|  PREDICTED: ruBisCO large subunit-binding pro...    200   3e-57   Solanum lycopersicum
ref|XP_006343054.1|  PREDICTED: ruBisCO large subunit-binding pro...    196   8e-56   Solanum tuberosum [potatoes]
ref|XP_002284134.1|  PREDICTED: ruBisCO large subunit-binding pro...    196   2e-55   Vitis vinifera
ref|XP_010254011.1|  PREDICTED: ruBisCO large subunit-binding pro...    191   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_002523404.1|  rubisco subunit binding-protein beta subunit...    188   1e-52   Ricinus communis
ref|XP_010249575.1|  PREDICTED: ruBisCO large subunit-binding pro...    187   2e-52   Nelumbo nucifera [Indian lotus]
gb|KJB56809.1|  hypothetical protein B456_009G136600                    187   3e-52   Gossypium raimondii
ref|XP_011089709.1|  PREDICTED: ruBisCO large subunit-binding pro...    187   4e-52   Sesamum indicum [beniseed]
gb|KCW87049.1|  hypothetical protein EUGRSUZ_B03593                     186   5e-52   Eucalyptus grandis [rose gum]
ref|XP_008809220.1|  PREDICTED: ruBisCO large subunit-binding pro...    186   6e-52   Phoenix dactylifera
ref|XP_010044926.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    186   6e-52   Eucalyptus grandis [rose gum]
emb|CDP18583.1|  unnamed protein product                                184   3e-51   Coffea canephora [robusta coffee]
ref|XP_009382612.1|  PREDICTED: ruBisCO large subunit-binding pro...    184   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009793336.1|  PREDICTED: ruBisCO large subunit-binding pro...    183   9e-51   Nicotiana sylvestris
ref|XP_002285746.1|  PREDICTED: ruBisCO large subunit-binding pro...    183   9e-51   Vitis vinifera
ref|XP_009628147.1|  PREDICTED: ruBisCO large subunit-binding pro...    182   2e-50   Nicotiana tomentosiformis
ref|XP_004144069.1|  PREDICTED: ruBisCO large subunit-binding pro...    181   3e-50   Cucumis sativus [cucumbers]
ref|XP_012080824.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    181   5e-50   Jatropha curcas
ref|XP_010920048.1|  PREDICTED: ruBisCO large subunit-binding pro...    181   5e-50   
ref|XP_008221851.1|  PREDICTED: ruBisCO large subunit-binding pro...    181   5e-50   Prunus mume [ume]
ref|XP_007208310.1|  hypothetical protein PRUPE_ppa003093mg             181   7e-50   Prunus persica
ref|XP_008451008.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   8e-50   Cucumis melo [Oriental melon]
ref|XP_009597827.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    180   9e-50   Nicotiana tomentosiformis
ref|XP_008803228.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   9e-50   Phoenix dactylifera
ref|XP_010909417.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   1e-49   Elaeis guineensis
ref|XP_010671843.1|  PREDICTED: ruBisCO large subunit-binding pro...    180   1e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|AFI08589.1|  cyclophilin                                             171   2e-49   Rhododendron micranthum
gb|EYU32832.1|  hypothetical protein MIMGU_mgv1a003115mg                179   2e-49   Erythranthe guttata [common monkey flower]
ref|XP_007014617.1|  TCP-1/cpn60 chaperonin family protein              179   4e-49   
ref|XP_004294947.1|  PREDICTED: ruBisCO large subunit-binding pro...    178   4e-49   Fragaria vesca subsp. vesca
gb|ABR13306.1|  putative GloEL protein:chaperonin, 60kDa                168   5e-49   Prunus dulcis [sweet almond]
ref|XP_008351333.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    178   7e-49   
ref|XP_009790232.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    177   7e-49   Nicotiana sylvestris
ref|XP_007024263.1|  TCP-1/cpn60 chaperonin family protein              176   2e-48   
ref|XP_010942728.1|  PREDICTED: ruBisCO large subunit-binding pro...    176   2e-48   Elaeis guineensis
ref|XP_008384375.1|  PREDICTED: ruBisCO large subunit-binding pro...    176   2e-48   
gb|KJB73257.1|  hypothetical protein B456_011G224500                    175   2e-48   Gossypium raimondii
ref|XP_010552318.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    176   3e-48   Tarenaya hassleriana [spider flower]
gb|KEH15462.1|  TCP-1/cpn60 chaperonin family protein                   166   4e-48   Medicago truncatula
emb|CDX82537.1|  BnaA03g32840D                                          176   4e-48   
ref|XP_008813151.1|  PREDICTED: ruBisCO large subunit-binding pro...    176   4e-48   Phoenix dactylifera
ref|XP_009135307.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    176   4e-48   Brassica rapa
gb|KJB73262.1|  hypothetical protein B456_011G224500                    175   5e-48   Gossypium raimondii
gb|KHG01053.1|  RuBisCO large subunit-binding protein subunit bet...    175   6e-48   Gossypium arboreum [tree cotton]
gb|EPS66563.1|  hypothetical protein M569_08214                         166   8e-48   Genlisea aurea
ref|XP_009376036.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    175   8e-48   
ref|XP_006297271.1|  hypothetical protein CARUB_v10013285mg             175   8e-48   Capsella rubella
ref|XP_009392770.1|  PREDICTED: ruBisCO large subunit-binding pro...    175   9e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376045.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    175   9e-48   Pyrus x bretschneideri [bai li]
ref|XP_010500599.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    174   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010103092.1|  Chaperonin 60 subunit beta 2                       174   1e-47   
ref|XP_007149220.1|  hypothetical protein PHAVU_005G051700g             174   1e-47   Phaseolus vulgaris [French bean]
gb|KJB73258.1|  hypothetical protein B456_011G224500                    174   1e-47   Gossypium raimondii
gb|KJB73253.1|  hypothetical protein B456_011G224500                    174   1e-47   Gossypium raimondii
gb|KJB73259.1|  hypothetical protein B456_011G224500                    174   1e-47   Gossypium raimondii
gb|KJB73260.1|  hypothetical protein B456_011G224500                    174   1e-47   Gossypium raimondii
ref|NP_001275097.1|  chaperonin-60 beta subunit                         174   2e-47   Solanum tuberosum [potatoes]
ref|XP_008813152.1|  PREDICTED: ruBisCO large subunit-binding pro...    174   2e-47   Phoenix dactylifera
ref|XP_011048163.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    174   2e-47   Populus euphratica
ref|XP_010920050.1|  PREDICTED: ruBisCO large subunit-binding pro...    173   2e-47   Elaeis guineensis
ref|XP_011025126.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    173   3e-47   Populus euphratica
ref|XP_010094358.1|  RuBisCO large subunit-binding protein subuni...    174   3e-47   
ref|XP_010487110.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    173   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002303983.1|  chaperonin precursor family protein                173   4e-47   Populus trichocarpa [western balsam poplar]
gb|KJB10931.1|  hypothetical protein B456_001G233100                    163   4e-47   Gossypium raimondii
ref|XP_004228946.1|  PREDICTED: ruBisCO large subunit-binding pro...    172   5e-47   Solanum lycopersicum
gb|KDO54477.1|  hypothetical protein CISIN_1g007313mg                   172   5e-47   Citrus sinensis [apfelsine]
gb|KDO54476.1|  hypothetical protein CISIN_1g007313mg                   172   6e-47   Citrus sinensis [apfelsine]
ref|XP_006407212.1|  hypothetical protein EUTSA_v10020346mg             172   7e-47   Eutrema salsugineum [saltwater cress]
gb|KDO54475.1|  hypothetical protein CISIN_1g007313mg                   172   7e-47   Citrus sinensis [apfelsine]
ref|XP_006838174.1|  PREDICTED: ruBisCO large subunit-binding pro...    172   7e-47   Amborella trichopoda
ref|XP_010465189.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin 6...    172   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002297617.1|  hypothetical protein POPTR_0001s03980g             172   9e-47   Populus trichocarpa [western balsam poplar]
gb|KDO54472.1|  hypothetical protein CISIN_1g007313mg                   172   1e-46   Citrus sinensis [apfelsine]
ref|XP_006445574.1|  hypothetical protein CICLE_v10014640mg             172   1e-46   Citrus clementina [clementine]
ref|NP_187956.1|  TCP-1/cpn60 chaperonin family protein                 171   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KDO54471.1|  hypothetical protein CISIN_1g007313mg                   171   1e-46   Citrus sinensis [apfelsine]
sp|P08927.2|RUBB_PEA  RecName: Full=RuBisCO large subunit-binding...    171   1e-46   Pisum sativum [garden pea]
emb|CAJ19275.1|  beta chaperonin 60                                     171   2e-46   Solanum commersonii
gb|ABK24483.1|  unknown                                                 171   2e-46   Picea sitchensis
gb|AFW86142.1|  putative TCP-1/cpn60 chaperonin family protein          167   3e-46   
ref|XP_006307049.1|  hypothetical protein CARUB_v10008637mg             170   4e-46   Capsella rubella
sp|P21241.1|RUBB_BRANA  RecName: Full=RuBisCO large subunit-bindi...    170   4e-46   Brassica napus [oilseed rape]
emb|CDY26100.1|  BnaC06g10960D                                          170   6e-46   Brassica napus [oilseed rape]
ref|XP_009106876.1|  PREDICTED: ruBisCO large subunit-binding pro...    169   6e-46   Brassica rapa
emb|CDY02438.1|  BnaA08g00450D                                          170   6e-46   
ref|XP_006392634.1|  hypothetical protein EUTSA_v10011330mg             169   6e-46   Eutrema salsugineum [saltwater cress]
ref|XP_009339195.1|  PREDICTED: LOW QUALITY PROTEIN: ruBisCO larg...    169   7e-46   
ref|XP_002894506.1|  CPN60B                                             169   7e-46   
emb|CDY08245.1|  BnaA05g13740D                                          169   1e-45   Brassica napus [oilseed rape]
ref|XP_009103725.1|  PREDICTED: ruBisCO large subunit-binding pro...    169   1e-45   Brassica rapa
ref|XP_010501159.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    169   1e-45   Camelina sativa [gold-of-pleasure]
emb|CDX75713.1|  BnaC03g37960D                                          168   2e-45   
emb|CDY10557.1|  BnaC03g70570D                                          170   2e-45   Brassica napus [oilseed rape]
ref|XP_003531529.1|  PREDICTED: ruBisCO large subunit-binding pro...    168   2e-45   Glycine max [soybeans]
gb|KEH39991.1|  TCP-1/cpn60 chaperonin family protein                   168   2e-45   Medicago truncatula
ref|XP_010090495.1|  RuBisCO large subunit-binding protein subuni...    167   2e-45   
ref|NP_175945.1|  chaperonin 60 subunit beta 1                          168   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462399.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    168   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010480083.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    168   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008659370.1|  PREDICTED: ruBisCO large subunit-binding pro...    167   4e-45   Zea mays [maize]
ref|XP_004964341.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    167   4e-45   Setaria italica
ref|XP_008659369.1|  PREDICTED: ruBisCO large subunit-binding pro...    167   4e-45   
ref|XP_010536825.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    167   5e-45   Tarenaya hassleriana [spider flower]
ref|XP_004498949.1|  PREDICTED: ruBisCO large subunit-binding pro...    167   5e-45   Cicer arietinum [garbanzo]
ref|XP_002437709.1|  hypothetical protein SORBIDRAFT_10g001120          167   5e-45   Sorghum bicolor [broomcorn]
ref|XP_004964340.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    167   5e-45   Setaria italica
ref|XP_009418590.1|  PREDICTED: ruBisCO large subunit-binding pro...    167   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557154.1|  PREDICTED: ruBisCO large subunit-binding pro...    167   6e-45   Brachypodium distachyon [annual false brome]
ref|XP_003546771.1|  PREDICTED: ruBisCO large subunit-binding pro...    167   7e-45   Glycine max [soybeans]
ref|XP_010691436.1|  PREDICTED: ruBisCO large subunit-binding pro...    167   7e-45   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH39992.1|  TCP-1/cpn60 chaperonin family protein                   166   8e-45   Medicago truncatula
dbj|BAB11583.1|  RuBisCO subunit binding-protein beta subunit pre...    166   9e-45   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00280.1|  RuBisCO subunit binding-protein beta subunit pre...    166   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001032083.1|  chaperonin 60 subunit beta 3                       166   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008648746.1|  PREDICTED: ruBisCO large subunit-binding pro...    166   1e-44   
gb|EMS68298.1|  RuBisCO large subunit-binding protein subunit bet...    167   2e-44   Triticum urartu
ref|NP_001056601.1|  Os06g0114000                                       166   2e-44   
gb|EEE64974.1|  hypothetical protein OsJ_19883                          165   2e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006401314.1|  hypothetical protein EUTSA_v10013030mg             164   5e-44   Eutrema salsugineum [saltwater cress]
ref|XP_006655715.1|  PREDICTED: chaperonin 60 subunit beta 1, chl...    164   7e-44   
emb|CDY32855.1|  BnaC09g33020D                                          163   1e-43   Brassica napus [oilseed rape]
gb|EMT05406.1|  RuBisCO large subunit-binding protein subunit bet...    166   1e-43   
ref|XP_002864459.1|  ATP binding protein                                163   2e-43   
emb|CDY11918.1|  BnaC03g13440D                                          162   2e-43   Brassica napus [oilseed rape]
ref|XP_006280215.1|  hypothetical protein CARUB_v10026123mg             160   8e-43   Capsella rubella
ref|XP_010451233.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    160   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010443301.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    159   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010483125.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    159   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009132296.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    159   4e-42   Brassica rapa
gb|KHN26774.1|  RuBisCO large subunit-binding protein subunit bet...    159   4e-42   Glycine soja [wild soybean]
ref|XP_003574065.1|  PREDICTED: ruBisCO large subunit-binding pro...    159   4e-42   Brachypodium distachyon [annual false brome]
gb|EMS63178.1|  RuBisCO large subunit-binding protein subunit bet...    158   6e-42   Triticum urartu
ref|XP_001754999.1|  predicted protein                                  158   8e-42   
gb|KHN23693.1|  RuBisCO large subunit-binding protein subunit bet...    157   1e-41   Glycine soja [wild soybean]
gb|EMT19476.1|  RuBisCO large subunit-binding protein subunit bet...    157   1e-41   
emb|CDY36809.1|  BnaA03g10770D                                          156   3e-41   Brassica napus [oilseed rape]
ref|NP_001045601.1|  Os02g0102900                                       156   3e-41   
ref|XP_001754571.1|  predicted protein                                  155   4e-41   
ref|XP_002982262.1|  hypothetical protein SELMODRAFT_271545             156   4e-41   Selaginella moellendorffii
ref|XP_004951187.1|  PREDICTED: ruBisCO large subunit-binding pro...    155   1e-40   Setaria italica
gb|AFW66837.1|  putative TCP-1/cpn60 chaperonin family protein is...    154   1e-40   
ref|NP_001146890.1|  ruBisCO large subunit-binding protein subuni...    154   1e-40   
gb|ACG36615.1|  ruBisCO large subunit-binding protein subunit beta      154   1e-40   Zea mays [maize]
dbj|BAK07904.1|  predicted protein                                      154   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001780334.1|  predicted protein                                  154   3e-40   
ref|XP_002961675.1|  hypothetical protein SELMODRAFT_165043             153   5e-40   
gb|EMT33855.1|  RuBisCO large subunit-binding protein subunit bet...    153   5e-40   
ref|XP_002966190.1|  hypothetical protein SELMODRAFT_168153             151   2e-39   
ref|XP_009413285.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...    149   2e-39   
ref|XP_002964742.1|  hypothetical protein SELMODRAFT_142800             150   4e-39   Selaginella moellendorffii
ref|XP_005843554.1|  hypothetical protein CHLNCDRAFT_59809              148   2e-38   Chlorella variabilis
emb|CDX75715.1|  BnaC03g37980D                                          148   2e-38   
emb|CEF98707.1|  Chaperonin Cpn60                                       144   7e-37   Ostreococcus tauri
ref|XP_003080325.1|  RUBISCO SUBUNIT BINDING-PROTEIN BETA-2 SUBUN...    144   9e-37   
gb|ERN05824.1|  hypothetical protein AMTR_s00006p00260480               143   2e-36   Amborella trichopoda
ref|XP_002500045.1|  chaperonin 60 beta                                 143   2e-36   Micromonas commoda
ref|XP_005647445.1|  chaperonin 60B2                                    142   2e-36   Coccomyxa subellipsoidea C-169
ref|XP_003057879.1|  predicted protein                                  142   2e-36   Micromonas pusilla CCMP1545
ref|XP_011623265.1|  PREDICTED: ruBisCO large subunit-binding pro...    142   3e-36   
gb|KIZ01508.1|  RuBisCO large subunit-binding protein subunit beta      140   4e-36   Monoraphidium neglectum
gb|KJB11277.1|  hypothetical protein B456_001G250800                    140   4e-36   Gossypium raimondii
ref|XP_007514774.1|  chaperonin GroEL                                   140   1e-35   Bathycoccus prasinos
ref|XP_001418926.1|  chaperonin 60 beta chain, chloroplast              140   1e-35   Ostreococcus lucimarinus CCE9901
gb|KDO70207.1|  hypothetical protein CISIN_1g010494mg                   139   1e-35   Citrus sinensis [apfelsine]
ref|XP_001692504.1|  chaperonin 60B2                                    140   2e-35   Chlamydomonas reinhardtii
gb|EMS56406.1|  RuBisCO large subunit-binding protein subunit bet...    140   2e-35   Triticum urartu
gb|KJB11271.1|  hypothetical protein B456_001G250800                    140   2e-35   Gossypium raimondii
gb|KDO70205.1|  hypothetical protein CISIN_1g010494mg                   139   3e-35   Citrus sinensis [apfelsine]
gb|KDO70206.1|  hypothetical protein CISIN_1g010494mg                   139   3e-35   Citrus sinensis [apfelsine]
ref|XP_006484293.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    139   3e-35   Citrus sinensis [apfelsine]
ref|XP_002269341.2|  PREDICTED: chaperonin 60 subunit beta 4, chl...    139   4e-35   Vitis vinifera
gb|KDD74080.1|  TCP-1/cpn60 chaperonin                                  139   5e-35   Helicosporidium sp. ATCC 50920
ref|XP_007045689.1|  TCP-1/cpn60 chaperonin family protein isoform 1    139   7e-35   
ref|XP_012080491.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    137   1e-34   Jatropha curcas
emb|CDP00506.1|  unnamed protein product                                137   2e-34   Coffea canephora [robusta coffee]
ref|XP_011077797.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    136   3e-34   
ref|XP_002951713.1|  hypothetical protein VOLCADRAFT_81582              137   3e-34   Volvox carteri f. nagariensis
ref|XP_001701113.1|  chaperonin 60B1                                    136   3e-34   Chlamydomonas reinhardtii
ref|XP_006573192.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    136   4e-34   
ref|XP_011077788.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    136   4e-34   Sesamum indicum [beniseed]
ref|XP_002514548.1|  rubisco subunit binding-protein beta subunit...    136   4e-34   
emb|CBI27426.3|  unnamed protein product                                135   6e-34   Vitis vinifera
ref|XP_006573191.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    135   6e-34   Glycine max [soybeans]
ref|XP_012080492.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    135   7e-34   Jatropha curcas
ref|XP_010696183.1|  PREDICTED: ruBisCO large subunit-binding pro...    135   7e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003516734.2|  PREDICTED: chaperonin 60 subunit beta 4, chl...    135   8e-34   Glycine max [soybeans]
ref|XP_006574985.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    135   1e-33   Glycine max [soybeans]
ref|XP_011655734.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    134   2e-33   Cucumis sativus [cucumbers]
ref|XP_006437814.1|  hypothetical protein CICLE_v10031053mg             134   2e-33   
ref|XP_007146371.1|  hypothetical protein PHAVU_006G034900g             134   3e-33   Phaseolus vulgaris [French bean]
ref|XP_004135135.1|  PREDICTED: ruBisCO large subunit-binding pro...    134   4e-33   Cucumis sativus [cucumbers]
gb|KGN52011.1|  hypothetical protein Csa_5G607990                       134   4e-33   Cucumis sativus [cucumbers]
ref|XP_010066785.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    134   4e-33   Eucalyptus grandis [rose gum]
ref|XP_004490321.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    133   6e-33   Cicer arietinum [garbanzo]
ref|XP_010261583.1|  PREDICTED: ruBisCO large subunit-binding pro...    133   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_009121294.1|  PREDICTED: chaperonin 60 subunit beta 3, chl...    125   9e-33   
ref|XP_008446495.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    132   1e-32   Cucumis melo [Oriental melon]
ref|XP_011462962.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    131   1e-32   Fragaria vesca subsp. vesca
ref|XP_008243763.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    132   1e-32   Prunus mume [ume]
ref|XP_008446496.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    132   1e-32   
ref|XP_011462961.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    131   1e-32   Fragaria vesca subsp. vesca
ref|XP_010091675.1|  Chaperonin 60 subunit beta 4                       132   2e-32   
ref|NP_173947.1|  chaperonin 60 subunit beta 4                          132   2e-32   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95277.1|  chaperonin precursor                                   132   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008446493.1|  PREDICTED: ruBisCO large subunit-binding pro...    131   2e-32   Cucumis melo [Oriental melon]
ref|XP_007227057.1|  hypothetical protein PRUPE_ppa020938mg             131   3e-32   
ref|XP_004297181.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    131   3e-32   Fragaria vesca subsp. vesca
ref|XP_011009131.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    130   3e-32   Populus euphratica
ref|XP_008243762.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    131   4e-32   Prunus mume [ume]
gb|EYU28916.1|  hypothetical protein MIMGU_mgv1a003338mg                130   7e-32   Erythranthe guttata [common monkey flower]
ref|XP_011009123.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    130   7e-32   Populus euphratica
gb|AFW75266.1|  putative TCP-1/cpn60 chaperonin family protein          122   9e-32   
ref|XP_002315987.2|  hypothetical protein POPTR_0010s14520g             130   9e-32   
ref|XP_011397598.1|  RuBisCO large subunit-binding protein subuni...    129   9e-32   Auxenochlorella protothecoides
ref|XP_011009115.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    129   1e-31   Populus euphratica
ref|XP_011009108.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    129   1e-31   Populus euphratica
emb|CDY56074.1|  BnaC06g41650D                                          129   1e-31   Brassica napus [oilseed rape]
ref|XP_008804418.1|  PREDICTED: ruBisCO large subunit-binding pro...    129   1e-31   Phoenix dactylifera
ref|XP_009611004.1|  PREDICTED: ruBisCO large subunit-binding pro...    129   1e-31   Nicotiana tomentosiformis
ref|XP_009774324.1|  PREDICTED: ruBisCO large subunit-binding pro...    129   2e-31   Nicotiana sylvestris
ref|XP_010552083.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    129   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_002890669.1|  hypothetical protein ARALYDRAFT_890123             128   2e-31   
ref|XP_006415907.1|  hypothetical protein EUTSA_v10007125mg             129   2e-31   Eutrema salsugineum [saltwater cress]
gb|AFW75267.1|  putative TCP-1/cpn60 chaperonin family protein          123   2e-31   
ref|XP_002465562.1|  hypothetical protein SORBIDRAFT_01g041170          122   2e-31   
ref|XP_010477879.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    128   4e-31   Camelina sativa [gold-of-pleasure]
emb|CDY66193.1|  BnaA07g36980D                                          128   4e-31   Brassica napus [oilseed rape]
ref|XP_009103087.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    128   5e-31   Brassica rapa
emb|CDY20555.1|  BnaC07g12220D                                          128   5e-31   Brassica napus [oilseed rape]
ref|XP_010905780.1|  PREDICTED: ruBisCO large subunit-binding pro...    128   5e-31   Elaeis guineensis
ref|XP_010460335.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    128   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010499066.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    127   6e-31   
ref|XP_010499065.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    128   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009356484.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    126   8e-31   Pyrus x bretschneideri [bai li]
ref|XP_009356483.1|  PREDICTED: ruBisCO large subunit-binding pro...    126   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_006348604.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    125   3e-30   Solanum tuberosum [potatoes]
ref|XP_010320797.1|  PREDICTED: ruBisCO large subunit-binding pro...    125   4e-30   
gb|EMS68279.1|  RuBisCO large subunit-binding protein subunit bet...    125   4e-30   Triticum urartu
ref|XP_003579836.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    125   4e-30   Brachypodium distachyon [annual false brome]
ref|XP_008389355.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    124   7e-30   
ref|XP_009418029.1|  PREDICTED: ruBisCO large subunit-binding pro...    124   8e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006653448.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    124   8e-30   Oryza brachyantha
gb|EEC67866.1|  hypothetical protein OsI_35492                          124   1e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_004975721.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    124   1e-29   Setaria italica
ref|XP_008389354.1|  PREDICTED: ruBisCO large subunit-binding pro...    124   2e-29   
ref|XP_008351035.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    122   2e-29   
ref|XP_008653444.1|  PREDICTED: ruBisCO large subunit-binding pro...    122   5e-29   
emb|CDY56079.1|  BnaC06g41690D                                          114   2e-28   Brassica napus [oilseed rape]
ref|WP_012993464.1|  molecular chaperone GroEL                          119   3e-28   Mageeibacillus indolicus
ref|WP_023153155.1|  chaperonin GroL                                    119   4e-28   [Eubacterium] brachy
ref|WP_033051464.1|  hypothetical protein                               111   5e-28   
ref|XP_010320801.1|  PREDICTED: chaperonin 60 subunit beta 4, chl...    119   6e-28   Solanum lycopersicum
ref|XP_010320799.1|  PREDICTED: ruBisCO large subunit-binding pro...    119   9e-28   Solanum lycopersicum
ref|XP_010320795.1|  PREDICTED: ruBisCO large subunit-binding pro...    119   1e-27   
ref|XP_010320798.1|  PREDICTED: ruBisCO large subunit-binding pro...    119   1e-27   Solanum lycopersicum
ref|WP_033062830.1|  molecular chaperone GroEL                          112   2e-27   
ref|WP_025747015.1|  molecular chaperone GroEL                          117   2e-27   Caldicoprobacter
gb|ADC80588.1|  chaperonin C60-like protein                             108   2e-27   Bauhinia purpurea
ref|WP_033064442.1|  molecular chaperone GroEL                          112   2e-27   
ref|XP_009384573.1|  PREDICTED: ruBisCO large subunit-binding pro...    117   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_045175634.1|  molecular chaperone GroEL                          117   4e-27   Caldicellulosiruptor danielii
ref|WP_008711196.1|  MULTISPECIES: molecular chaperone GroEL            117   4e-27   Synergistaceae
gb|ETI99838.1|  hypothetical protein Q611_LSC00206G0004                 109   4e-27   Leuconostoc sp. DORA_2
ref|XP_001420863.1|  chaperonin 60 alpha chain, chloroplast             117   4e-27   Ostreococcus lucimarinus CCE9901
ref|WP_043120019.1|  molecular chaperone GroEL                          116   4e-27   Sinomonas humi
ref|WP_030045239.1|  molecular chaperone GroEL                          111   4e-27   
gb|AAV65335.1|  plastid 60 kDa chaperonin alpha subunit                 112   5e-27   Prototheca wickerhamii
ref|XP_002313525.1|  RUBISCO SUBUNIT BINDING-protein ALPHA SUBUNIT      117   5e-27   Populus trichocarpa [western balsam poplar]
ref|WP_017326110.1|  molecular chaperone GroEL                          116   6e-27   Synechococcus sp. PCC 7336
dbj|BAJ93636.1|  predicted protein                                      117   6e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADC80590.1|  chaperonin C60-like protein                             108   6e-27   Bauhinia purpurea
ref|XP_011000529.1|  PREDICTED: ruBisCO large subunit-binding pro...    116   6e-27   Populus euphratica
ref|WP_027399496.1|  molecular chaperone GroEL                          116   7e-27   Anaerovorax odorimutans
ref|WP_026530992.1|  molecular chaperone GroEL                          115   8e-27   Haematomicrobium sanguinis
ref|WP_013402565.1|  MULTISPECIES: molecular chaperone GroEL            115   9e-27   Caldicellulosiruptor
ref|WP_013291182.1|  MULTISPECIES: molecular chaperone GroEL            115   9e-27   Caldicellulosiruptor
ref|WP_045169022.1|  molecular chaperone GroEL                          115   9e-27   
ref|WP_039763755.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_011916830.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_045165264.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_036317602.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_041104385.1|  molecular chaperone GroEL                          115   1e-26   
ref|XP_010689095.1|  PREDICTED: ruBisCO large subunit-binding pro...    116   1e-26   
ref|WP_002857591.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_032557538.1|  hypothetical protein                               107   1e-26   
ref|XP_005644409.1|  chaperonin 60A                                     116   1e-26   
ref|WP_036340907.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_012751032.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_044659449.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_036384650.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_012797713.1|  molecular chaperone GroEL                          115   1e-26   
ref|WP_034547530.1|  molecular chaperone GroEL                          115   1e-26   
ref|XP_011401398.1|  RuBisCO large subunit-binding protein subuni...    115   1e-26   
emb|CEF99984.1|  Chaperonin Cpn60                                       115   1e-26   
ref|WP_032556891.1|  hypothetical protein                               107   1e-26   
ref|XP_003082449.1|  RuBisCO subunit binding-protein alpha subuni...    115   2e-26   
ref|WP_044576585.1|  molecular chaperone GroEL                          115   2e-26   
ref|WP_015359978.1|  molecular chaperone GroEL [                        115   2e-26   
ref|WP_034836202.1|  molecular chaperone GroEL [                        114   2e-26   
ref|WP_014256859.1|  molecular chaperone GroEL [                        115   2e-26   
gb|EIA25322.1|  chaperonin                                              109   2e-26   
ref|WP_027622231.1|  molecular chaperone GroEL [                        114   2e-26   
gb|EHO20065.1|  chaperonin                                              108   2e-26   
ref|XP_003558045.1|  PREDICTED: ruBisCO large subunit-binding pro...    115   2e-26   
ref|XP_009386348.1|  PREDICTED: ruBisCO large subunit-binding pro...    115   3e-26   
ref|WP_010244763.1|  MULTISPECIES: molecular chaperone GroEL            114   3e-26   
ref|XP_011040914.1|  PREDICTED: LOW QUALITY PROTEIN: ruBisCO larg...    115   3e-26   
ref|WP_003492339.1|  MULTISPECIES: molecular chaperone GroEL            114   3e-26   
ref|XP_002440887.1|  hypothetical protein SORBIDRAFT_09g014430          114   3e-26   
ref|WP_039726130.1|  MULTISPECIES: molecular chaperone GroEL            114   3e-26   
ref|WP_005267455.1|  chaperonin GroEL                                   114   3e-26   
ref|WP_014966514.1|  molecular chaperone GroEL                          114   3e-26   
ref|WP_014162755.1|  molecular chaperone GroEL                          114   3e-26   
ref|XP_004291571.1|  PREDICTED: ruBisCO large subunit-binding pro...    114   3e-26   
ref|WP_039702826.1|  molecular chaperone GroEL                          114   3e-26   
ref|XP_008359856.1|  PREDICTED: chaperonin 60 subunit alpha 1, ch...    109   4e-26   
ref|WP_037977244.1|  molecular chaperone GroEL                          114   4e-26   
gb|KID49560.1|  hypothetical protein C095_05275                         108   4e-26   
ref|XP_008787342.1|  PREDICTED: ruBisCO large subunit-binding pro...    112   4e-26   
ref|WP_011142891.1|  molecular chaperone GroEL                          114   4e-26   
ref|XP_002534347.1|  rubisco subunit binding-protein alpha subuni...    113   4e-26   
ref|WP_017488263.1|  molecular chaperone GroEL                          114   4e-26   
gb|KDD76969.1|  TCP-1/cpn60 chaperonin                                  114   4e-26   
ref|WP_018134159.1|  molecular chaperone GroEL                          114   4e-26   
ref|WP_022871023.1|  molecular chaperone GroEL                          114   4e-26   
gb|EMY27220.1|  60 kDa chaperonin domain protein                        108   4e-26   
ref|WP_015360296.1|  molecular chaperone GroEL [                        114   5e-26   
gb|AGQ20058.1|  chaperonin GroEL (HSP60 family)                         111   5e-26   
ref|WP_034131319.1|  molecular chaperone GroEL                          114   5e-26   
ref|WP_021736687.1|  chaperonin GroL                                    114   5e-26   
ref|WP_034836475.1|  molecular chaperone GroEL [                        114   5e-26   
ref|WP_045660092.1|  molecular chaperone GroEL                          114   5e-26   
ref|WP_015116771.1|  chaperonin GroL                                    114   5e-26   
gb|EMM83430.1|  60 kDa chaperonin domain protein                        108   5e-26   
ref|WP_009015680.1|  MULTISPECIES: molecular chaperone GroEL            114   5e-26   
ref|WP_030970322.1|  molecular chaperone GroEL                          110   5e-26   
ref|WP_015169314.1|  chaperonin GroL                                    114   5e-26   
ref|XP_006384931.1|  RUBISCO SUBUNIT BINDING-protein ALPHA SUBUNIT      114   6e-26   
ref|WP_026545961.1|  molecular chaperone GroEL                          113   6e-26   
ref|WP_020890460.1|  Heat shock protein 60 family chaperone GroEL       113   6e-26   
ref|WP_038464520.1|  molecular chaperone GroEL                          113   6e-26   
ref|WP_012397748.1|  molecular chaperone GroEL                          113   6e-26   
ref|WP_039102073.1|  molecular chaperone GroEL                          113   6e-26   
ref|WP_019309603.1|  molecular chaperone GroEL                          113   6e-26   
ref|WP_031119985.1|  molecular chaperone GroEL                          110   7e-26   
ref|NP_001066567.1|  Os12g0277500                                       114   7e-26   
ref|XP_006653189.1|  PREDICTED: ruBisCO large subunit-binding pro...    114   7e-26   
ref|WP_031369890.1|  molecular chaperone GroEL                          112   7e-26   
ref|WP_030046438.1|  molecular chaperone GroEL                          110   8e-26   
dbj|BAH22163.1|  GroEL                                                  112   8e-26   
ref|WP_021717025.1|  molecular chaperone GroEL                          113   8e-26   
ref|WP_019500096.1|  molecular chaperone GroEL                          113   8e-26   
ref|XP_005843628.1|  hypothetical protein CHLNCDRAFT_59237              113   8e-26   
ref|WP_004833193.1|  molecular chaperone GroEL                          113   8e-26   
ref|WP_012308054.1|  molecular chaperone GroEL                          113   8e-26   
ref|WP_030006933.1|  molecular chaperone GroEL                          113   8e-26   
ref|WP_024476844.1|  molecular chaperone GroEL                          113   8e-26   
ref|WP_009372257.1|  MULTISPECIES: molecular chaperone GroEL            113   8e-26   
ref|WP_023171298.1|  chaperonin GroEL                                   113   8e-26   
ref|WP_034819549.1|  molecular chaperone GroEL [                        113   9e-26   
ref|WP_001029960.1|  hypothetical protein                               108   9e-26   
ref|XP_006424516.1|  hypothetical protein CICLE_v10028085mg             113   1e-25   
ref|XP_012064751.1|  PREDICTED: ruBisCO large subunit-binding pro...    113   1e-25   
ref|WP_027869975.1|  molecular chaperone GroEL                          113   1e-25   
ref|WP_035293828.1|  molecular chaperone GroEL                          113   1e-25   
ref|WP_031541918.1|  hypothetical protein                               106   1e-25   
ref|WP_006888720.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_038670252.1|  molecular chaperone GroEL                          113   1e-25   
ref|WP_045936795.1|  molecular chaperone GroEL                          110   1e-25   
ref|WP_037234620.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_032982920.1|  molecular chaperone GroEL                          106   1e-25   
emb|CDY31193.1|  BnaC03g46980D                                          109   1e-25   
ref|XP_010918679.1|  PREDICTED: ruBisCO large subunit-binding pro...    113   1e-25   
ref|WP_042420173.1|  molecular chaperone GroEL                          112   1e-25   
ref|NP_001173725.1|  Os03g0859600                                       108   1e-25   
dbj|BAE71231.1|  putative rubisco subunit binding-protein alpha s...    113   1e-25   
ref|WP_008300610.1|  Stress protein H5                                  112   1e-25   
dbj|BAE71302.1|  putative rubisco subunit binding-protein alpha s...    113   1e-25   
ref|XP_006488046.1|  PREDICTED: ruBisCO large subunit-binding pro...    113   1e-25   
dbj|BAE71311.1|  putative rubisco subunit binding-protein alpha s...    113   1e-25   
ref|WP_030084407.1|  molecular chaperone GroEL                          109   1e-25   
ref|WP_042365495.1|  molecular chaperone GroEL                          112   1e-25   
ref|XP_004962429.1|  PREDICTED: ruBisCO large subunit-binding pro...    113   1e-25   
ref|WP_026551899.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_003354043.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_034616307.1|  molecular chaperone GroEL                          109   1e-25   
ref|WP_027365302.1|  molecular chaperone GroEL                          112   1e-25   
ref|XP_010918680.1|  PREDICTED: ruBisCO large subunit-binding pro...    113   1e-25   
ref|WP_019481571.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_004005228.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_015165256.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_009164022.1|  molecular chaperone GroEL                          111   1e-25   
ref|WP_013397584.1|  molecular chaperone GroEL                          112   1e-25   
dbj|BAE71227.1|  putative rubisco subunit binding-protein alpha s...    112   1e-25   
ref|WP_042389258.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_012938775.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_008312275.1|  chaperonin GroL                                    112   1e-25   
ref|WP_006301345.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_022366572.1|  molecular chaperone GroEL                          112   1e-25   
ref|WP_013240323.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_023162307.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_022258998.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_006583189.1|  molecular chaperone GroEL                          112   2e-25   
gb|AAO72600.1|  putative chaperonin 60 alpha subunit                    108   2e-25   
ref|WP_027627179.1|  molecular chaperone GroEL [                        112   2e-25   
gb|ABR18037.1|  unknown                                                 112   2e-25   
ref|WP_033051798.1|  molecular chaperone GroEL                          107   2e-25   
ref|WP_015135231.1|  molecular chaperone GroEL                          112   2e-25   
ref|XP_008226152.1|  PREDICTED: ruBisCO large subunit-binding pro...    112   2e-25   
ref|WP_022487043.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_033177834.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_022145510.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_003360385.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_004616331.1|  molecular chaperone GroEL [                        112   2e-25   
ref|WP_031516467.1|  molecular chaperone GroEL                          112   2e-25   
ref|XP_007204982.1|  hypothetical protein PRUPE_ppa003328mg             112   2e-25   
ref|WP_037912439.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_014521881.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_022081117.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_012343546.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_003357641.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_013360509.1|  molecular chaperone GroEL [                        112   2e-25   
ref|WP_034432512.1|  molecular chaperone GroEL                          112   2e-25   
ref|XP_008649582.1|  PREDICTED: ruBisCO large subunit-binding pro...    112   2e-25   
ref|WP_012869974.1|  chaperonin GroEL                                   112   2e-25   
ref|WP_024822627.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_030211456.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_035563024.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_030549194.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_008637805.1|  chaperonin GroEL                                   105   2e-25   
ref|WP_034267949.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_035924783.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_022144336.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_019490875.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_024545344.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_009756747.1|  MULTISPECIES: molecular chaperone GroEL            112   2e-25   
ref|WP_016870295.1|  molecular chaperone GroEL                          112   2e-25   
gb|AFW77798.1|  chloroplast protein synthesis2                          112   2e-25   
ref|WP_033280060.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_013387817.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_012954134.1|  molecular chaperone GroEL                          112   2e-25   
gb|EUJ25113.1|  chaperonin GroEL                                        105   2e-25   
ref|WP_017319770.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_019055580.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_030089483.1|  molecular chaperone GroEL                          108   2e-25   
ref|WP_035959431.1|  molecular chaperone GroEL                          111   2e-25   
ref|WP_021950955.1|  molecular chaperone GroEL                          112   2e-25   
ref|WP_012422966.1|  molecular chaperone GroEL                          111   3e-25   
ref|XP_003581066.1|  PREDICTED: ruBisCO large subunit-binding pro...    112   3e-25   
ref|WP_017834526.1|  molecular chaperone GroEL                          112   3e-25   
gb|EQJ26681.1|  TCP-1/cpn60 chaperonin family protein                   109   3e-25   
ref|XP_006652052.1|  PREDICTED: ruBisCO large subunit-binding pro...    112   3e-25   
ref|WP_034421574.1|  molecular chaperone GroEL                          111   3e-25   
emb|CDX83280.1|  BnaA03g22260D                                          112   3e-25   
ref|WP_042401139.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_015218965.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_045085260.1|  molecular chaperone GroEL [                        111   3e-25   
ref|WP_033213939.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_030368350.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_003371161.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_035786254.1|  molecular chaperone GroEL                          111   3e-25   
ref|XP_001769377.1|  predicted protein                                  112   3e-25   
ref|WP_012451848.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_035863461.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_041082463.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_030904998.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_045852576.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_030251466.1|  molecular chaperone GroEL                          111   3e-25   
sp|P08926.2|RUBA_PEA  RecName: Full=RuBisCO large subunit-binding...    112   3e-25   
ref|WP_009138282.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_009643616.1|  MULTISPECIES: molecular chaperone GroEL            111   3e-25   
ref|WP_014136231.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_012627767.1|  molecular chaperone GroEL                          111   3e-25   
ref|WP_034840261.1|  molecular chaperone GroEL [                        111   3e-25   
ref|WP_030457378.1|  molecular chaperone GroEL                          111   3e-25   
gb|KJF16264.1|  60 kDa chaperonin 1                                     111   3e-25   
ref|WP_043914500.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_022518278.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_036740677.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_019527934.1|  MULTISPECIES: molecular chaperone GroEL            111   4e-25   
dbj|BAH22173.1|  GroEL                                                  110   4e-25   
ref|WP_010472301.1|  MULTISPECIES: molecular chaperone GroEL            111   4e-25   
ref|WP_031180833.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_009449110.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_009626159.1|  molecular chaperone GroEL                          111   4e-25   
gb|ERJ84793.1|  chaperonin GroL                                         111   4e-25   
ref|WP_017949607.1|  MULTISPECIES: molecular chaperone GroEL            111   4e-25   
ref|WP_013484328.1|  molecular chaperone GroEL                          111   4e-25   
dbj|BAH22152.1|  GroEL                                                  110   4e-25   
ref|WP_030112759.1|  molecular chaperone GroEL                          109   4e-25   
ref|WP_037858470.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_007500774.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_033817676.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_022008892.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_031012177.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_030317219.1|  molecular chaperone GroEL                          111   4e-25   
ref|WP_020135755.1|  molecular chaperone GroEL                          111   4e-25   



>gb|AAB39828.1| chaperonin-60 beta subunit, partial [Solanum tuberosum]
Length=174

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 5/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MA+TF+++ S   + S +QT++KK + SSETLSSF+ +S  +LGGRRKN VL+KR  SK+
Sbjct  1    MAATFTSVCS---IASTNQTVDKKFINSSETLSSFSGISLTSLGGRRKNKVLKKRNDSKI  57

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAK L+FN DGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  58   QAMAKKLHFNQDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  117

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGASLVRQAASKTNDL
Sbjct  118  REVELEDPVENIGASLVRQAASKTNDL  144



>emb|CDO97994.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 3/148 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSAS-QTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SK  287
            MASTF+AMS +G+++S S  T +KK + SSE LSS  S+S N LGGRR+NV+LRKR   K
Sbjct  1    MASTFTAMSCVGSLISPSTSTADKKFVSSSEALSSLTSISANKLGGRRQNVILRKRLSCK  60

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            V+AMAKDL+FN DGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  61   VQAMAKDLHFNKDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  120

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            A+EVELEDPVENIGA LVRQAASKTNDL
Sbjct  121  AKEVELEDPVENIGAKLVRQAASKTNDL  148



>ref|XP_004235655.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Solanum lycopersicum]
Length=605

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 5/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MA+TF+++ S+    S SQT+EKK + S ETLSSF+ +S  +LGGRRKN VL+KR  SK+
Sbjct  1    MAATFTSVCSIS---STSQTVEKKIINSCETLSSFSGISLTSLGGRRKNNVLKKRNDSKI  57

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAK+L+FN DGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  58   QAMAKELHFNQDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  117

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGASLVRQAASKTNDL
Sbjct  118  REVELEDPVENIGASLVRQAASKTNDL  144



>ref|XP_006343054.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Solanum tuberosum]
Length=605

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 5/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MA+TF+++ S   + S +QT++KK + SSETLSSF+ +S  +LGGRRKN VL+KR  SK+
Sbjct  1    MAATFTSVCS---IASTNQTVDKKFINSSETLSSFSGISLTSLGGRRKNKVLKKRNDSKI  57

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAK L+FN DGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  58   QAMAKKLHFNQDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  117

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGASLVRQAASKTNDL
Sbjct  118  REVELEDPVENIGASLVRQAASKTNDL  144



>ref|XP_002284134.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 ref|XP_010654639.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 emb|CBI36094.3| unnamed protein product [Vitis vinifera]
Length=609

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSAS-QTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS--K  287
            MAS+F+ MSS+G   S+S  T++KK L SS  LSSFAS+S N+  GR++++VL+KR   K
Sbjct  1    MASSFATMSSIGYFTSSSSHTMDKKFLGSSRRLSSFASISANSFEGRKQSMVLQKRCSPK  60

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            VRAMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV
Sbjct  61   VRAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  120

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAASKTNDL
Sbjct  121  AREVELEDPVENIGARLVRQAASKTNDL  148



>ref|XP_010254011.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nelumbo nucifera]
Length=608

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSA-SQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS-KV  290
            MAST + +SS+G++ +A ++ ++KK   S E LSSFAS+S ++LGGRR+NV+L +RS K+
Sbjct  1    MASTIATISSVGSLAAAGNRAVDKKLSSSLEKLSSFASISSSSLGGRRQNVILSRRSPKI  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  61   MAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  120

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  REVELEDPVENIGAKLVRQAAAKTNDL  147



>ref|XP_002523404.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
 gb|EEF38983.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
Length=605

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 130/147 (88%), Gaps = 5/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MASTF+AMSS+G++V+ +  ++KK   +S  LSSFAS+S +A G RR+NVVLR+ RS K+
Sbjct  1    MASTFTAMSSVGSLVAPN--VDKKFASTSNRLSSFASISGSAFG-RRQNVVLRRSRSPKI  57

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAKDL+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  58   CAMAKDLHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  117

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  118  KEVELEDPVENIGAKLVRQAAAKTNDL  144



>ref|XP_010249575.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nelumbo nucifera]
Length=609

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 3/148 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAV-VSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS--K  287
            MAST + MSS+G++ V+ S+ ++KK   SSE LSSFAS+S ++  GRR NV+L +R   K
Sbjct  1    MASTIATMSSVGSLAVAGSRAMDKKFSSSSENLSSFASISSSSFSGRRHNVILSRRCFPK  60

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +RAMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV
Sbjct  61   IRAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  120

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            A+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  AKEVELEDPVENIGAKLVRQAAAKTNDL  148



>gb|KJB56809.1| hypothetical protein B456_009G136600 [Gossypium raimondii]
 gb|KJB56810.1| hypothetical protein B456_009G136600 [Gossypium raimondii]
Length=609

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAV-VSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSK  287
            MAS+F AMSS+G++    S+ ++KK   SS  LSSF S+S +A  G+++ V+LR+   SK
Sbjct  1    MASSFIAMSSIGSLGFPCSKQMDKKFFNSSGRLSSFESISSSAFLGKKQKVILRRGHSSK  60

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +RAMAK+L+FNTDGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV
Sbjct  61   IRAMAKELHFNTDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  120

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            A+EVELEDPVENIGA LVRQAASKTNDL
Sbjct  121  AKEVELEDPVENIGARLVRQAASKTNDL  148



>ref|XP_011089709.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Sesamum indicum]
Length=608

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  290
            MASTF+ MSS+G++ +    +    + +S +  S  +   ++  GRRKNVVLRK   S++
Sbjct  1    MASTFAGMSSVGSLAAPGSRVMDDKIAASSSKLSSLASISSSSLGRRKNVVLRKTRSSQI  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AKDLYFN DGSAIK+LQ+GVNKLAD+VGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  61   TAAAKDLYFNKDGSAIKRLQSGVNKLADIVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  120

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  KEVELEDPVENIGAKLVRQAAAKTNDL  147



>gb|KCW87049.1| hypothetical protein EUGRSUZ_B03593 [Eucalyptus grandis]
Length=620

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 115/147 (78%), Gaps = 2/147 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  290
            MASTF+AMSS G + +    +  K L +S    S  S   ++  GRR+ V LRK    K+
Sbjct  1    MASTFTAMSSAGTLAAPGSCVMDKKLATSLDKLSSVSSISSSSFGRRRTVSLRKSREPKI  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAKDLYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  61   CAMAKDLYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  120

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  KEVELEDPVENIGAKLVRQAAAKTNDL  147



>ref|XP_008809220.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Phoenix dactylifera]
Length=612

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 123/151 (81%), Gaps = 6/151 (4%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIE----kkslkssetlssfaslsPNALGGRRKNVVLRKR-  281
            MASTFS MS++G+V + S  +       S +    LSS AS S ++L GRR+N+ L+KR 
Sbjct  1    MASTFSTMSTIGSVAAPSSFVTDRKLSASAQKFSKLSSLASSSSSSLSGRRQNLHLQKRC  60

Query  282  -SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG  458
             S +RAMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG
Sbjct  61   NSGIRAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG  120

Query  459  VTVAREVELEDPVENIGASLVRQAASKTNDL  551
            VTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  VTVAKEVELEDPVENIGAKLVRQAAAKTNDL  151



>ref|XP_010044926.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW87050.1| hypothetical protein EUGRSUZ_B03593 [Eucalyptus grandis]
Length=608

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 115/147 (78%), Gaps = 2/147 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  290
            MASTF+AMSS G + +    +  K L +S    S  S   ++  GRR+ V LRK    K+
Sbjct  1    MASTFTAMSSAGTLAAPGSCVMDKKLATSLDKLSSVSSISSSSFGRRRTVSLRKSREPKI  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAKDLYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  61   CAMAKDLYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  120

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  KEVELEDPVENIGAKLVRQAAAKTNDL  147



>emb|CDP18583.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 119/148 (80%), Gaps = 3/148 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTI-EkkslkssetlssfaslsPNALGGRRKNVVLRKR--SK  287
            MASTF+ MSS+G++ + S  I +   L +S    S  +   ++  GR++NVVLRK   S+
Sbjct  1    MASTFAGMSSVGSLAAPSTCIIDNNKLAASSNKLSSLACISSSSFGRKRNVVLRKSRSSQ  60

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            + A AK+LYFN DGSAIKKLQ GVNKL+DLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV
Sbjct  61   ITASAKELYFNKDGSAIKKLQIGVNKLSDLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  120

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  AREVELEDPVENIGAKLVRQAAAKTNDL  148



>ref|XP_009382612.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=609

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQ-TIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SK  287
            MASTFS MS++G++ +A+    +K S +     SS AS+S  +   RR+N++++KR  S+
Sbjct  1    MASTFSTMSTIGSLGAATCLHADKASAEKFSKFSSLASISSGSSSSRRQNLLMQKRCNSR  60

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +RAMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  61   IRAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  120

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            A+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  AKEVELEDPVENIGAKLVRQAAAKTNDL  148



>ref|XP_009793336.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nicotiana sylvestris]
Length=605

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS--KV  290
            MA+TF+++ S   + S SQ ++KK + SSE LSSF+++S ++LGGRRKN VL+KR   K+
Sbjct  1    MAATFTSVCS---IASTSQAVDKKLINSSEILSSFSAISSSSLGGRRKNTVLKKRYDFKI  57

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +A  K L+FN DG AI+KLQAGV+KLA+LVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  58   QAATKKLHFNQDGDAIRKLQAGVDKLANLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  117

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGASLVRQAASKTNDL
Sbjct  118  REVELEDPVENIGASLVRQAASKTNDL  144



>ref|XP_002285746.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 ref|XP_010651396.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 emb|CBI16557.3| unnamed protein product [Vitis vinifera]
Length=608

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MAS F+ MSS+G++ +       K L +S    S  +   ++  GRR+NVVLR+ RS ++
Sbjct  1    MASAFTTMSSVGSLAAPGGRGMDKKLATSSDRLSSFASISSSSFGRRQNVVLRRTRSPRI  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAKDLYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  61   NAMAKDLYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  120

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  KEVELEDPVENIGAKLVRQAAAKTNDL  147



>ref|XP_009628147.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=605

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS--KV  290
            MA+TF+++ S   + S SQ ++KK + SSETLSSF ++S ++LGGR+KN VL+KR   K+
Sbjct  1    MAATFTSVCS---IASTSQAVDKKLINSSETLSSFTAISSSSLGGRKKNTVLKKRYDFKI  57

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +A  K L+FN DG AI+KLQAGV+KLA+LVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  58   QAATKKLHFNQDGDAIRKLQAGVDKLANLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  117

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGASLVRQAASKTNDL
Sbjct  118  REVELEDPVENIGASLVRQAASKTNDL  144



>ref|XP_004144069.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Cucumis sativus]
 gb|KGN66351.1| hypothetical protein Csa_1G599450 [Cucumis sativus]
Length=608

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 127/148 (86%), Gaps = 4/148 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVS-ASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SK  287
            MASTF+AMSS+G + +  S+ ++KK L SS+ L+S  S+S  AL  +R++VVLR+   SK
Sbjct  1    MASTFTAMSSIGTLAAPGSRVMDKKLLSSSDKLTSRTSISSFALP-KRQSVVLRRNRSSK  59

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            + AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV
Sbjct  60   ISAMAKELHFNQDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  119

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            A+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  AKEVELEDPVENIGAKLVRQAAAKTNDL  147



>ref|XP_012080824.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Jatropha 
curcas]
 ref|XP_012080825.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Jatropha 
curcas]
 gb|KDP30625.1| hypothetical protein JCGZ_16190 [Jatropha curcas]
Length=605

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 5/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MASTF+AMSSL A    +  +  K+L SS    S  +    +  GRR+NVVLR+ RS K+
Sbjct  1    MASTFTAMSSLAA---PNGRVMDKNLASSSNRLSSFASISGSSFGRRQNVVLRRSRSPKI  57

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  58   NAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  117

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  118  KEVELEDPVENIGAKLVRQAAAKTNDL  144



>ref|XP_010920048.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Elaeis guineensis]
 ref|XP_010920049.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=611

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 119/150 (79%), Gaps = 5/150 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTI---EkkslkssetlssfaslsPNALGGRRKNVVLRKRS-  284
            MASTFS MS++G V +    +   +        + SS AS+S ++L GR  N+ L+KR  
Sbjct  1    MASTFSTMSTIGYVAAPGGFVTDRKLAVSAQKFSFSSLASISSSSLSGRWHNLHLQKRCN  60

Query  285  -KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGV  461
             ++RAMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGV
Sbjct  61   CRIRAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGV  120

Query  462  TVAREVELEDPVENIGASLVRQAASKTNDL  551
            TVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  TVAKEVELEDPVENIGAKLVRQAAAKTNDL  150



>ref|XP_008221851.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Prunus mume]
Length=605

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 6/147 (4%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS--KV  290
            MASTF+AM+S+G++ + S  +     +  + LSS AS+SP +   RR NVVLR+    ++
Sbjct  1    MASTFAAMTSVGSLAAPSSRV---IDRKFDNLSSRASISPFSFS-RRHNVVLRRTQSPRI  56

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  57   SAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  116

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  117  KEVELEDPVENIGAKLVRQAAAKTNDL  143



>ref|XP_007208310.1| hypothetical protein PRUPE_ppa003093mg [Prunus persica]
 gb|EMJ09509.1| hypothetical protein PRUPE_ppa003093mg [Prunus persica]
Length=605

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 123/147 (84%), Gaps = 6/147 (4%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MASTF+AM+S+G++ + S  +     +  + LSS AS+SP +   RR NVVLR+ RS ++
Sbjct  1    MASTFAAMTSVGSLAAPSSRV---IDRKFDNLSSRASISPFSFS-RRHNVVLRRTRSPRI  56

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  57   CAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  116

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  117  KEVELEDPVENIGAKLVRQAAAKTNDL  143



>ref|XP_008451008.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Cucumis melo]
Length=608

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 127/148 (86%), Gaps = 4/148 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVS-ASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SK  287
            MASTF+AMSS+G + +  S+ ++KK L SS+ L+S  S+S  AL  +R++VVLR+   SK
Sbjct  1    MASTFTAMSSIGTLSAPGSRAMDKKLLPSSDKLTSRTSISSFALP-KRQSVVLRRNRSSK  59

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            + AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV
Sbjct  60   ISAMAKELHFNQDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  119

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            A+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  AKEVELEDPVENIGAKLVRQAAAKTNDL  147



>ref|XP_009597827.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Nicotiana 
tomentosiformis]
Length=599

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 119/147 (81%), Gaps = 11/147 (7%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MASTF+ MSS G + + S +        S  LSS A++S +A G RR NVVLRK RS K+
Sbjct  1    MASTFAGMSSAGPLAAPSTS--------SNKLSSVANISSSAFGSRR-NVVLRKARSPKI  51

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK+LYFN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA
Sbjct  52   SAAAKELYFNKDGSAIKRLQVGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA  111

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  REVELEDPVENIGAKLVRQAAAKTNDL  138



>ref|XP_008803228.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Phoenix dactylifera]
Length=608

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 2/103 (2%)
 Frame = +3

Query  249  GRRKNVVLRKR--SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLE  422
            GRR+NV L+KR  SK+ AMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLE
Sbjct  45   GRRQNVRLQKRCNSKISAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLE  104

Query  423  SKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            SKYGSPKIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  105  SKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  147



>ref|XP_010909417.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Elaeis guineensis]
Length=608

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = +3

Query  249  GRRKNVVLRKRS--KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLE  422
            GRR+NV LRKR   K+ AMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLE
Sbjct  45   GRRQNVSLRKRCNLKINAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLE  104

Query  423  SKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            SKYGSP+IVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  105  SKYGSPRIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  147



>ref|XP_010671843.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=606

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 4/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTF++MS++ A    ++ ++KKSL  ++ LSS AS+S ++   RR N+VLRK   +KV
Sbjct  1    MASTFTSMSAMAA--PGARVMDKKSLTCADKLSSLASVSSSSALSRRPNIVLRKSRSAKV  58

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+LYFN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESK+GSPKIVNDGVTVA
Sbjct  59   NAMAKELYFNKDGSAIKRLQNGVNKLADLVGVTLGPKGRNVVLESKFGSPKIVNDGVTVA  118

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  119  REVELEDPVENIGAKLVRQAAAKTNDL  145



>gb|AFI08589.1| cyclophilin, partial [Rhododendron micranthum]
Length=211

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = +3

Query  249  GRRKNVVLRK-RS-KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLE  422
            GR +NV LR+ RS ++ AMAK+LYFN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLE
Sbjct  2    GRSQNVFLRRARSPRINAMAKELYFNKDGSAIKRLQNGVNKLADLVGVTLGPKGRNVVLE  61

Query  423  SKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            SKYGSPKIVNDGVTVAREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  62   SKYGSPKIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDL  104



>gb|EYU32832.1| hypothetical protein MIMGU_mgv1a003115mg [Erythranthe guttata]
Length=607

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 117/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTF+ +S++G++ +    +   +  ++    S  +   ++  GRR +VVLRK+  S++
Sbjct  1    MASTFAGVSTVGSLAATGSRV-MDNKIAASNKLSSLASISSSSLGRRNSVVLRKQRSSQI  59

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AKDLYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA
Sbjct  60   TAAAKDLYFNKDGSAIKKLQIGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  REVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_007014617.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
 gb|EOY32236.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
Length=607

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+AMSS+G+ V+ +  +  K L SS    S  +   +   G R+NVVLR+ R    
Sbjct  1    MASTFTAMSSVGSFVAPNGRVMDKKLASSSNRLSSFASISSTAFGMRQNVVLRRTRLPKI  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
            + AK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+
Sbjct  61   SAAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_004294947.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=601

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 9/147 (6%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MASTF+AM+S+G++ + S  +  K L S  +++SF+         +R NV LR+ RS +V
Sbjct  1    MASTFAAMTSVGSLAAPSGRVADKKLSSRASIASFSFS-------KRPNVALRRTRSPRV  53

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  54   SAMAKELHFNKDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  113

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  114  KEVELEDPVENIGAKLVRQAAAKTNDL  140



>gb|ABR13306.1| putative GloEL protein:chaperonin, 60kDa [Prunus dulcis]
Length=166

 Score =   168 bits (425),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 2/102 (2%)
 Frame = +3

Query  252  RRKNVVLRK-RS-KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLES  425
            RR NVVLR+ RS ++ AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLES
Sbjct  21   RRHNVVLRRTRSPRICAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLES  80

Query  426  KYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            KYGSPKIVNDGVTVA+EVELEDPVENIGA LVR+AA+KTNDL
Sbjct  81   KYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRRAAAKTNDL  122



>ref|XP_008351333.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Malus 
domestica]
 ref|XP_008351340.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Malus 
domestica]
Length=604

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 117/147 (80%), Gaps = 7/147 (5%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTF+AM+S+G++ + S+ I++K    S   S  +         RR++V +R+    ++
Sbjct  1    MASTFAAMTSVGSLAAPSRVIDRKFDNLSSRASISSFSL-----SRRQHVAMRRTRAPRI  55

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  56   CAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  115

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  116  KEVELEDPVENIGAKLVRQAAAKTNDL  142



>ref|XP_009790232.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Nicotiana 
sylvestris]
Length=599

 Score =   177 bits (450),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 113/147 (77%), Gaps = 11/147 (7%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MASTF+ MSS G + + S +             S  +   ++  G R+NVVLRK RS K+
Sbjct  1    MASTFAGMSSAGPLAAPSTS---------SNKLSSVANISSSSFGSRRNVVLRKARSPKI  51

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK+LYFN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA
Sbjct  52   SAAAKELYFNKDGSAIKRLQVGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA  111

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  REVELEDPVENIGAKLVRQAAAKTNDL  138



>ref|XP_007024263.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
 gb|EOY26885.1| TCP-1/cpn60 chaperonin family protein [Theobroma cacao]
Length=608

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  290
            M S+F+A+         S+T++KK L SS  LSSF S+S +A+ GR++NV+LR+   SK+
Sbjct  1    MTSSFNALLYSSPAFPCSRTMDKKFLSSSGRLSSFDSISSSAIVGRKQNVILRRGHSSKI  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESK+GSPKIVNDGVTVA
Sbjct  61   WAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKFGSPKIVNDGVTVA  120

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELE PVENIGA LVRQAASKTNDL
Sbjct  121  KEVELEHPVENIGARLVRQAASKTNDL  147



>ref|XP_010942728.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Elaeis guineensis]
Length=608

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = +3

Query  249  GRRKNVVLRKR--SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLE  422
            GRR+NV L+KR  SK+ AMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLE
Sbjct  45   GRRQNVRLQKRCNSKISAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLE  104

Query  423  SKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            SKYGSPKIVNDGVTVA+EVELED VENIGA LVRQAA+KTNDL
Sbjct  105  SKYGSPKIVNDGVTVAKEVELEDAVENIGAKLVRQAAAKTNDL  147



>ref|XP_008384375.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Malus domestica]
 ref|XP_008384376.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Malus domestica]
Length=605

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 116/147 (79%), Gaps = 6/147 (4%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MASTF+AM+S+G++ + S  +    +       S  +   +    RR+NV LR+ RS ++
Sbjct  1    MASTFAAMTSVGSLAAPSGRV----IDRKFDNLSSXASFSSFSVSRRQNVALRRTRSPRI  56

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  57   CAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  116

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  117  KEVELEDPVENIGAKLVRQAAAKTNDL  143



>gb|KJB73257.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=496

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+AMSS+G+ V+ +  +  K L SS    S  +   ++    R+NVVLR RS++  
Sbjct  1    MASTFTAMSSVGSFVAPNGLVMDKKLSSSSNRLSSLASISSSSFVSRRNVVLR-RSRLPK  59

Query  297  M--AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +  AK+L+FN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  60   ISAAKELHFNKDGSAIKRLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_010552318.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic [Tarenaya 
hassleriana]
Length=595

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 112/146 (77%), Gaps = 13/146 (9%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+A SSLG++++ +  I                LS ++  GRR+NV  R+ RS V 
Sbjct  1    MASTFTATSSLGSMIAPNGHI------------LDKKLSSSSSFGRRQNVAPRRVRSAVV  48

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+L+FN DG+ IKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  49   CAAKELHFNKDGTTIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  108

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  109  EVELEDPVENIGAKLVRQAAAKTNDL  134



>gb|KEH15462.1| TCP-1/cpn60 chaperonin family protein, partial [Medicago truncatula]
Length=188

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 94/106 (89%), Gaps = 6/106 (6%)
 Frame = +3

Query  252  RRK---NVVLRKRS---KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNV  413
            RRK   NV L ++S   KV AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNV
Sbjct  25   RRKTTSNVALTRKSRNPKVSAMAKELHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNV  84

Query  414  VLESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            VLESKYGSPKIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  85   VLESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  130



>emb|CDX82537.1| BnaA03g32840D [Brassica napus]
Length=587

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 109/146 (75%), Gaps = 18/146 (12%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+A SSLG++++ +                 A   P++  G+R+NV  R+    + 
Sbjct  1    MASTFTATSSLGSLIAPN-----------------ALKFPSSTFGKRQNVCSRRTHPAIV  43

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+L+FN DGS IKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  44   CAAKELHFNKDGSTIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  103

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  104  EVELEDPVENIGAKLVRQAAAKTNDL  129



>ref|XP_008813151.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like isoform X1 [Phoenix dactylifera]
Length=608

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = +3

Query  240  ALGGRRKNVVLRKRS--KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNV  413
            ++ GRR+NV  RKR   K+ AMAK+LYFN DGSA KKLQ GVNKLADLVGVTLGPKGRNV
Sbjct  42   SVSGRRQNVCPRKRCNLKINAMAKELYFNKDGSATKKLQTGVNKLADLVGVTLGPKGRNV  101

Query  414  VLESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            VLESKYGSP+IVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  102  VLESKYGSPRIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  147



>ref|XP_009135307.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Brassica 
rapa]
Length=590

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 109/146 (75%), Gaps = 18/146 (12%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+A SSLG++++ +                 A   P++  G+R+NV  R+    + 
Sbjct  1    MASTFTATSSLGSLIAPN-----------------ALKFPSSTFGKRQNVCSRRTHPAIV  43

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+L+FN DGS IKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  44   CAAKELHFNKDGSTIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  103

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  104  EVELEDPVENIGAKLVRQAAAKTNDL  129



>gb|KJB73262.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=549

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+AMSS+G+ V+ +  +  K L SS    S  +   ++    R+NVVLR RS++  
Sbjct  1    MASTFTAMSSVGSFVAPNGLVMDKKLSSSSNRLSSLASISSSSFVSRRNVVLR-RSRLPK  59

Query  297  M--AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +  AK+L+FN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  60   ISAAKELHFNKDGSAIKRLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>gb|KHG01053.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Gossypium arboreum]
 gb|KHG01054.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Gossypium arboreum]
Length=607

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+AMSS+G+ V+ +  +  K L SS    S  +   ++    R+NVVLR RS++  
Sbjct  1    MASTFTAMSSVGSFVAPNGLVMDKKLPSSSNRLSSLASISSSSFVSRRNVVLR-RSRLPK  59

Query  297  M--AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +  AK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  60   ISAAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>gb|EPS66563.1| hypothetical protein M569_08214, partial [Genlisea aurea]
Length=200

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 113/146 (77%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKV-R  293
            MAS+F+  S++G++ ++    +K    S    S  A  S  ++ GR+K +  ++R+ V  
Sbjct  1    MASSFAGPSAVGSLAASRIVDDKVVASSIRLSSLSAISSSGSILGRKKVLRTKQRASVIT  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
            A  KDLYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKI+NDGVTVA+
Sbjct  61   AAKKDLYFNKDGSAIKKLQIGVNKLADLVGVTLGPKGRNVVLESKYGAPKIINDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_009376036.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=605

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 6/147 (4%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTF+AM+S+G++ + S  +  +   S  + +S +S S +    RR+NV +R+    ++
Sbjct  1    MASTFAAMTSVGSLAAPSGRVVDRKFDSLSSRASISSFSLS----RRQNVAMRRTRAPRI  56

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  57   CAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  116

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  117  KEVELEDPVENIGAKLVRQAAAKTNDL  143



>ref|XP_006297271.1| hypothetical protein CARUB_v10013285mg [Capsella rubella]
 gb|EOA30169.1| hypothetical protein CARUB_v10013285mg [Capsella rubella]
Length=596

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 110/158 (70%), Gaps = 36/158 (23%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALG------------GRRK  260
            MAS F+A SSLG++V+                       PNA+             GRR+
Sbjct  1    MASAFTATSSLGSLVA-----------------------PNAIKLSSATSLSSSSFGRRQ  37

Query  261  NVVLRK-RSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGS  437
            N+ LR+ R  +   AKDL+FN DG+ I+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGS
Sbjct  38   NLCLRRSRPAIVCAAKDLHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGS  97

Query  438  PKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            P+IVNDGVTVAREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  98   PRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDL  135



>ref|XP_009392770.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=612

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 6/151 (4%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIE----kkslkssetlssfaslsPNALGGRRKNVVLRKR-  281
            MA+TF AMS++GA+ S S          S +     SSF+S+SP A+ GR +++   +R 
Sbjct  1    MAATFYAMSTVGAIASPSNVRPNKKLLASKQKFSQFSSFSSISPIAISGRGQSLCYLRRG  60

Query  282  -SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG  458
             SK+ AMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG
Sbjct  61   NSKINAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG  120

Query  459  VTVAREVELEDPVENIGASLVRQAASKTNDL  551
            VTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  VTVAKEVELEDPVENIGAKLVRQAAAKTNDL  151



>ref|XP_009376045.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=605

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 6/147 (4%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTF+AM+S+G++ + S  +  +   S  + +S +S S +    RR+NV +R+    ++
Sbjct  1    MASTFAAMTSVGSLAAPSGRVVDRKFDSLSSRASISSFSLS----RRQNVAMRRTRAPRI  56

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  57   CAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  116

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  117  KEVELEDPVENIGAKLVRQAAAKTNDL  143



>ref|XP_010500599.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Camelina 
sativa]
Length=596

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 111/158 (70%), Gaps = 36/158 (23%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALG------------GRRK  260
            MASTF+A SSLG++V+                       PNA+             GRR+
Sbjct  1    MASTFTATSSLGSLVA-----------------------PNAIKLSSAASISSSSFGRRQ  37

Query  261  NVVLRK-RSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGS  437
            N+ LR+ R  +   AKDL+FN DG+ I++LQ+GVNKLADLVGVTLGPKGRNVVLESKYGS
Sbjct  38   NLCLRRSRPAIVCAAKDLHFNKDGTTIRRLQSGVNKLADLVGVTLGPKGRNVVLESKYGS  97

Query  438  PKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            P+IVNDGVTVAREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  98   PRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDL  135



>ref|XP_010103092.1| Chaperonin 60 subunit beta 2 [Morus notabilis]
 gb|EXB94815.1| Chaperonin 60 subunit beta 2 [Morus notabilis]
Length=603

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 111/146 (76%), Gaps = 5/146 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS-KVR  293
            MASTF+AMSS G++ + S  +            S +S   +    RR+N V R  S ++ 
Sbjct  1    MASTFAAMSSAGSLAAPSSRV----TDMKFQKLSSSSSISSCSFVRRQNFVRRTPSPRIS  56

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
            AMAK+L+FN DGS IKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  57   AMAKELHFNKDGSTIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  116

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  117  EVELEDPVENIGAKLVRQAAAKTNDL  142



>ref|XP_007149220.1| hypothetical protein PHAVU_005G051700g [Phaseolus vulgaris]
 gb|ESW21214.1| hypothetical protein PHAVU_005G051700g [Phaseolus vulgaris]
Length=593

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 115/150 (77%), Gaps = 23/150 (15%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKN--VVLRKRSK-  287
            MASTFSAMSS    +S+S  I               S  P + G RR++  VVL +RS+ 
Sbjct  1    MASTFSAMSSYK--LSSSAAI---------------SSFPFS-GSRRQSNGVVLARRSRN  42

Query  288  --VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGV  461
              V AMAK+L+FN DG+AIKKLQ+GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGV
Sbjct  43   ARVSAMAKELHFNKDGTAIKKLQSGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGV  102

Query  462  TVAREVELEDPVENIGASLVRQAASKTNDL  551
            TVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  103  TVAKEVELEDPVENIGAKLVRQAAAKTNDL  132



>gb|KJB73258.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=599

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+AMSS+G+ V+ +  +  K L SS    S  +   ++    R+NVVLR RS++  
Sbjct  1    MASTFTAMSSVGSFVAPNGLVMDKKLSSSSNRLSSLASISSSSFVSRRNVVLR-RSRLPK  59

Query  297  M--AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +  AK+L+FN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  60   ISAAKELHFNKDGSAIKRLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>gb|KJB73253.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
 gb|KJB73254.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
 gb|KJB73255.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
 gb|KJB73256.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
 gb|KJB73261.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=607

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+AMSS+G+ V+ +  +  K L SS    S  +   ++    R+NVVLR RS++  
Sbjct  1    MASTFTAMSSVGSFVAPNGLVMDKKLSSSSNRLSSLASISSSSFVSRRNVVLR-RSRLPK  59

Query  297  M--AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +  AK+L+FN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  60   ISAAKELHFNKDGSAIKRLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>gb|KJB73259.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=603

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+AMSS+G+ V+ +  +  K L SS    S  +   ++    R+NVVLR RS++  
Sbjct  1    MASTFTAMSSVGSFVAPNGLVMDKKLSSSSNRLSSLASISSSSFVSRRNVVLR-RSRLPK  59

Query  297  M--AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +  AK+L+FN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  60   ISAAKELHFNKDGSAIKRLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>gb|KJB73260.1| hypothetical protein B456_011G224500 [Gossypium raimondii]
Length=610

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+AMSS+G+ V+ +  +  K L SS    S  +   ++    R+NVVLR RS++  
Sbjct  1    MASTFTAMSSVGSFVAPNGLVMDKKLSSSSNRLSSLASISSSSFVSRRNVVLR-RSRLPK  59

Query  297  M--AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +  AK+L+FN DGSAIK+LQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  60   ISAAKELHFNKDGSAIKRLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|NP_001275097.1| chaperonin-60 beta subunit [Solanum tuberosum]
 gb|AAB39827.1| chaperonin-60 beta subunit [Solanum tuberosum]
Length=599

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 114/147 (78%), Gaps = 11/147 (7%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  290
            MASTF+ MSS G + + S +  K S  ++ + +SF         G ++NV LRK  R  +
Sbjct  1    MASTFAGMSSAGPLAAPSTSSNKLSSVANISSTSF---------GSKRNVALRKSRRPTI  51

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA
Sbjct  52   LAAAKELHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA  111

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  REVELEDPVENIGAKLVRQAAAKTNDL  138



>ref|XP_008813152.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like isoform X2 [Phoenix dactylifera]
Length=601

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 105/150 (70%), Gaps = 26/150 (17%)
 Frame = +3

Query  108  LWSMASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS-  284
            L + A  FS  SSL  + S S                        + GRR+NV  RKR  
Sbjct  15   LSASAKRFSQFSSLAFISSTS------------------------VSGRRQNVCPRKRCN  50

Query  285  -KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGV  461
             K+ AMAK+LYFN DGSA KKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGV
Sbjct  51   LKINAMAKELYFNKDGSATKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGV  110

Query  462  TVAREVELEDPVENIGASLVRQAASKTNDL  551
            TVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  111  TVAKEVELEDPVENIGAKLVRQAAAKTNDL  140



>ref|XP_011048163.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like [Populus 
euphratica]
Length=607

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 114/147 (78%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVL-RKRS-KV  290
            MASTF+AMSS GA+ + +     K    S    S  +    +  GR +NVVL R RS KV
Sbjct  1    MASTFTAMSSAGALAAPNARAMDKKFAFSSNKLSSFASISASRFGRPQNVVLPRSRSLKV  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK+L+FN DGSAI+KLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  61   NA-AKELHFNKDGSAIRKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_010920050.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=604

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 2/103 (2%)
 Frame = +3

Query  249  GRRKNVVLRKRS--KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLE  422
            GR  N+ L+KR   ++RAMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLE
Sbjct  41   GRWHNLHLQKRCNCRIRAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLE  100

Query  423  SKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            SKYGSPKIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  101  SKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  143



>ref|XP_011025126.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Populus 
euphratica]
Length=607

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 114/147 (78%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVL-RKRS-KV  290
            MASTF+AMSS+G + + +     K    S    S  +    +  GR +NVVL R RS KV
Sbjct  1    MASTFTAMSSVGTLAAPNGRAMDKKFVFSSNKLSSFASISASRFGRPQNVVLPRSRSLKV  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  61   NA-AKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_010094358.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
 gb|EXB55869.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
Length=769

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS-KVR  293
            MASTF+AMSS G++ + S  +            S +S   +    +R+NVV R    ++ 
Sbjct  1    MASTFAAMSSAGSLAAPSGRV----ADIKFQKLSSSSSISSCSFVKRRNVVRRTAPPRIS  56

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
            AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  57   AMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  116

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  117  EVELEDPVENIGAKLVRQAAAKTNDL  142



>ref|XP_010487110.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like [Camelina 
sativa]
Length=596

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 110/158 (70%), Gaps = 36/158 (23%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALG------------GRRK  260
            MASTF+A SSL ++V+                       PNA+             GRR+
Sbjct  1    MASTFTATSSLSSLVA-----------------------PNAIKLSSAASISSSSFGRRQ  37

Query  261  NVVLRK-RSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGS  437
            N+ LRK R  +   AKDL+FN DG+ I++LQ+GVNKLADLVGVTLGPKGRNVVLESKYGS
Sbjct  38   NLCLRKSRPAIVCAAKDLHFNKDGTTIRRLQSGVNKLADLVGVTLGPKGRNVVLESKYGS  97

Query  438  PKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            P+IVNDGVTVAREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  98   PRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDL  135



>ref|XP_002303983.1| chaperonin precursor family protein [Populus trichocarpa]
 gb|EEE78962.1| chaperonin precursor family protein [Populus trichocarpa]
Length=607

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 111/146 (76%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVL-RKRSKVR  293
            MASTF+AMSS+G + + +  +  K    S    S  +    +  GR +NVVL R R    
Sbjct  1    MASTFTAMSSVGTLAAPNGRVMDKKFVFSSNKLSSFASISASRFGRPQNVVLPRSRPLKV  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+
Sbjct  61   NAAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>gb|KJB10931.1| hypothetical protein B456_001G233100 [Gossypium raimondii]
Length=182

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 115/147 (78%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MA+TF AMSS+G+ V+ +  +  K L SS    S  +   ++    R+NVVLR RS++  
Sbjct  1    MATTFIAMSSVGSFVAPNGLVMDKKLSSSSYRLSSLASISSSSFLSRRNVVLR-RSRLPK  59

Query  297  M--AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +  AK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKY SPKIVNDGVTVA
Sbjct  60   ISAAKELHFNNDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYCSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTN L
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNGL  146



>ref|XP_004228946.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Solanum lycopersicum]
Length=599

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 114/147 (78%), Gaps = 11/147 (7%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  290
            MASTF+ MSS G + + S +  K S  ++ + +SF         G ++NV L+K  R  +
Sbjct  1    MASTFAGMSSAGPLAAPSTSSNKLSSVANISSTSF---------GSKRNVALKKSRRPTI  51

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA
Sbjct  52   LAAAKELHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA  111

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  REVELEDPVENIGAKLVRQAAAKTNDL  138



>gb|KDO54477.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=532

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+AMSS+ ++++ +  +  K L SS    S  +   ++  GRR++V LR+ R+   
Sbjct  1    MASTFTAMSSISSMIAPNGRMTDKKLASSSNKLSSLASISSSSFGRRQSVALRRARTPKI  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AKDL+FN DG A+KKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA+
Sbjct  61   YAAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>gb|KDO54476.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=531

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+AMSS+ ++++ +  +  K L SS    S  +   ++  GRR++V LR+ R+   
Sbjct  1    MASTFTAMSSISSMIAPNGRMTDKKLASSSNKLSSLASISSSSFGRRQSVALRRARTPKI  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AKDL+FN DG A+KKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA+
Sbjct  61   YAAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_006407212.1| hypothetical protein EUTSA_v10020346mg [Eutrema salsugineum]
 gb|ESQ48665.1| hypothetical protein EUTSA_v10020346mg [Eutrema salsugineum]
Length=596

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 111/146 (76%), Gaps = 12/146 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+A SSLG++V+ +               S A+   ++  GRR+NV  R+ R  + 
Sbjct  1    MASTFTATSSLGSLVAPN-----------AHKLSSANSISSSSFGRRQNVCPRRSRPAIV  49

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+L+FN DG+ IKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAR
Sbjct  50   CAAKELHFNKDGTTIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAR  109

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  110  EVELEDPVENIGAKLVRQAAAKTNDL  135



>gb|KDO54475.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=571

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+AMSS+ ++++ +  +  K L SS    S  +   ++  GRR++V LR+ R+   
Sbjct  1    MASTFTAMSSISSMIAPNGRMTDKKLASSSNKLSSLASISSSSFGRRQSVALRRARTPKI  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AKDL+FN DG A+KKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA+
Sbjct  61   YAAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_006838174.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Amborella trichopoda]
 gb|ERN00743.1| hypothetical protein AMTR_s00106p00119930 [Amborella trichopoda]
Length=613

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 111/152 (73%), Gaps = 7/152 (5%)
 Frame = +3

Query  117  MASTFSAMSSLG---AVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--  281
            MAST S MSS+G   A+ + S+  +        +  S  +   +     R  VV  +R  
Sbjct  1    MASTLSTMSSMGSLAAICNLSRDKKSSVSSEKYSQFSSLASISSTSFNNRSQVVRMQRRG  60

Query  282  --SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVND  455
              S +RAMAK+LYFN DGSA KKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVND
Sbjct  61   GSSGIRAMAKELYFNKDGSATKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVND  120

Query  456  GVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            GVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  GVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  152



>ref|XP_010465189.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin 60 subunit beta 2, 
chloroplastic [Camelina sativa]
Length=596

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 110/158 (70%), Gaps = 36/158 (23%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALG------------GRRK  260
            MASTF+A SSLG++V+                       PNA+             GRR+
Sbjct  1    MASTFTATSSLGSLVA-----------------------PNAIKLSSAASISSSSFGRRQ  37

Query  261  NVVLRK-RSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGS  437
            N+ LR+ R  +   AKDL+FN DG+ I++LQ+GVNKLADLVGVTLGPKGRNVVLESKYGS
Sbjct  38   NLCLRRSRPAIVCAAKDLHFNKDGTTIRRLQSGVNKLADLVGVTLGPKGRNVVLESKYGS  97

Query  438  PKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            P+IVNDGVTVAREVELEDPVENIGA LVR AA+KTNDL
Sbjct  98   PRIVNDGVTVAREVELEDPVENIGAKLVRXAAAKTNDL  135



>ref|XP_002297617.1| hypothetical protein POPTR_0001s03980g [Populus trichocarpa]
 gb|ABK95011.1| unknown [Populus trichocarpa]
 gb|EEE82422.1| hypothetical protein POPTR_0001s03980g [Populus trichocarpa]
Length=607

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 113/147 (77%), Gaps = 3/147 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVL-RKRS-KV  290
            MASTF+AMSS G + + +     K    S    S  +    +  GR +NVVL R RS KV
Sbjct  1    MASTFTAMSSAGTLAAPNARALDKKFAFSSNKLSSFASISASRFGRPQNVVLPRSRSLKV  60

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK+L+FN DGSAI+KLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  61   NA-AKELHFNKDGSAIRKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  119

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  120  KEVELEDPVENIGAKLVRQAAAKTNDL  146



>gb|KDO54472.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=601

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+AMSS+ ++++ +  +  K L SS    S  +   ++  GRR++V LR+ R+   
Sbjct  1    MASTFTAMSSISSMIAPNGRMTDKKLASSSNKLSSLASISSSSFGRRQSVALRRARTPKI  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AKDL+FN DG A+KKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA+
Sbjct  61   YAAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|XP_006445574.1| hypothetical protein CICLE_v10014640mg [Citrus clementina]
 ref|XP_006488950.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Citrus 
sinensis]
 gb|ESR58814.1| hypothetical protein CICLE_v10014640mg [Citrus clementina]
 gb|KDO54473.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=608

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+AMSS+ ++++ +  +  K L SS    S  +   ++  GRR++V LR+ R+   
Sbjct  1    MASTFTAMSSISSMIAPNGRMTDKKLASSSNKLSSLASISSSSFGRRQSVALRRARTPKI  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AKDL+FN DG A+KKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA+
Sbjct  61   YAAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>ref|NP_187956.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
 sp|Q9LJE4.1|CPNB2_ARATH RecName: Full=Chaperonin 60 subunit beta 2, chloroplastic; Short=CPN-60 
beta 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01754.1| GloEL protein; chaperonin, 60 kDa [Arabidopsis thaliana]
 gb|AEE75362.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
Length=596

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 109/158 (69%), Gaps = 36/158 (23%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALG------------GRRK  260
            MASTF+A SSLG++++                       PNA+             GRR 
Sbjct  1    MASTFTATSSLGSLLA-----------------------PNAIKLSSATSISSSSFGRRH  37

Query  261  NVVLRK-RSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGS  437
            NV +R+ R  +   AK+L+FN DG+ I+KLQ GVNKLADLVGVTLGPKGRNVVLESKYGS
Sbjct  38   NVCVRRSRPAIVCAAKELHFNKDGTTIRKLQTGVNKLADLVGVTLGPKGRNVVLESKYGS  97

Query  438  PKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            P+IVNDGVTVAREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  98   PRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDL  135



>gb|KDO54471.1| hypothetical protein CISIN_1g007313mg [Citrus sinensis]
Length=595

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MASTF+AMSS+ ++++ +  +  K L SS    S  +   ++  GRR++V LR+ R+   
Sbjct  1    MASTFTAMSSISSMIAPNGRMTDKKLASSSNKLSSLASISSSSFGRRQSVALRRARTPKI  60

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AKDL+FN DG A+KKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA+
Sbjct  61   YAAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAK  120

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  121  EVELEDPVENIGAKLVRQAAAKTNDL  146



>sp|P08927.2|RUBB_PEA RecName: Full=RuBisCO large subunit-binding protein subunit beta, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
beta; AltName: Full=CPN-60 beta; Flags: Precursor [Pisum sativum]
 gb|AAA66365.1| chaperonin precursor [Pisum sativum]
Length=595

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 108/149 (72%), Gaps = 20/149 (13%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS----  284
            MASTFSA +S    +S+S  I               S  P A G R  N V+  R     
Sbjct  1    MASTFSATTS-SCNLSSSAAI---------------SSFPLAAGKRNANKVVLPRKNRNV  44

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            KV AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT
Sbjct  45   KVSAMAKELHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  104

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            VA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  105  VAKEVELEDPVENIGAKLVRQAAAKTNDL  133



>emb|CAJ19275.1| beta chaperonin 60 [Solanum commersonii]
Length=600

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 114/147 (78%), Gaps = 11/147 (7%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  290
            MASTF+ MSS G + + S +  K S  ++ + +SF         G ++NV LRK  R  +
Sbjct  1    MASTFAGMSSAGPLAAPSTSSNKLSSVANISSTSF---------GSKRNVALRKSRRLTI  51

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVA
Sbjct  52   LAAAKELHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA  111

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPV+NIGA LVRQAA+KTNDL
Sbjct  112  REVELEDPVKNIGAKLVRQAAAKTNDL  138



>gb|ABK24483.1| unknown [Picea sitchensis]
Length=617

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 93/103 (90%), Gaps = 3/103 (3%)
 Frame = +3

Query  252  RRKNVVLRKRSKV---RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLE  422
            RR+ + LR R +V   RAMAK+LYFN DGSA KKLQAGVNKLADLVGVTLGPKGRNVVLE
Sbjct  54   RRQTMRLRNREQVVNTRAMAKELYFNKDGSATKKLQAGVNKLADLVGVTLGPKGRNVVLE  113

Query  423  SKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            SKYGSPKIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  114  SKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  156



>gb|AFW86142.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=388

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 103/146 (71%), Gaps = 29/146 (20%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +                             KNV L++R+  R 
Sbjct  1    MASTFGATSTVGLMAAPTG----------------------------KNVRLQRRANFRV  32

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  33   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  92

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  93   EVELEDPVENIGAKLVRQAAAKTNDL  118



>ref|XP_006307049.1| hypothetical protein CARUB_v10008637mg [Capsella rubella]
 gb|EOA39947.1| hypothetical protein CARUB_v10008637mg [Capsella rubella]
Length=600

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR---SK  287
            MASTF+A SS+G++V+ +           ++     S   ++  GRR+NV  R R   S 
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLISKLSSSSFGRRQNVCPRPRRSSSA  51

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I++LQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>sp|P21241.1|RUBB_BRANA RecName: Full=RuBisCO large subunit-binding protein subunit beta, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
beta; AltName: Full=CPN-60 beta; Flags: Precursor [Brassica 
napus]
 gb|AAA32980.1| 60-kDa beta-polypeptide of plastid chaperonin-60 precursor [Brassica 
napus]
Length=588

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVV--LRKRS-K  287
            MASTF+A SS+G++V+ +         + +T     +   ++  GRR+NV   LR+ S  
Sbjct  1    MASTFTATSSIGSMVAPN---------AHKTDKKLMNKLSSSSFGRRQNVFPKLRRSSPA  51

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            V   AK+L+FN DG+ I+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   VVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>emb|CDY26100.1| BnaC06g10960D [Brassica napus]
Length=628

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+A SS+G++V+ +           ++     +   ++  GRR+NV  R R    A
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLMNKLSSSSFGRRQNVCPRLRRSSPA  51

Query  297  M---AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>ref|XP_009106876.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Brassica rapa]
Length=600

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVV--LRKRS-K  287
            MASTF+A SS+G++V+ +         + +T     +   ++  GRR+NV   LR+ S  
Sbjct  1    MASTFTATSSIGSMVAPN---------AHKTDKKLMNKLSSSSFGRRQNVFPKLRRSSPA  51

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            V   AK+L+FN DG+ I+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   VVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>emb|CDY02438.1| BnaA08g00450D [Brassica napus]
Length=697

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVV--LRKRSK-  287
            MASTF+A SS+G++V+ +         + +T     +   ++  GRR+NV   LR+ S  
Sbjct  90   MASTFTATSSIGSMVAPN---------AHKTDKKLMNKLSSSSFGRRQNVFPKLRRSSPA  140

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            V   AK+L+FN DG+ I+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  141  VVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  200

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  201  AREVELEDPVENIGAKLVRQAAAKTNDL  228



>ref|XP_006392634.1| hypothetical protein EUTSA_v10011330mg [Eutrema salsugineum]
 gb|ESQ29920.1| hypothetical protein EUTSA_v10011330mg [Eutrema salsugineum]
Length=600

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+A SS+G++V+ +           ++     +   ++  GRR+N+  R R    A
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLMNKLSSSSFGRRQNMCARPRRSSPA  51

Query  297  M---AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>ref|XP_009339195.1| PREDICTED: LOW QUALITY PROTEIN: ruBisCO large subunit-binding 
protein subunit beta, chloroplastic-like [Pyrus x bretschneideri]
Length=607

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  290
            MASTF+AM+S+G++ + S  +     K      S  +   +    RR+NV +R+ RS ++
Sbjct  1    MASTFAAMTSVGSLAAPSGRV--IDRKIDIDNLSSRASFSSFSVSRRQNVAIRRTRSPRI  58

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  59   CAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  118

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  119  KEVELEDPVENIGAKLVRQAAAKTNDL  145



>ref|XP_002894506.1| CPN60B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70765.1| CPN60B [Arabidopsis lyrata subsp. lyrata]
Length=600

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR---SK  287
            MASTF+A SS+G++V+ +           ++     +   ++  GRR++V  R R   S 
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLMNKLSSSSFGRRQSVCPRPRRSGSA  51

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>emb|CDY08245.1| BnaA05g13740D [Brassica napus]
Length=600

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+A SS+G++V+ +           ++     +   ++  GRR+NV  R R    A
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLMNKLSSSSFGRRQNVCPRLRRSSPA  51

Query  297  M---AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I++LQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>ref|XP_009103725.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brassica rapa]
Length=600

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+A SS+G++V+ +           ++     +   ++  GRR+NV  R R    A
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLMNKLSSSSFGRRQNVCPRLRRSSPA  51

Query  297  M---AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I++LQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>ref|XP_010501159.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Camelina 
sativa]
Length=600

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR---SK  287
            MASTF+A SS+G++V+ +           ++     +   ++  GRR++V  R R   S 
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLTNKLSSSSFGRRQSVCPRPRRSSSA  51

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I++LQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>emb|CDX75713.1| BnaC03g37960D [Brassica napus]
Length=593

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 108/146 (74%), Gaps = 12/146 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RSKVR  293
            MAS F+A SSLG +V+                 S A+   ++  GRR+NV  R+ R  + 
Sbjct  1    MASIFTATSSLGPLVAP-----------ISPKLSSATSISSSSFGRRQNVCPRRPRPAIV  49

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+L+FN DGS IKKLQ GVNKLA+LVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  50   CAAKELHFNKDGSTIKKLQTGVNKLANLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  109

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  110  EVELEDPVENIGAKLVRQAAAKTNDL  135



>emb|CDY10557.1| BnaC03g70570D [Brassica napus]
Length=829

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 116/153 (76%), Gaps = 16/153 (10%)
 Frame = +3

Query  108  LWSMASTFSAMSSLGAVVS--ASQTIEkkslkssetlssfaslsPNALGGRRKNVV--LR  275
            L  MASTF+A SS+G++V+  A +T +K   K S +             GRR+NV   LR
Sbjct  226  LEKMASTFTATSSIGSMVAPNAHKTDKKLMNKLSSSSF-----------GRRQNVFPKLR  274

Query  276  KRSK-VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVN  452
            + S  V   AK+L+FN DG+ I+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVN
Sbjct  275  RSSPAVVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVN  334

Query  453  DGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            DGVTVAREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  335  DGVTVAREVELEDPVENIGAKLVRQAAAKTNDL  367



>ref|XP_003531529.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Glycine max]
Length=592

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 4/104 (4%)
 Frame = +3

Query  252  RRKN-VVLRKRSK---VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVL  419
            RR N VVL +RS+   V AMAK+L+FN DG+AIKKLQ+GVNKLADLVGVTLGPKGRNVVL
Sbjct  28   RRSNAVVLSRRSRAARVSAMAKELHFNKDGTAIKKLQSGVNKLADLVGVTLGPKGRNVVL  87

Query  420  ESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            ESKYGSPKIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  88   ESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  131



>gb|KEH39991.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=591

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 94/106 (89%), Gaps = 6/106 (6%)
 Frame = +3

Query  252  RRK---NVVLRKRS---KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNV  413
            RRK   NV L +++   KV AMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNV
Sbjct  25   RRKTTSNVALTRKNRNPKVSAMAKELYFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNV  84

Query  414  VLESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            VLESKYGSPKIVNDGVTVAREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  85   VLESKYGSPKIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDL  130



>ref|XP_010090495.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
 gb|EXB39594.1| RuBisCO large subunit-binding protein subunit beta [Morus notabilis]
Length=496

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 1/101 (1%)
 Frame = +3

Query  252  RRKNVVLRKRS-KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESK  428
            RR+NVV R  S ++ AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESK
Sbjct  37   RRQNVVRRTPSPRISAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESK  96

Query  429  YGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            YGSPKIVNDGVTVA+EVELEDP ENIGA LVRQAA+KTNDL
Sbjct  97   YGSPKIVNDGVTVAKEVELEDPAENIGAKLVRQAAAKTNDL  137



>ref|NP_175945.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 ref|NP_849811.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 sp|P21240.3|CPNB1_ARATH RecName: Full=Chaperonin 60 subunit beta 1, chloroplastic; Short=CPN-60 
beta 1; AltName: Full=60 kDa chaperonin subunit beta 
1; AltName: Full=RuBisCO large subunit-binding protein subunit 
beta, chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK62390.1|AF386945_1 Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 gb|AAD10647.1| Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 gb|AAM10063.1| Rubisco subunit binding-protein beta subunit [Arabidopsis thaliana]
 dbj|BAH19596.1| AT1G55490 [Arabidopsis thaliana]
 gb|AEE33251.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
 gb|AEE33252.1| chaperonin 60 subunit beta 1 [Arabidopsis thaliana]
Length=600

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR---SK  287
            MASTF+A SS+G++V+ +           ++     S   ++  GRR++V  R R   S 
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLISKLSSSSFGRRQSVCPRPRRSSSA  51

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I++LQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>ref|XP_010462399.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic [Camelina 
sativa]
Length=600

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR---SK  287
            MASTF+A SS+G++V+ +           ++     S   ++  GRR++V  R R   S 
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLISKLSSSSFGRRQSVCPRPRRSSSA  51

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I++LQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>ref|XP_010480083.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Camelina 
sativa]
Length=600

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR---SK  287
            MASTF+A SS+G++V+ +           ++     S   ++  GRR++V  R R   S 
Sbjct  1    MASTFTATSSIGSMVAPN---------GHKSDKKLISKLSSSSFGRRQSVCPRPRRSSSA  51

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            +   AK+L+FN DG+ I++LQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  52   IVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  111

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            AREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  AREVELEDPVENIGAKLVRQAAAKTNDL  139



>ref|XP_008659370.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 ref|XP_008659372.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 ref|XP_008659373.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Zea mays]
 gb|ACN28096.1| unknown [Zea mays]
 gb|ACN28325.1| unknown [Zea mays]
 gb|AFW86139.1| putative TCP-1/cpn60 chaperonin family protein isoform 1 [Zea 
mays]
 gb|AFW86140.1| putative TCP-1/cpn60 chaperonin family protein isoform 2 [Zea 
mays]
 gb|AFW86141.1| putative TCP-1/cpn60 chaperonin family protein isoform 3 [Zea 
mays]
Length=579

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 103/146 (71%), Gaps = 29/146 (20%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +                             KNV L++R+  R 
Sbjct  1    MASTFGATSTVGLMAAPTG----------------------------KNVRLQRRANFRV  32

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  33   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  92

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  93   EVELEDPVENIGAKLVRQAAAKTNDL  118



>ref|XP_004964341.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=579

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 103/146 (71%), Gaps = 29/146 (20%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +                             KNV L++R+  R 
Sbjct  1    MASTFGATSTVGLMAAPTG----------------------------KNVRLQRRANFRV  32

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  33   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  92

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  93   EVELEDPVENIGAKLVRQAAAKTNDL  118



>ref|XP_008659369.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Zea mays]
 gb|ACN34709.1| unknown [Zea mays]
 gb|AFW86138.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=600

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 103/146 (71%), Gaps = 29/146 (20%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +                             KNV L++R+  R 
Sbjct  22   MASTFGATSTVGLMAAPTG----------------------------KNVRLQRRANFRV  53

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  54   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  113

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  114  EVELEDPVENIGAKLVRQAAAKTNDL  139



>ref|XP_010536825.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
 ref|XP_010536826.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
 ref|XP_010536827.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Tarenaya 
hassleriana]
Length=606

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTF+ MSS+G++  A        L SS  LSSF S+ P +  G+R+N+  RK    K+
Sbjct  1    MASTFAGMSSVGSLAPAGGHARDGQLSSSNRLSSFVSI-PLSSFGKRQNIAQRKARLPKI  59

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK L+FN DG+AI+KLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  60   YA-AKQLHFNKDGTAIRKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  118

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  119  KEVELEDPVENIGAKLVRQAAAKTNDL  145



>ref|XP_004498949.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Cicer arietinum]
Length=592

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +3

Query  261  NVVLRKRS---KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKY  431
            NV L +RS   KV AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKY
Sbjct  32   NVALTRRSRNPKVSAMAKELHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKY  91

Query  432  GSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            GSPKIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  92   GSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  131



>ref|XP_002437709.1| hypothetical protein SORBIDRAFT_10g001120 [Sorghum bicolor]
 gb|EER89076.1| hypothetical protein SORBIDRAFT_10g001120 [Sorghum bicolor]
Length=579

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 103/146 (71%), Gaps = 29/146 (20%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +                             KNV L++R+  R 
Sbjct  1    MASTFGATSTVGLMAAPAG----------------------------KNVRLQRRANFRV  32

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  33   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  92

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  93   EVELEDPVENIGAKLVRQAAAKTNDL  118



>ref|XP_004964340.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=598

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 103/146 (71%), Gaps = 29/146 (20%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +                             KNV L++R+  R 
Sbjct  20   MASTFGATSTVGLMAAPTG----------------------------KNVRLQRRANFRV  51

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  52   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  111

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  EVELEDPVENIGAKLVRQAAAKTNDL  137



>ref|XP_009418590.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=612

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  273  RKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVN  452
            R   K+ AMAK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVN
Sbjct  59   RGNCKINAMAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVN  118

Query  453  DGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            DGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  119  DGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  151



>ref|XP_003557154.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Brachypodium distachyon]
Length=599

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 90/101 (89%), Gaps = 1/101 (1%)
 Frame = +3

Query  252  RRKNVVLRKRSKVRA-MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESK  428
            R +NV L+++   R   AK+LYFN DGSA KKLQAGVNKLADLVGVTLGPKGRNVVLESK
Sbjct  38   RPRNVRLQRKCNFRVKAAKELYFNKDGSATKKLQAGVNKLADLVGVTLGPKGRNVVLESK  97

Query  429  YGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            YGSPKIVNDGVTVAREVELEDPVENIGA LVRQAA+KTNDL
Sbjct  98   YGSPKIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDL  138



>ref|XP_003546771.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Glycine max]
Length=591

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 4/104 (4%)
 Frame = +3

Query  252  RRKNVVLRKR----SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVL  419
            RR N VL  R    ++V AMAK+L+FN DG+AI+KLQ+GVNKLADLVGVTLGPKGRNVVL
Sbjct  27   RRTNAVLLSRRSRAARVSAMAKELHFNKDGTAIRKLQSGVNKLADLVGVTLGPKGRNVVL  86

Query  420  ESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            ESKYGSPKIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  87   ESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  130



>ref|XP_010691436.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=610

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 3/148 (2%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVS-ASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS--K  287
            MAS+F  MS++G+++S  S +I+K+S  SS  LSSF  +S +     + N+V RKR   K
Sbjct  1    MASSFVTMSAVGSLISMGSHSIDKRSFSSSHKLSSFDCISSSFSKNNQINIVPRKRCSFK  60

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            + A  K L+FN +GSAI+KLQAGVNKLAD+VGVTLGPKGRNVVLESKYGSP+IVNDGVTV
Sbjct  61   ISAATKKLHFNKNGSAIRKLQAGVNKLADVVGVTLGPKGRNVVLESKYGSPRIVNDGVTV  120

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
            A+EVELEDPVENIGA LVRQAASKTN+L
Sbjct  121  AKEVELEDPVENIGAQLVRQAASKTNEL  148



>gb|KEH39992.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=591

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 94/106 (89%), Gaps = 6/106 (6%)
 Frame = +3

Query  252  RRK---NVVLRKRS---KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNV  413
            RRK   NV L ++S   KV AMAK+L+FN DGSAIKKLQ GVNKLADLVGVTLGPKGRNV
Sbjct  25   RRKTTSNVALTRKSRNPKVSAMAKELHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNV  84

Query  414  VLESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            VLESKYGSPKIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  85   VLESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  130



>dbj|BAB11583.1| RuBisCO subunit binding-protein beta subunit precursor; chaperonin, 
60 kDa [Arabidopsis thaliana]
Length=596

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 108/147 (73%), Gaps = 14/147 (10%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTFSA SS+G+ ++                 S      ++  GR +++  RK    K+
Sbjct  1    MASTFSATSSMGSSLAPPSN-----------RLSSFVSISSSSFGRTQSIAQRKARFPKI  49

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK L+FN DG+AIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVA
Sbjct  50   YA-AKQLHFNKDGTAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVA  108

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAASKTNDL
Sbjct  109  REVELEDPVENIGAKLVRQAASKTNDL  135



>dbj|BAF00280.1| RuBisCO subunit binding-protein beta subunit precursor [Arabidopsis 
thaliana]
Length=597

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 108/147 (73%), Gaps = 14/147 (10%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTFSA SS+G+ ++                 S      ++  GR +++  RK    K+
Sbjct  1    MASTFSATSSMGSSLAPPSN-----------RLSSFVSISSSSFGRTQSIAQRKARFPKI  49

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK L+FN DG+AIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVA
Sbjct  50   YA-AKQLHFNKDGTAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVA  108

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAASKTNDL
Sbjct  109  REVELEDPVENIGAKLVRQAASKTNDL  135



>ref|NP_001032083.1| chaperonin 60 subunit beta 3 [Arabidopsis thaliana]
 ref|NP_200461.4| chaperonin 60 subunit beta 3 [Arabidopsis thaliana]
 sp|C0Z361.1|CPNB3_ARATH RecName: Full=Chaperonin 60 subunit beta 3, chloroplastic; Short=CPN-60 
beta 3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAH57140.1| AT5G56500 [Arabidopsis thaliana]
 gb|AED96773.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
 gb|AED96774.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
Length=597

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 108/147 (73%), Gaps = 14/147 (10%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTFSA SS+G+ ++                 S      ++  GR +++  RK    K+
Sbjct  1    MASTFSATSSMGSSLAPPSN-----------RLSSFVSISSSSFGRTQSIAQRKARFPKI  49

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK L+FN DG+AIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVA
Sbjct  50   YA-AKQLHFNKDGTAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVA  108

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAASKTNDL
Sbjct  109  REVELEDPVENIGAKLVRQAASKTNDL  135



>ref|XP_008648746.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Zea mays]
Length=623

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 102/146 (70%), Gaps = 29/146 (20%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +                             KNV L++R   R 
Sbjct  45   MASTFGATSTVGLMAAPTG----------------------------KNVRLQRRVNFRV  76

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  77   RAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  136

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  137  EVELEDPVENIGAKLVRQAAAKTNDL  162



>gb|EMS68298.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=776

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 109/147 (74%), Gaps = 10/147 (7%)
 Frame = +3

Query  114  SMASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVR  293
            +MAS F A S++G + + S  +  K   S  ++         +L  R ++V L+++   R
Sbjct  178  NMASPFGATSTVGLMAAPSGIVSDKKPFSLSSI---------SLADRPRHVRLQRKCNFR  228

Query  294  A-MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
               AK+LYFN DGSA KKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  229  VKAAKELYFNKDGSATKKLQVGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  288

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  289  REVELEDPVENIGAKLVRQAAAKTNDL  315



>ref|NP_001056601.1| Os06g0114000 [Oryza sativa Japonica Group]
 dbj|BAA92724.1| putative chaperonin 60 beta precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18515.1| Os06g0114000 [Oryza sativa Japonica Group]
 gb|ABY52934.1| RuBisCo subunit binding-protein beta subunit [Oryza sativa Japonica 
Group]
 dbj|BAG95015.1| unnamed protein product [Oryza sativa Japonica Group]
Length=601

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 111/146 (76%), Gaps = 7/146 (5%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +  +  K   S  ++SS +  S      R +N  L+++   R 
Sbjct  1    MASTFGATSTVGLMAAPTGIVSDKKPSSLSSVSSVSVAS------RPRNARLQRKCNFRV  54

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAR
Sbjct  55   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAR  114

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  115  EVELEDPVENIGAKLVRQAAAKTNDL  140



>gb|EEE64974.1| hypothetical protein OsJ_19883 [Oryza sativa Japonica Group]
Length=588

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 111/146 (76%), Gaps = 7/146 (5%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF A S++G + + +  +  K   S  ++SS +  S      R +N  L+++   R 
Sbjct  1    MASTFGATSTVGLMAAPTGIVSDKKPSSLSSVSSVSVAS------RPRNARLQRKCNFRV  54

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAR
Sbjct  55   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAR  114

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  115  EVELEDPVENIGAKLVRQAAAKTNDL  140



>ref|XP_006401314.1| hypothetical protein EUTSA_v10013030mg [Eutrema salsugineum]
 gb|ESQ42767.1| hypothetical protein EUTSA_v10013030mg [Eutrema salsugineum]
Length=597

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 105/146 (72%), Gaps = 12/146 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTFSA SS+G+ ++                 S      +   G+ +++  RK    R 
Sbjct  1    MASTFSAASSMGSSLAPPSN-----------RLSSLVSISSNSFGKSQSIAQRKARFPRI  49

Query  297  MA-KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
             A K L+FN DG+AIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAR
Sbjct  50   YAAKQLHFNKDGTAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAR  109

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAASKTNDL
Sbjct  110  EVELEDPVENIGAKLVRQAASKTNDL  135



>ref|XP_006655715.1| PREDICTED: chaperonin 60 subunit beta 1, chloroplastic-like [Oryza 
brachyantha]
Length=601

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 110/146 (75%), Gaps = 7/146 (5%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+A S++G + + +  +  K   S  ++SS +  S      R  N   +++   R 
Sbjct  1    MASTFNATSTVGLMAAPTGIVSDKKPSSLSSVSSVSVAS------RPLNARFQRKCNFRV  54

Query  297  -MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
              AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR
Sbjct  55   KAAKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  114

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  115  EVELEDPVENIGAKLVRQAAAKTNDL  140



>emb|CDY32855.1| BnaC09g33020D [Brassica napus]
Length=594

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 105/145 (72%), Gaps = 10/145 (7%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MAS FSA SSLG+ ++               LSS  S+S N  G  +     + R     
Sbjct  1    MASAFSATSSLGSSLAPPSN----------RLSSLVSVSTNPFGKSQAFAQRKARFPKIY  50

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
             AK L+FN DG+AIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVARE
Sbjct  51   AAKQLHFNKDGTAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVARE  110

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDPVENIGA LVRQAASKTNDL
Sbjct  111  VELEDPVENIGAKLVRQAASKTNDL  135



>gb|EMT05406.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=932

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 10/147 (7%)
 Frame = +3

Query  114  SMASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVR  293
            +MAS F A S++G + + +  +  K   S  ++         +L  R ++V L+++   R
Sbjct  334  NMASPFGATSTVGLMAAPTGLVSDKKPFSLSSI---------SLADRPRHVRLQRKCNFR  384

Query  294  A-MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
               AK+LYFN DGSA KKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  385  VKAAKELYFNKDGSATKKLQVGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  444

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVELEDPVENIGA LVRQAA+KTNDL
Sbjct  445  REVELEDPVENIGAKLVRQAAAKTNDL  471



>ref|XP_002864459.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40718.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=597

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 106/147 (72%), Gaps = 14/147 (10%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTFSA SS+G+ ++                 S      ++  G+ +    RK    K+
Sbjct  1    MASTFSATSSMGSCLAPPSN-----------RLSSFVSISSSSFGKSQTFAQRKARFPKI  49

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
             A AK L+FN DG+AIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVA
Sbjct  50   YA-AKQLHFNKDGTAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVA  108

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            REVEL+DPVENIGA LVRQAASKTNDL
Sbjct  109  REVELDDPVENIGAKLVRQAASKTNDL  135



>emb|CDY11918.1| BnaC03g13440D [Brassica napus]
Length=595

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 104/145 (72%), Gaps = 12/145 (8%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MA TFSA SS+G+ ++   +               + +S N+ G  +     + R     
Sbjct  1    MAPTFSATSSMGSSLAPPAS------------RLSSLVSSNSFGKSQAFAQRKARFPKIY  48

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
             AK L+FN DG+AI+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVARE
Sbjct  49   AAKQLHFNKDGTAIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVARE  108

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDPVENIGA LVRQAASKTNDL
Sbjct  109  VELEDPVENIGAKLVRQAASKTNDL  133



>ref|XP_006280215.1| hypothetical protein CARUB_v10026123mg [Capsella rubella]
 gb|EOA13113.1| hypothetical protein CARUB_v10026123mg [Capsella rubella]
Length=598

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 111/145 (77%), Gaps = 9/145 (6%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTFSA SS+G+ + A  +     L S  ++SS +     ++  R+      +  K+ A
Sbjct  1    MASTFSATSSMGSSLLAPPS---NKLSSFVSISSSSFGRSQSIAQRKA-----RFPKIYA  52

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
             AK L+FN DG+AIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVARE
Sbjct  53   -AKQLHFNKDGTAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVARE  111

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDPVENIGA LVRQAASKTNDL
Sbjct  112  VELEDPVENIGAKLVRQAASKTNDL  136



>ref|XP_010451233.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Camelina 
sativa]
Length=598

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 9/145 (6%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTFSA SS+G+ + A  +     L S  ++SS +     ++  R+      +  K+ A
Sbjct  1    MASTFSATSSMGSSLLAPPS---NRLSSFVSISSSSFGKSQSIAQRKA-----RFPKIYA  52

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
             AK+L+FN DG+AI+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVARE
Sbjct  53   -AKELHFNKDGTAIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVARE  111

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDPVENIGA LVRQAASKTNDL
Sbjct  112  VELEDPVENIGAKLVRQAASKTNDL  136



>ref|XP_010443301.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Camelina 
sativa]
Length=597

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+L+FN DG+AI+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAREV
Sbjct  52   AKELHFNKDGTAIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREV  111

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAASKTNDL
Sbjct  112  ELEDPVENIGAKLVRQAASKTNDL  135



>ref|XP_010483125.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic-like [Camelina 
sativa]
Length=597

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+L+FN DG+AI+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAREV
Sbjct  52   AKELHFNKDGTAIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREV  111

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAASKTNDL
Sbjct  112  ELEDPVENIGAKLVRQAASKTNDL  135



>ref|XP_009132296.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Brassica 
rapa]
Length=591

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK L+FN DG+AI+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAREV
Sbjct  46   AKQLHFNKDGTAIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREV  105

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAASKTNDL
Sbjct  106  ELEDPVENIGAKLVRQAASKTNDL  129



>gb|KHN26774.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Glycine soja]
Length=546

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            MAK+L+FN DG+AIKKLQ+GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+E
Sbjct  1    MAKELHFNKDGTAIKKLQSGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKE  60

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDPVENIGA LVRQAA+KTNDL
Sbjct  61   VELEDPVENIGAKLVRQAAAKTNDL  85



>ref|XP_003574065.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brachypodium distachyon]
 ref|XP_010233648.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Brachypodium distachyon]
Length=598

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 85/94 (90%), Gaps = 1/94 (1%)
 Frame = +3

Query  273  RKRSKVRA-MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIV  449
            R++   R   AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIV
Sbjct  44   RRKCSFRVNAAKELYFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIV  103

Query  450  NDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            NDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  104  NDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  137



>gb|EMS63178.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=561

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVA+EV
Sbjct  30   AKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAKEV  89

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAA+KTNDL
Sbjct  90   ELEDPVENIGAKLVRQAAAKTNDL  113



>ref|XP_001754999.1| predicted protein [Physcomitrella patens]
 gb|EDQ80453.1| predicted protein [Physcomitrella patens]
Length=604

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 92/103 (89%), Gaps = 3/103 (3%)
 Frame = +3

Query  243  LGGRRKNVVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLE  422
            L  RR+ V    R+ V+A AK+L+FN DGSAIKK+QAGV+KLADLVGVTLGPKGRNVVLE
Sbjct  44   LNQRRQRVA--HRTTVKA-AKELHFNKDGSAIKKMQAGVDKLADLVGVTLGPKGRNVVLE  100

Query  423  SKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            SKYGSPKIVNDGVTVA+EVELEDPVENIGA LVRQA++KTNDL
Sbjct  101  SKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQASAKTNDL  143



>gb|KHN23693.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Glycine soja]
Length=546

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            MAK+L+FN DG+AI+KLQ+GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+E
Sbjct  1    MAKELHFNKDGTAIRKLQSGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKE  60

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDPVENIGA LVRQAA+KTNDL
Sbjct  61   VELEDPVENIGAKLVRQAAAKTNDL  85



>gb|EMT19476.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=654

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVA+EV
Sbjct  54   AKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAKEV  113

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAA+KTNDL
Sbjct  114  ELEDPVENIGAKLVRQAAAKTNDL  137



>emb|CDY36809.1| BnaA03g10770D [Brassica napus]
Length=607

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK L+FN DG+AI+KLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAREV
Sbjct  46   AKQLHFNKDGTAIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREV  105

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
             LEDPVENIGA LVRQAASKTNDL
Sbjct  106  ALEDPVENIGAKLVRQAASKTNDL  129



>ref|NP_001045601.1| Os02g0102900 [Oryza sativa Japonica Group]
 dbj|BAD07821.1| putative RuBisCO subunit binding-protein beta subunit, chloroplast 
precursor [Oryza sativa Japonica Group]
 dbj|BAF07515.1| Os02g0102900 [Oryza sativa Japonica Group]
 gb|EEC72294.1| hypothetical protein OsI_05469 [Oryza sativa Indica Group]
 gb|EEE56131.1| hypothetical protein OsJ_05004 [Oryza sativa Japonica Group]
 gb|ADR66967.1| 60 kDa chaperonin beta subunit [Oryza sativa Japonica Group]
Length=598

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 102/145 (70%), Gaps = 9/145 (6%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MAS F + S+ G  ++ +         +  T      + P  +   RKN   RK +    
Sbjct  1    MASAFGSTSACGIKITPT---------AFATKKHLCLVPPPVVSLPRKNRPQRKCNFRVN  51

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
             AK+LYFN DG AIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+E
Sbjct  52   AAKELYFNKDGLAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKE  111

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDPVENIGA LVRQAA+KTNDL
Sbjct  112  VELEDPVENIGAKLVRQAAAKTNDL  136



>ref|XP_001754571.1| predicted protein [Physcomitrella patens]
 gb|EDQ80541.1| predicted protein [Physcomitrella patens]
Length=548

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK L+FN DGSAIKK+QAGV+KLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+EV
Sbjct  6    AKQLHFNKDGSAIKKMQAGVDKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEV  65

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAA+KTNDL
Sbjct  66   ELEDPVENIGAKLVRQAAAKTNDL  89



>ref|XP_002982262.1| hypothetical protein SELMODRAFT_271545 [Selaginella moellendorffii]
 gb|EFJ16507.1| hypothetical protein SELMODRAFT_271545 [Selaginella moellendorffii]
Length=598

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 2/95 (2%)
 Frame = +3

Query  273  RKRSKVR--AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKI  446
            R +S VR  AMAK+L FN DG A K+LQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKI
Sbjct  39   RHKSCVRTSAMAKELVFNKDGQATKRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKI  98

Query  447  VNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            +NDGVTV +E+ELEDPVENIG  LVRQAASKTNDL
Sbjct  99   INDGVTVTKEIELEDPVENIGVKLVRQAASKTNDL  133



>ref|XP_004951187.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Setaria italica]
Length=599

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 3/97 (3%)
 Frame = +3

Query  270  LRKRSKVRAM---AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP  440
            +R + K R     AK+++FN DGSAI+KLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP
Sbjct  41   MRHQRKCRFTVNAAKEIHFNKDGSAIRKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSP  100

Query  441  KIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            KIVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  101  KIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  137



>gb|AFW66837.1| putative TCP-1/cpn60 chaperonin family protein isoform 1 [Zea 
mays]
 gb|AFW66838.1| putative TCP-1/cpn60 chaperonin family protein isoform 2 [Zea 
mays]
Length=605

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+L+FN DGSAI+K+Q GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+EV
Sbjct  56   AKELHFNKDGSAIRKMQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEV  115

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAA+KTNDL
Sbjct  116  ELEDPVENIGAKLVRQAAAKTNDL  139



>ref|NP_001146890.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
 gb|ACG24216.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
Length=604

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+L+FN DGSAI+K+Q GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+EV
Sbjct  56   AKELHFNKDGSAIRKMQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEV  115

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAA+KTNDL
Sbjct  116  ELEDPVENIGAKLVRQAAAKTNDL  139



>gb|ACG36615.1| ruBisCO large subunit-binding protein subunit beta [Zea mays]
Length=605

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+L+FN DGSAI+K+Q GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+EV
Sbjct  56   AKELHFNKDGSAIRKMQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEV  115

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAA+KTNDL
Sbjct  116  ELEDPVENIGAKLVRQAAAKTNDL  139



>dbj|BAK07904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  273  RKRSKVRA-MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIV  449
            R+R   RA  AK+LYFN DGSA++KLQ GVNKLA LVGVTLGPKGRNVVLESKYG P+IV
Sbjct  44   RRRCNFRANAAKELYFNQDGSAMRKLQNGVNKLAHLVGVTLGPKGRNVVLESKYGPPRIV  103

Query  450  NDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            NDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  104  NDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  137



>ref|XP_001780334.1| predicted protein [Physcomitrella patens]
 gb|EDQ54893.1| predicted protein [Physcomitrella patens]
Length=604

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+L+FN DGSAIK++QAGV+KLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA+EV
Sbjct  60   AKELHFNKDGSAIKRMQAGVDKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEV  119

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQA++KTNDL
Sbjct  120  ELEDPVENIGAKLVRQASAKTNDL  143



>ref|XP_002961675.1| hypothetical protein SELMODRAFT_165043 [Selaginella moellendorffii]
 gb|EFJ36935.1| hypothetical protein SELMODRAFT_165043 [Selaginella moellendorffii]
Length=607

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 89/103 (86%), Gaps = 4/103 (4%)
 Frame = +3

Query  252  RRKNVVLRKRSKV---RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLE  422
            R K+  LR R+ V   RA AK L+FN DGSA+KKLQAG NK+ADLVGVTLGPKGRNVVLE
Sbjct  40   RSKSGGLRCRAPVVRTRA-AKQLFFNKDGSAMKKLQAGANKVADLVGVTLGPKGRNVVLE  98

Query  423  SKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            SKYGSPKIVNDGVTVA+EVELED VENIGA LVRQAASKTNDL
Sbjct  99   SKYGSPKIVNDGVTVAKEVELEDAVENIGARLVRQAASKTNDL  141



>gb|EMT33855.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Aegilops tauschii]
Length=659

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 106/146 (73%), Gaps = 8/146 (5%)
 Frame = +3

Query  114  SMASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVR  293
            +MAS F  +S+ G  +SA+      + K+   +S      P  +  RR     R   +V 
Sbjct  61   TMASPFCGISTCG--LSAAAPTGFSTKKARSLVSPTFVSLPQEIRPRR-----RCNFRVN  113

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
            A AK+LYFN DGSA++KLQ GVNKLA+LVGVTLGPKGRNVVLESKYG P+IVNDGVTVA+
Sbjct  114  A-AKELYFNKDGSAMRKLQNGVNKLANLVGVTLGPKGRNVVLESKYGPPRIVNDGVTVAK  172

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  173  EVELEDPVENIGAKLVRQAAAKTNDL  198



>ref|XP_002966190.1| hypothetical protein SELMODRAFT_168153 [Selaginella moellendorffii]
 gb|EFJ32217.1| hypothetical protein SELMODRAFT_168153 [Selaginella moellendorffii]
Length=550

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            MAK+L FN DG A K+LQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKI+NDGVTV +E
Sbjct  1    MAKELVFNKDGQATKRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIINDGVTVTKE  60

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            +ELEDPVENIG  LVRQAASKTNDL
Sbjct  61   IELEDPVENIGVKLVRQAASKTNDL  85



>ref|XP_009413285.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=374

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 108/151 (72%), Gaps = 8/151 (5%)
 Frame = +3

Query  111  W--SMASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR-  281
            W   MASTFS MS++G++ SA+  +        +  S  +  S +   GR+ N+ ++KR 
Sbjct  88   WIQEMASTFSTMSTIGSL-SATNCLSANKASVEKFSSLSSVSSNSLSSGRQ-NLKMQKRC  145

Query  282  -SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG  458
             S++RAMAK+L+FN D S IKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSP +    
Sbjct  146  NSRIRAMAKELHFNKDVSTIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPNMPKRY  205

Query  459  VTVAREVELEDPVENIGASLVRQAASKTNDL  551
            + +   VELEDPVENIGA LVRQAA+KTNDL
Sbjct  206  LII--RVELEDPVENIGAKLVRQAAAKTNDL  234



>ref|XP_002964742.1| hypothetical protein SELMODRAFT_142800 [Selaginella moellendorffii]
 gb|EFJ33580.1| hypothetical protein SELMODRAFT_142800 [Selaginella moellendorffii]
Length=603

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 5/102 (5%)
 Frame = +3

Query  246  GGRRKNVVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLES  425
            G R +  V+R R+     AK L+FN DGSA+KKLQAG NK+A+LVGVTLGPKGRNVVLES
Sbjct  45   GLRCRAPVVRTRA-----AKQLFFNKDGSAMKKLQAGANKVANLVGVTLGPKGRNVVLES  99

Query  426  KYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            KYGSPKIVNDGVTVA+EVELED VENIGA LVRQAASKTNDL
Sbjct  100  KYGSPKIVNDGVTVAKEVELEDAVENIGARLVRQAASKTNDL  141



>ref|XP_005843554.1| hypothetical protein CHLNCDRAFT_59809 [Chlorella variabilis]
 gb|EFN51452.1| hypothetical protein CHLNCDRAFT_59809 [Chlorella variabilis]
Length=584

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK L+FNT+G A+K++QAGV+KLA +VGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV
Sbjct  41   AKQLHFNTNGEALKRMQAGVDKLATVVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  100

Query  480  ELEDPVENIGASLVRQAASKTNDL  551
            ELEDPVENIGA LVRQAA++TNDL
Sbjct  101  ELEDPVENIGAKLVRQAAARTNDL  124



>emb|CDX75715.1| BnaC03g37980D [Brassica napus]
Length=563

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  315  FNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVELEDP  494
            FN DGS IKKLQ GVNKLADLVG TLGPKGRNVVLESKYGSPKIVNDGVTVAREVELEDP
Sbjct  18   FNKDGSTIKKLQTGVNKLADLVGFTLGPKGRNVVLESKYGSPKIVNDGVTVAREVELEDP  77

Query  495  VENIGASLVRQAASKTNDL  551
            VENIGA LVRQAA+KTNDL
Sbjct  78   VENIGAKLVRQAAAKTNDL  96



>emb|CEF98707.1| Chaperonin Cpn60 [Ostreococcus tauri]
Length=593

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +3

Query  255  RKNVVLRKRSKVRAMAKDLYFN-TDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKY  431
            R+  V R    V A AK+LYFN  DG A+KK+Q GV+KLA +VGVTLGPKGRNVVLESKY
Sbjct  29   RRTSVRRAPLCVTAAAKNLYFNKNDGVALKKMQKGVDKLASVVGVTLGPKGRNVVLESKY  88

Query  432  GSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTND  548
            GSPKIVNDGVTVA+EVELEDPVEN+GA LVRQA+ KTND
Sbjct  89   GSPKIVNDGVTVAKEVELEDPVENVGAKLVRQASQKTND  127



>ref|XP_003080325.1| RUBISCO SUBUNIT BINDING-PROTEIN BETA-2 SUBUNIT (60 KD CHAPERONIN 
(IC) [Ostreococcus tauri]
Length=621

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +3

Query  255  RKNVVLRKRSKVRAMAKDLYFN-TDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKY  431
            R+  V R    V A AK+LYFN  DG A+KK+Q GV+KLA +VGVTLGPKGRNVVLESKY
Sbjct  57   RRTSVRRAPLCVTAAAKNLYFNKNDGVALKKMQKGVDKLASVVGVTLGPKGRNVVLESKY  116

Query  432  GSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTND  548
            GSPKIVNDGVTVA+EVELEDPVEN+GA LVRQA+ KTND
Sbjct  117  GSPKIVNDGVTVAKEVELEDPVENVGAKLVRQASQKTND  155



>gb|ERN05824.1| hypothetical protein AMTR_s00006p00260480 [Amborella trichopoda]
Length=550

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  264  VVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPK  443
            + +++   + AM+K++YFN DGSA KKLQAGV+ LA+LVGVTLGPKGRNVVLE+KYG PK
Sbjct  29   LCMQRYPTITAMSKEIYFNHDGSATKKLQAGVDMLANLVGVTLGPKGRNVVLENKYGPPK  88

Query  444  IVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            IVNDGV + +E+ELED +ENIG  LVRQAA+KTNDL
Sbjct  89   IVNDGVAICKEIELEDTLENIGVKLVRQAAAKTNDL  124



>ref|XP_002500045.1| chaperonin 60 beta [Micromonas sp. RCC299]
 gb|ACO61303.1| chaperonin 60 beta [Micromonas sp. RCC299]
Length=594

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 6/106 (6%)
 Frame = +3

Query  237  NALGGRRKNVVLRKRSKVRAMAKDLYFNT-DGSAIKKLQAGVNKLADLVGVTLGPKGRNV  413
            +A   RR  V     S V   AK LYFN  DG+A+KK+Q GV+KLA +VGVTLGPKGRNV
Sbjct  31   SAFPARRARV-----STVIKAAKQLYFNAQDGTALKKMQKGVDKLAHVVGVTLGPKGRNV  85

Query  414  VLESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            VLESKYGSPKIVNDGVTVA+EV+LEDPVEN+GA LVRQAA KTNDL
Sbjct  86   VLESKYGSPKIVNDGVTVAKEVDLEDPVENVGARLVRQAAQKTNDL  131



>ref|XP_005647445.1| chaperonin 60B2 [Coccomyxa subellipsoidea C-169]
 gb|EIE22901.1| chaperonin 60B2 [Coccomyxa subellipsoidea C-169]
Length=546

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            MAK+L+FN +  A+KKLQAGV+KL+ +VGVTLGPKGRNVVLESKYGSP+IVNDGVTVA+E
Sbjct  1    MAKELHFNRNMEALKKLQAGVDKLSSVVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAKE  60

Query  477  VELEDPVENIGASLVRQAASKTN  545
            VELEDPVENIGA LVRQAASKTN
Sbjct  61   VELEDPVENIGAKLVRQAASKTN  83



>ref|XP_003057879.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57830.1| predicted protein [Micromonas pusilla CCMP1545]
Length=593

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +3

Query  294  AMAKDLYFNTD-GSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            A AK LYFN D G+A+KK+Q GV+KLA +VGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  46   AAAKKLYFNADDGAALKKMQRGVDKLAHVVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  105

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +EVEL+DPVEN+GA LVRQAA KTNDL
Sbjct  106  KEVELQDPVENVGARLVRQAAQKTNDL  132



>ref|XP_011623265.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Amborella trichopoda]
Length=584

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  270  LRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIV  449
            +++   + AM+K++YFN DGSA KKLQAGV+ LA+LVGVTLGPKGRNVVLE+KYG PKIV
Sbjct  1    MQRYPTITAMSKEIYFNHDGSATKKLQAGVDMLANLVGVTLGPKGRNVVLENKYGPPKIV  60

Query  450  NDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            NDGV + +E+ELED +ENIG  LVRQAA+KTNDL
Sbjct  61   NDGVAICKEIELEDTLENIGVKLVRQAAAKTNDL  94



>gb|KIZ01508.1| RuBisCO large subunit-binding protein subunit beta [Monoraphidium 
neglectum]
Length=413

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = +3

Query  273  RKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVN  452
            R+   VRA AK+L+FN +  A+KK+QAG +KLA +VGVTLGPKGRNVVLESKYGSPKIVN
Sbjct  24   RRMQVVRA-AKELHFNKNMEALKKMQAGADKLATVVGVTLGPKGRNVVLESKYGSPKIVN  82

Query  453  DGVTVAREVELEDPVENIGASLVRQAASKTN  545
            DGVT+AREVELEDPVENIGA LVRQAA++TN
Sbjct  83   DGVTIAREVELEDPVENIGAKLVRQAAARTN  113



>gb|KJB11277.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
Length=418

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            K RAMAK++YFN DGSA KKLQ GV+K+A+L+GVTLGPKGRNVVL++KYG PKIVNDG T
Sbjct  34   KPRAMAKEVYFNHDGSATKKLQTGVDKVAELIGVTLGPKGRNVVLQNKYGPPKIVNDGET  93

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +++ELEDP+EN+G  LVRQA +KTNDL
Sbjct  94   VLKQIELEDPLENVGVKLVRQAGAKTNDL  122



>ref|XP_007514774.1| chaperonin GroEL [Bathycoccus prasinos]
 emb|CCO15014.1| chaperonin GroEL [Bathycoccus prasinos]
Length=589

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 1/84 (1%)
 Frame = +3

Query  300  AKDLYFNT-DGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            AKDLYFN  DG A+KK+Q GV+KL+ +VGVTLGPKGRNVVLESK+GSPKIVNDGVTVA+E
Sbjct  42   AKDLYFNAQDGLALKKMQKGVDKLSHVVGVTLGPKGRNVVLESKFGSPKIVNDGVTVAKE  101

Query  477  VELEDPVENIGASLVRQAASKTND  548
            VELEDPVENIGA LVRQA+ KTND
Sbjct  102  VELEDPVENIGAKLVRQASQKTND  125



>ref|XP_001418926.1| chaperonin 60 beta chain, chloroplast [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO97219.1| chaperonin 60 beta chain, chloroplast [Ostreococcus lucimarinus 
CCE9901]
Length=594

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 1/88 (1%)
 Frame = +3

Query  288  VRAMAKDLYFN-TDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            V A AK+LYFN  DGSA+KK+Q GV+KLA +VGVTLGPKGRNVVLESK+GSPKIVNDGVT
Sbjct  44   VVAAAKNLYFNKNDGSALKKMQKGVDKLASVVGVTLGPKGRNVVLESKFGSPKIVNDGVT  103

Query  465  VAREVELEDPVENIGASLVRQAASKTND  548
            VA+EV+LEDPVEN+GA LVRQA+ KTND
Sbjct  104  VAKEVDLEDPVENVGAKLVRQASQKTND  131



>gb|KDO70207.1| hypothetical protein CISIN_1g010494mg [Citrus sinensis]
Length=401

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +3

Query  258  KNVVLRKR---SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESK  428
            KN  L KR   S  RAM K++YFN DGSA KKLQAGV+ +A+LVGVTLGPKGRNVVL++K
Sbjct  14   KNPTLPKRAPNSVPRAMVKEVYFNHDGSATKKLQAGVDLVAELVGVTLGPKGRNVVLQNK  73

Query  429  YGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            YG PKIVNDG TV +E+ELEDP+ENIG  LVRQA ++TNDL
Sbjct  74   YGPPKIVNDGETVLKEIELEDPLENIGVKLVRQAGARTNDL  114



>ref|XP_001692504.1| chaperonin 60B2 [Chlamydomonas reinhardtii]
 gb|EDP03982.1| chaperonin 60B2 [Chlamydomonas reinhardtii]
Length=577

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +3

Query  276  KRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVND  455
            +RS V   AK+L+FN +  A+KK+QAGV+KLA +VGVT+GPKGRNVVLESK+GSPKIVND
Sbjct  24   RRSVVVQAAKELHFNRNMEALKKMQAGVDKLATVVGVTIGPKGRNVVLESKFGSPKIVND  83

Query  456  GVTVAREVELEDPVENIGASLVRQAASKTN  545
            GVT+AREVELEDPVENIGA LVRQAA++TN
Sbjct  84   GVTIAREVELEDPVENIGAKLVRQAAARTN  113



>gb|EMS56406.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=617

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 83/105 (79%), Gaps = 12/105 (11%)
 Frame = +3

Query  273  RKRSKVRA-MAKDLYFNTDGSAIKKLQA-----------GVNKLADLVGVTLGPKGRNVV  416
            R+R   R   AK+LYFN DG A++KLQ            GVNKLA+LVGVTLGPKGRNVV
Sbjct  44   RRRCNFRVNAAKELYFNKDGLAMRKLQMQISDCIFPYQNGVNKLANLVGVTLGPKGRNVV  103

Query  417  LESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            LE+KYG P+IVNDGVTVA+EVELEDPVENIGA LVRQAA+KTNDL
Sbjct  104  LENKYGPPRIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDL  148



>gb|KJB11271.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
 gb|KJB11276.1| hypothetical protein B456_001G250800 [Gossypium raimondii]
Length=599

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            K RAMAK++YFN DGSA KKLQ GV+K+A+L+GVTLGPKGRNVVL++KYG PKIVNDG T
Sbjct  34   KPRAMAKEVYFNHDGSATKKLQTGVDKVAELIGVTLGPKGRNVVLQNKYGPPKIVNDGET  93

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +++ELEDP+EN+G  LVRQA +KTNDL
Sbjct  94   VLKQIELEDPLENVGVKLVRQAGAKTNDL  122



>gb|KDO70205.1| hypothetical protein CISIN_1g010494mg [Citrus sinensis]
Length=493

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +3

Query  258  KNVVLRKR---SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESK  428
            KN  L KR   S  RAM K++YFN DGSA KKLQAGV+ +A+LVGVTLGPKGRNVVL++K
Sbjct  14   KNPTLPKRAPNSVPRAMVKEVYFNHDGSATKKLQAGVDLVAELVGVTLGPKGRNVVLQNK  73

Query  429  YGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            YG PKIVNDG TV +E+ELEDP+ENIG  LVRQA ++TNDL
Sbjct  74   YGPPKIVNDGETVLKEIELEDPLENIGVKLVRQAGARTNDL  114



>gb|KDO70206.1| hypothetical protein CISIN_1g010494mg [Citrus sinensis]
Length=509

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +3

Query  258  KNVVLRKR---SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESK  428
            KN  L KR   S  RAM K++YFN DGSA KKLQAGV+ +A+LVGVTLGPKGRNVVL++K
Sbjct  14   KNPTLPKRAPNSVPRAMVKEVYFNHDGSATKKLQAGVDLVAELVGVTLGPKGRNVVLQNK  73

Query  429  YGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            YG PKIVNDG TV +E+ELEDP+ENIG  LVRQA ++TNDL
Sbjct  74   YGPPKIVNDGETVLKEIELEDPLENIGVKLVRQAGARTNDL  114



>ref|XP_006484293.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=612

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +3

Query  258  KNVVLRKR---SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESK  428
            KN  L KR   S  RAM K++YFN DGSA KKLQAGV+ +A+LVGVTLGPKGRNVVL++K
Sbjct  14   KNPTLPKRAPNSVPRAMVKEVYFNHDGSATKKLQAGVDLVAELVGVTLGPKGRNVVLQNK  73

Query  429  YGSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            YG PKIVNDG TV +E+ELEDP+ENIG  LVRQA ++TNDL
Sbjct  74   YGPPKIVNDGETVLKEIELEDPLENIGVKLVRQAGARTNDL  114



>ref|XP_002269341.2| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Vitis 
vinifera]
Length=610

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RAMAK+LYFN DGSA KKLQAGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  25   RAMAKELYFNHDGSATKKLQAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  84

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTN L
Sbjct  85   KEIELEDPLENVGVKLVRQAGAKTNHL  111



>gb|KDD74080.1| TCP-1/cpn60 chaperonin [Helicosporidium sp. ATCC 50920]
Length=622

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = +3

Query  279  RSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG  458
            RS  RA AK+L+FN DG A+K++Q GV +LA +VGVTLGPKGRNVVLES++GSP+IVNDG
Sbjct  69   RSLARA-AKELHFNGDGEALKRMQRGVERLASVVGVTLGPKGRNVVLESRFGSPRIVNDG  127

Query  459  VTVAREVELEDPVENIGASLVRQAASKTNDL  551
            VTVAREVELED VEN+GA LVRQAA+KTND+
Sbjct  128  VTVAREVELEDAVENVGAKLVRQAAAKTNDV  158



>ref|XP_007045689.1| TCP-1/cpn60 chaperonin family protein isoform 1 [Theobroma cacao]
 gb|EOY01521.1| TCP-1/cpn60 chaperonin family protein isoform 1 [Theobroma cacao]
Length=617

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            K R +AK++YFN DGSA KKLQAGV+K+A+L+GVTLGPKGRNVVL++KYG PKIVNDG T
Sbjct  55   KPRPLAKEIYFNHDGSATKKLQAGVDKVAELIGVTLGPKGRNVVLQNKYGPPKIVNDGET  114

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +++ELEDP+EN+G  LVRQA +KTNDL
Sbjct  115  VLKQIELEDPLENVGVKLVRQAGAKTNDL  143



>ref|XP_012080491.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Jatropha curcas]
 gb|KDP31429.1| hypothetical protein JCGZ_11805 [Jatropha curcas]
Length=592

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAKDLYFN DGSA KKL AGV+ +A LVGVTLGPKGRNVVLE+KYG PKIVNDG TV 
Sbjct  32   KAMAKDLYFNHDGSAAKKLLAGVDMVAQLVGVTLGPKGRNVVLENKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELEDP+EN+G  LVRQA +KTNDL
Sbjct  92   KQIELEDPLENVGVKLVRQAGAKTNDL  118



>emb|CDP00506.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            MAK+LYFN DGSA+KKLQAGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV +E
Sbjct  1    MAKELYFNHDGSAMKKLQAGVDLVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVLKE  60

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            +ELEDP+EN+G  LVRQA +KTN+L
Sbjct  61   IELEDPLENVGVKLVRQAGAKTNEL  85



>ref|XP_011077797.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Sesamum indicum]
Length=528

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RA+AK+LYFN DGSA +KL AGVNK+A+++GVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  34   RAVAKELYFNHDGSATRKLLAGVNKVAEVIGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  93

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA ++TNDL
Sbjct  94   KEIELEDPLENVGVKLVRQAGARTNDL  120



>ref|XP_002951713.1| hypothetical protein VOLCADRAFT_81582 [Volvox carteri f. nagariensis]
 gb|EFJ47164.1| hypothetical protein VOLCADRAFT_81582 [Volvox carteri f. nagariensis]
Length=577

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+L+FN +  A+K++QAGV+KLA +VGVT+GPKGRNVVLESK+GSPKIVNDGVT+AREV
Sbjct  33   AKELHFNKNMEALKRMQAGVDKLATVVGVTIGPKGRNVVLESKFGSPKIVNDGVTIAREV  92

Query  480  ELEDPVENIGASLVRQAASKTN  545
            ELEDPVENIGA LVRQAA++TN
Sbjct  93   ELEDPVENIGAKLVRQAAARTN  114



>ref|XP_001701113.1| chaperonin 60B1 [Chlamydomonas reinhardtii]
 gb|EDO97815.1| chaperonin 60B1 [Chlamydomonas reinhardtii]
Length=580

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  300  AKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREV  479
            AK+L+FN D  A+K++QAGV+KLA +VGVT+GPKGRNVVLESK+G+PKIVNDGVT+AREV
Sbjct  31   AKELHFNKDMQALKRMQAGVDKLATVVGVTIGPKGRNVVLESKFGAPKIVNDGVTIAREV  90

Query  480  ELEDPVENIGASLVRQAASKTN  545
            EL DPVENIGA+LVRQAA++TN
Sbjct  91   ELSDPVENIGATLVRQAAARTN  112



>ref|XP_006573192.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X3 [Glycine max]
Length=516

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RAMAK+LYFN DGSA+KKL AGV+ +A+L+GVTLGPKGRNVVL +KYG PKIVNDG TV 
Sbjct  29   RAMAKELYFNHDGSAMKKLLAGVDMVAELLGVTLGPKGRNVVLPNKYGPPKIVNDGETVL  88

Query  471  REVELEDPVENIGASLVRQAASKTND  548
            +E+ELEDP+EN+G  LVRQA +KTND
Sbjct  89   KEIELEDPLENVGVKLVRQAGAKTND  114



>ref|XP_011077788.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Sesamum indicum]
Length=584

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RA+AK+LYFN DGSA +KL AGVNK+A+++GVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  34   RAVAKELYFNHDGSATRKLLAGVNKVAEVIGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  93

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA ++TNDL
Sbjct  94   KEIELEDPLENVGVKLVRQAGARTNDL  120



>ref|XP_002514548.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
 gb|EEF47654.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
Length=592

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  288  VRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTV  467
            ++AM+KD+YFN DGSA KKL AGV  +A+LVGVTLGPKGRNVVLE+KYG PKIVNDG TV
Sbjct  33   LKAMSKDIYFNHDGSATKKLLAGVGMVAELVGVTLGPKGRNVVLENKYGPPKIVNDGETV  92

Query  468  AREVELEDPVENIGASLVRQAASKTNDL  551
             +++ELEDP+EN+G  LVRQA +KTNDL
Sbjct  93   LKQIELEDPLENVGVKLVRQAGAKTNDL  120



>emb|CBI27426.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            MAK+LYFN DGSA KKLQAGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV +E
Sbjct  1    MAKELYFNHDGSATKKLQAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVLKE  60

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            +ELEDP+EN+G  LVRQA +KTN L
Sbjct  61   IELEDPLENVGVKLVRQAGAKTNHL  85



>ref|XP_006573191.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X2 [Glycine max]
Length=587

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  252  RRKNVVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKY  431
            R +N +L      RAMAK+LYFN DGSA+KKL AGV+ +A+L+GVTLGPKGRNVVL +KY
Sbjct  16   RPRNSLLSSSLSPRAMAKELYFNHDGSAMKKLLAGVDMVAELLGVTLGPKGRNVVLPNKY  75

Query  432  GSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTND  548
            G PKIVNDG TV +E+ELEDP+EN+G  LVRQA +KTND
Sbjct  76   GPPKIVNDGETVLKEIELEDPLENVGVKLVRQAGAKTND  114



>ref|XP_012080492.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Jatropha curcas]
Length=559

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            MAKDLYFN DGSA KKL AGV+ +A LVGVTLGPKGRNVVLE+KYG PKIVNDG TV ++
Sbjct  1    MAKDLYFNHDGSAAKKLLAGVDMVAQLVGVTLGPKGRNVVLENKYGPPKIVNDGETVLKQ  60

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            +ELEDP+EN+G  LVRQA +KTNDL
Sbjct  61   IELEDPLENVGVKLVRQAGAKTNDL  85



>ref|XP_010696183.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=584

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  282  SKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGV  461
            + +++MAK+LYFN DGS  KKLQAGV+ + DL+GVTLGPKGRNVVL +KYG PKIVNDG 
Sbjct  30   TTIKSMAKELYFNHDGSVTKKLQAGVDLVGDLLGVTLGPKGRNVVLPNKYGPPKIVNDGE  89

Query  462  TVAREVELEDPVENIGASLVRQAASKTNDL  551
            TV +++ELEDP+ENIG  LVRQA +KTNDL
Sbjct  90   TVLKQIELEDPLENIGVKLVRQAGAKTNDL  119



>ref|XP_003516734.2| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Glycine max]
 gb|KHN31084.1| Chaperonin 60 subunit beta 4, chloroplastic [Glycine soja]
Length=605

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  252  RRKNVVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKY  431
            R +N +L      RAMAK+LYFN DGSA+KKL AGV+ +A+L+GVTLGPKGRNVVL +KY
Sbjct  16   RPRNSLLSSSLSPRAMAKELYFNHDGSAMKKLLAGVDMVAELLGVTLGPKGRNVVLPNKY  75

Query  432  GSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTND  548
            G PKIVNDG TV +E+ELEDP+EN+G  LVRQA +KTND
Sbjct  76   GPPKIVNDGETVLKEIELEDPLENVGVKLVRQAGAKTND  114



>ref|XP_006574985.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Glycine 
max]
 gb|KHN29911.1| Chaperonin 60 subunit beta 4, chloroplastic [Glycine soja]
Length=605

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  252  RRKNVVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKY  431
            R +N +       RAMAK+LYFN DGSA KKL AGV+ +A+L+GVTLGPKGRNVVL +KY
Sbjct  16   RLRNSLSSSSISPRAMAKELYFNHDGSATKKLLAGVDMVAELLGVTLGPKGRNVVLPNKY  75

Query  432  GSPKIVNDGVTVAREVELEDPVENIGASLVRQAASKTND  548
            G PKIVNDG TV +E+ELEDP+EN+G  LVRQA +KTND
Sbjct  76   GPPKIVNDGETVLKEIELEDPLENVGVKLVRQAGAKTND  114



>ref|XP_011655734.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X3 [Cucumis sativus]
Length=526

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDLYFN DGS  KKLQ GVN +A+LVG+TLGPKGRNVVL++KYG PKIVNDG TV +E+E
Sbjct  50   KDLYFNHDGSTFKKLQVGVNLVAELVGITLGPKGRNVVLQNKYGPPKIVNDGETVLKEIE  109

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA +KTNDL
Sbjct  110  LEDPLENVGVKLVRQAGAKTNDL  132



>ref|XP_006437814.1| hypothetical protein CICLE_v10031053mg [Citrus clementina]
 gb|ESR51054.1| hypothetical protein CICLE_v10031053mg [Citrus clementina]
Length=583

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            M K++YFN DGSA KKLQAGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV +E
Sbjct  1    MVKEVYFNHDGSATKKLQAGVDLVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVLKE  60

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            +ELEDP+ENIG  LVRQA ++TNDL
Sbjct  61   IELEDPLENIGVKLVRQAGARTNDL  85



>ref|XP_007146371.1| hypothetical protein PHAVU_006G034900g [Phaseolus vulgaris]
 gb|ESW18365.1| hypothetical protein PHAVU_006G034900g [Phaseolus vulgaris]
Length=616

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RAMAK+LY N DGSA KKL AGV+ +A+L+GVTLGPKGRNVVL +KYG PKIVNDG TV 
Sbjct  34   RAMAKELYLNHDGSATKKLLAGVDMVAELLGVTLGPKGRNVVLPNKYGPPKIVNDGETVL  93

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  94   KEIELEDPLENVGVKLVRQAGAKTNDL  120



>ref|XP_004135135.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Cucumis sativus]
Length=597

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDLYFN DGS  KKLQ GVN +A+LVG+TLGPKGRNVVL++KYG PKIVNDG TV +E+E
Sbjct  50   KDLYFNHDGSTFKKLQVGVNLVAELVGITLGPKGRNVVLQNKYGPPKIVNDGETVLKEIE  109

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA +KTNDL
Sbjct  110  LEDPLENVGVKLVRQAGAKTNDL  132



>gb|KGN52011.1| hypothetical protein Csa_5G607990 [Cucumis sativus]
Length=619

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDLYFN DGS  KKLQ GVN +A+LVG+TLGPKGRNVVL++KYG PKIVNDG TV +E+E
Sbjct  72   KDLYFNHDGSTFKKLQVGVNLVAELVGITLGPKGRNVVLQNKYGPPKIVNDGETVLKEIE  131

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA +KTNDL
Sbjct  132  LEDPLENVGVKLVRQAGAKTNDL  154



>ref|XP_010066785.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Eucalyptus 
grandis]
 gb|KCW64830.1| hypothetical protein EUGRSUZ_G02400 [Eucalyptus grandis]
Length=594

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +A+AK+L+FN DGSA KKL AGVN +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  33   KAVAKELHFNRDGSATKKLLAGVNMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  92

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA ++TNDL
Sbjct  93   KEIELEDPLENVGVKLVRQAGARTNDL  119



>ref|XP_004490321.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=578

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  279  RSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDG  458
            R + RAM+K+L+FN DG+  KKL AGV+ +A+L+GVTLGPKGRNVVL +KYG PKIVNDG
Sbjct  23   RPRTRAMSKELHFNHDGATTKKLLAGVDLVAELLGVTLGPKGRNVVLHNKYGPPKIVNDG  82

Query  459  VTVAREVELEDPVENIGASLVRQAASKTNDL  551
             TV +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  83   ETVLKEIELEDPLENVGVKLVRQAGAKTNDL  113



>ref|XP_010261583.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nelumbo nucifera]
Length=589

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            K+LYFN DGS +KKLQAGV+ +A+LVGVTLGPKGRNVVLE+KYG PKIVNDGV+V +E++
Sbjct  38   KELYFNHDGSTMKKLQAGVDTVAELVGVTLGPKGRNVVLENKYGPPKIVNDGVSVLKEIQ  97

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LED +EN+GA LVRQA +KTNDL
Sbjct  98   LEDQLENVGAKLVRQAGAKTNDL  120



>ref|XP_009121294.1| PREDICTED: chaperonin 60 subunit beta 3, chloroplastic [Brassica 
rapa]
Length=131

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  348  QAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVELEDPVENIGASLVRQ  527
            +AGVNKL DLVGVTLGPKGRNVVLESKYGSP+IVNDGVTVAREVELE+PVENIGA LVRQ
Sbjct  4    RAGVNKLVDLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELENPVENIGAKLVRQ  63

Query  528  AASKTNDL  551
            AASK NDL
Sbjct  64   AASKNNDL  71



>ref|XP_008446495.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X3 [Cucumis melo]
Length=537

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            K+LYFN DGS  KKLQ GVN +A+LVG+TLGPKGRNVVL++KYG PKIVNDG TV +E+E
Sbjct  52   KELYFNHDGSTFKKLQIGVNLVAELVGITLGPKGRNVVLQNKYGPPKIVNDGETVLKEIE  111

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA +KTNDL
Sbjct  112  LEDPLENVGVKLVRQAGAKTNDL  134



>ref|XP_011462962.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X3 [Fragaria vesca subsp. vesca]
Length=443

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + + KDLYFN DGSA KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGIPKDLYFNHDGSATKKLLAGVSMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELED VEN+G  LVRQA +KTNDL
Sbjct  92   KEIELEDSVENVGVKLVRQAGAKTNDL  118



>ref|XP_008243763.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Prunus mume]
Length=500

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + +AKDL FN DGSA KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  36   KGVAKDLIFNHDGSATKKLLAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  95

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELEDPVEN+G  LVRQA +KTNDL
Sbjct  96   KQIELEDPVENVGVKLVRQAGAKTNDL  122



>ref|XP_008446496.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X4 [Cucumis melo]
Length=528

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            K+LYFN DGS  KKLQ GVN +A+LVG+TLGPKGRNVVL++KYG PKIVNDG TV +E+E
Sbjct  52   KELYFNHDGSTFKKLQIGVNLVAELVGITLGPKGRNVVLQNKYGPPKIVNDGETVLKEIE  111

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA +KTNDL
Sbjct  112  LEDPLENVGVKLVRQAGAKTNDL  134



>ref|XP_011462961.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Fragaria vesca subsp. vesca]
Length=507

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + + KDLYFN DGSA KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGIPKDLYFNHDGSATKKLLAGVSMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELED VEN+G  LVRQA +KTNDL
Sbjct  92   KEIELEDSVENVGVKLVRQAGAKTNDL  118



>ref|XP_010091675.1| Chaperonin 60 subunit beta 4 [Morus notabilis]
 gb|EXB44941.1| Chaperonin 60 subunit beta 4 [Morus notabilis]
Length=649

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +A+AK++YFN DGS  KKLQAGV+ +A L+GVTLGPKGRNVVL+++YG PKIVNDG TV 
Sbjct  34   KAIAKEIYFNQDGSTRKKLQAGVDMVAGLLGVTLGPKGRNVVLQNRYGPPKIVNDGETVL  93

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDPVEN+G  LVRQA +KTNDL
Sbjct  94   KEIELEDPVENVGVKLVRQAGAKTNDL  120



>ref|NP_173947.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
 sp|Q9C667.1|CPNB4_ARATH RecName: Full=Chaperonin 60 subunit beta 4, chloroplastic; Short=CPN-60 
beta 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG50688.1|AC079829_21 chaperonin precursor, putative [Arabidopsis thaliana]
 gb|AEE30663.1| chaperonin 60 subunit beta 4 [Arabidopsis thaliana]
Length=611

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 79/97 (81%), Gaps = 4/97 (4%)
 Frame = +3

Query  261  NVVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP  440
            N VLR    VRA AK+++FN DGS  KKLQAG + +A L+GVTLGPKGRNVVL++KYG P
Sbjct  31   NFVLR----VRAAAKEVHFNRDGSVTKKLQAGADMVAKLLGVTLGPKGRNVVLQNKYGPP  86

Query  441  KIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            +IVNDG TV +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  87   RIVNDGETVLKEIELEDPLENVGVKLVRQAGAKTNDL  123



>dbj|BAD95277.1| chaperonin precursor [Arabidopsis thaliana]
Length=611

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 79/97 (81%), Gaps = 4/97 (4%)
 Frame = +3

Query  261  NVVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP  440
            N VLR    VRA AK+++FN DGS  KKLQAG + +A L+GVTLGPKGRNVVL++KYG P
Sbjct  31   NFVLR----VRAAAKEVHFNRDGSVTKKLQAGADMVAKLLGVTLGPKGRNVVLQNKYGPP  86

Query  441  KIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            +IVNDG TV +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  87   RIVNDGETVLKEIELEDPLENVGVKLVRQAGAKTNDL  123



>ref|XP_008446493.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Cucumis melo]
Length=599

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            K+LYFN DGS  KKLQ GVN +A+LVG+TLGPKGRNVVL++KYG PKIVNDG TV +E+E
Sbjct  52   KELYFNHDGSTFKKLQIGVNLVAELVGITLGPKGRNVVLQNKYGPPKIVNDGETVLKEIE  111

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA +KTNDL
Sbjct  112  LEDPLENVGVKLVRQAGAKTNDL  134



>ref|XP_007227057.1| hypothetical protein PRUPE_ppa020938mg [Prunus persica]
 gb|EMJ28256.1| hypothetical protein PRUPE_ppa020938mg [Prunus persica]
Length=611

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + +AKDL FN DGSA KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGVAKDLIFNHDGSATKKLLAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELEDPVEN+G  LVRQA +KTNDL
Sbjct  92   KQIELEDPVENVGVKLVRQAGAKTNDL  118



>ref|XP_004297181.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=616

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + + KDLYFN DGSA KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGIPKDLYFNHDGSATKKLLAGVSMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELED VEN+G  LVRQA +KTNDL
Sbjct  92   KEIELEDSVENVGVKLVRQAGAKTNDL  118



>ref|XP_011009131.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X4 [Populus euphratica]
Length=487

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAK++YFN DGS  KKL AGV  +++L+GVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  31   KAMAKEIYFNHDGSTTKKLLAGVEMVSELLGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  90

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTN+L
Sbjct  91   KEIELEDPLENVGVKLVRQAGAKTNNL  117



>ref|XP_008243762.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Prunus mume]
Length=625

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + +AKDL FN DGSA KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  36   KGVAKDLIFNHDGSATKKLLAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  95

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELEDPVEN+G  LVRQA +KTNDL
Sbjct  96   KQIELEDPVENVGVKLVRQAGAKTNDL  122



>gb|EYU28916.1| hypothetical protein MIMGU_mgv1a003338mg [Erythranthe guttata]
Length=591

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + +AK+LYFN DGS   KL AGVNK+ADL+GVT+GPKGRNVVL++KYG PKIVNDG TV 
Sbjct  34   KPVAKELYFNHDGSTTIKLLAGVNKVADLIGVTMGPKGRNVVLQNKYGPPKIVNDGETVL  93

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++EL+DP+EN+G  LVRQA +KTNDL
Sbjct  94   KQIELDDPLENVGVKLVRQAGAKTNDL  120



>ref|XP_011009123.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X3 [Populus euphratica]
Length=562

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAK++YFN DGS  KKL AGV  +++L+GVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  31   KAMAKEIYFNHDGSTTKKLLAGVEMVSELLGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  90

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTN+L
Sbjct  91   KEIELEDPLENVGVKLVRQAGAKTNNL  117



>gb|AFW75266.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=131

 Score =   122 bits (307),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 83/125 (66%), Gaps = 31/125 (25%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTF A S++G + + +                             KNV L++R   +V
Sbjct  1    MASTFGATSTVGLMAAPTG----------------------------KNVRLQRRVNFRV  32

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RA AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  33   RA-AKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  91

Query  471  REVEL  485
            REV+ 
Sbjct  92   REVQC  96



>ref|XP_002315987.2| hypothetical protein POPTR_0010s14520g [Populus trichocarpa]
 gb|EEF02158.2| hypothetical protein POPTR_0010s14520g [Populus trichocarpa]
Length=585

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAK++YFN DGS  KKL AGV  +++L+GVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  31   KAMAKEIYFNHDGSTTKKLLAGVEMVSELLGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  90

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTN+L
Sbjct  91   KEIELEDPLENVGVKLVRQAGAKTNNL  117



>ref|XP_011397598.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Auxenochlorella protothecoides]
 gb|KFM24710.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Auxenochlorella protothecoides]
Length=529

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  345  LQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVELEDPVENIGASLVR  524
            +QAGV+KLA +VGVTLGPKGRNVVLE+KYGSPKIVNDGVTVAREVELEDPVENIGA LVR
Sbjct  1    MQAGVDKLASVVGVTLGPKGRNVVLETKYGSPKIVNDGVTVAREVELEDPVENIGAKLVR  60

Query  525  QAASKTNDL  551
            QAASKTNDL
Sbjct  61   QAASKTNDL  69



>ref|XP_011009115.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Populus euphratica]
Length=592

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAK++YFN DGS  KKL AGV  +++L+GVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  31   KAMAKEIYFNHDGSTTKKLLAGVEMVSELLGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  90

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTN+L
Sbjct  91   KEIELEDPLENVGVKLVRQAGAKTNNL  117



>ref|XP_011009108.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Populus euphratica]
Length=593

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            +AMAK++YFN DGS  KKL AGV  +++L+GVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  31   KAMAKEIYFNHDGSTTKKLLAGVEMVSELLGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  90

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTN+L
Sbjct  91   KEIELEDPLENVGVKLVRQAGAKTNNL  117



>emb|CDY56074.1| BnaC06g41650D [Brassica napus]
Length=475

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 92/145 (63%), Gaps = 26/145 (18%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRSKVRA  296
            MASTF+A SS+G++V+              + +   +   ++  GRR+NV  R R    A
Sbjct  1    MASTFTATSSIGSMVATK---------GHRSDNKLMNNLSSSSFGRRQNVFPRLRRSSPA  51

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            +A                 GVNKLA LVGVTLGPKGRN VLESK+GSP+IVNDGVTV RE
Sbjct  52   IA-----------------GVNKLAYLVGVTLGPKGRNAVLESKHGSPRIVNDGVTVVRE  94

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDPVENIGA LVRQAA+KTND 
Sbjct  95   VELEDPVENIGAKLVRQAAAKTNDF  119



>ref|XP_008804418.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Phoenix dactylifera]
Length=595

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  276  KRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVND  455
            KR     + K+L+FN D SA KKLQAGV+ +A+L+GVTLGPKGRNVVLE+KYG PKIVND
Sbjct  19   KRPPPVPIFKELHFNHDLSATKKLQAGVDLVANLIGVTLGPKGRNVVLENKYGPPKIVND  78

Query  456  GVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            G TV +EVELEDP+EN+G  LVRQA +KTNDL
Sbjct  79   GETVLKEVELEDPLENVGVKLVRQAGAKTNDL  110



>ref|XP_009611004.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nicotiana tomentosiformis]
Length=612

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RAMAK+LYFN DGS  KKL AGVN +A+LVGVT+GPKGRNVVL +KYG PKIVNDG TV 
Sbjct  33   RAMAKELYFNHDGSTTKKLLAGVNLVAELVGVTMGPKGRNVVLGNKYGPPKIVNDGETVL  92

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E++LEDP+E++G  LVR+A +KTN+L
Sbjct  93   KEIQLEDPLEHVGVKLVREAGAKTNNL  119



>ref|XP_009774324.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Nicotiana sylvestris]
Length=612

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RAMAK+LYFN DGS  KKL AGV+ +A+LVGVT+GPKGRNVVL +KYG PKIVNDG TV 
Sbjct  33   RAMAKELYFNHDGSTTKKLLAGVDLVAELVGVTMGPKGRNVVLGNKYGPPKIVNDGETVL  92

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E++LEDP+EN+G  LVR+A +KTN+L
Sbjct  93   KEIQLEDPLENVGVKLVREAGAKTNNL  119



>ref|XP_010552083.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Tarenaya 
hassleriana]
Length=628

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  294  AMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAR  473
            A+AK+++FN DGS  KKLQAG + +A+L+GVTLGPKGRNVVL++KYG+P+IVNDG TV +
Sbjct  44   AVAKEVHFNRDGSVTKKLQAGADMVAELLGVTLGPKGRNVVLQNKYGTPRIVNDGETVLK  103

Query  474  EVELEDPVENIGASLVRQAASKTNDL  551
            E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  104  EIELEDPLENVGVKLVRQAGAKTNDL  129



>ref|XP_002890669.1| hypothetical protein ARALYDRAFT_890123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66928.1| hypothetical protein ARALYDRAFT_890123 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            + RA AK+++FN DG+  KKLQAG + +A L+GVTLGPKGRN+VL++KYG PKIVNDG T
Sbjct  27   RARAAAKEVHFNRDGAVTKKLQAGADMVAKLLGVTLGPKGRNIVLQNKYGPPKIVNDGET  86

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  87   VLKEIELEDPLENVGVKLVRQAGAKTNDL  115



>ref|XP_006415907.1| hypothetical protein EUTSA_v10007125mg [Eutrema salsugineum]
 gb|ESQ34260.1| hypothetical protein EUTSA_v10007125mg [Eutrema salsugineum]
Length=604

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            + RA AK+++FN DGS  KKLQAG + +A L+GVTLGPKGRNVVL++KYG P+IVNDG T
Sbjct  29   RARAAAKEVHFNRDGSVTKKLQAGADMVAKLLGVTLGPKGRNVVLQNKYGPPRIVNDGET  88

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  89   VLKEIELEDPLENVGVKLVRQAGAKTNDL  117



>gb|AFW75267.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=175

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 83/125 (66%), Gaps = 31/125 (25%)
 Frame = +3

Query  117  MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  290
            MASTF A S++G + + +                             KNV L++R   +V
Sbjct  45   MASTFGATSTVGLMAAPTG----------------------------KNVRLQRRVNFRV  76

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RA AK+LYFN DGSAIKKLQ GVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA
Sbjct  77   RA-AKELYFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  135

Query  471  REVEL  485
            REV+ 
Sbjct  136  REVQC  140



>ref|XP_002465562.1| hypothetical protein SORBIDRAFT_01g041170 [Sorghum bicolor]
 gb|EER92560.1| hypothetical protein SORBIDRAFT_01g041170 [Sorghum bicolor]
Length=173

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDL+FN D SA KKLQAGV+ +A L+GVTLGPKGRNVVL +KYG PKIVNDG TV +E+E
Sbjct  33   KDLHFNRDLSATKKLQAGVDLVARLLGVTLGPKGRNVVLGNKYGPPKIVNDGETVLKEIE  92

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA ++TND+
Sbjct  93   LEDPLENLGVKLVRQAGARTNDI  115



>ref|XP_010477879.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010477880.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=607

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = +3

Query  261  NVVLRKRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP  440
            N V R     RA AK ++FN DGS  KKLQAG + +A L+GVTLGPKGRNVVL +KYG P
Sbjct  27   NFVFR----ARAAAKQVHFNRDGSVTKKLQAGADMVAKLLGVTLGPKGRNVVLPNKYGPP  82

Query  441  KIVNDGVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            KIVNDG TV +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  83   KIVNDGETVLKEIELEDPLENVGVKLVRQAGAKTNDL  119



>emb|CDY66193.1| BnaA07g36980D [Brassica napus]
Length=607

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            + RA AK+++FN DGS  KKL+AG + +A L+GVTLGPKGRNVVL++KYG PKIVNDG T
Sbjct  32   RARAAAKEVHFNRDGSVTKKLKAGADMVAKLLGVTLGPKGRNVVLQNKYGPPKIVNDGET  91

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  92   VLKEIELEDPLENVGVKLVRQAGAKTNDL  120



>ref|XP_009103087.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Brassica rapa]
Length=607

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            + RA AK+++FN DGS  KKL+AG + +A L+GVTLGPKGRNVVL++KYG PKIVNDG T
Sbjct  32   RARAAAKEVHFNRDGSVTKKLKAGADMVAKLLGVTLGPKGRNVVLQNKYGPPKIVNDGET  91

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  92   VLKEIELEDPLENVGVKLVRQAGAKTNDL  120



>emb|CDY20555.1| BnaC07g12220D [Brassica napus]
Length=607

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            + RA AK+++FN DGS  KKL+AG + +A L+GVTLGPKGRNVVL++KYG PKIVNDG T
Sbjct  32   RARAAAKEVHFNRDGSVTKKLKAGADMVAKLLGVTLGPKGRNVVLQNKYGPPKIVNDGET  91

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  92   VLKEIELEDPLENVGVKLVRQAGAKTNDL  120



>ref|XP_010905780.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Elaeis guineensis]
Length=595

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  276  KRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVND  455
            KR     + K+++FN D SA KKLQAGV+ +A L+GVTLGPKGRNVVLE+KYG PKIVND
Sbjct  19   KRPPPVPIFKEVHFNHDFSATKKLQAGVDLVAKLIGVTLGPKGRNVVLENKYGPPKIVND  78

Query  456  GVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            G TV +EVELEDP+EN+G  LVRQA +KTNDL
Sbjct  79   GETVLKEVELEDPLENVGVKLVRQAGAKTNDL  110



>ref|XP_010460335.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=636

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  KVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVT  464
            + RA AK ++FN DGS  KKLQAG + +A L+GVTLGPKGRNVVL +KYG PKIVNDG T
Sbjct  60   RARAAAKQVHFNRDGSVTKKLQAGADMVAKLLGVTLGPKGRNVVLPNKYGPPKIVNDGET  119

Query  465  VAREVELEDPVENIGASLVRQAASKTNDL  551
            V +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  120  VLKEIELEDPLENVGVKLVRQAGAKTNDL  148



>ref|XP_010499066.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Camelina sativa]
Length=608

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RA AK ++FN DGS  KKLQAG + +A L+GVTLGPKGRNVVL +KYG PKIVNDG TV 
Sbjct  34   RAAAKQVHFNRDGSVTKKLQAGADMVAKLLGVTLGPKGRNVVLPNKYGPPKIVNDGETVL  93

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  94   KEIELEDPLENVGVKLVRQAGAKTNDL  120



>ref|XP_010499065.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X1 [Camelina sativa]
Length=636

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RA AK ++FN DGS  KKLQAG + +A L+GVTLGPKGRNVVL +KYG PKIVNDG TV 
Sbjct  62   RAAAKQVHFNRDGSVTKKLQAGADMVAKLLGVTLGPKGRNVVLPNKYGPPKIVNDGETVL  121

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E+ELEDP+EN+G  LVRQA +KTNDL
Sbjct  122  KEIELEDPLENVGVKLVRQAGAKTNDL  148



>ref|XP_009356484.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=507

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + + KDL FN DGSA KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGIPKDLIFNHDGSATKKLLAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELED VEN+G  LVRQA +KTNDL
Sbjct  92   KQIELEDAVENVGVKLVRQAGAKTNDL  118



>ref|XP_009356483.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Pyrus x bretschneideri]
Length=616

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + + KDL FN DGSA KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGIPKDLIFNHDGSATKKLLAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELED VEN+G  LVRQA +KTNDL
Sbjct  92   KQIELEDAVENVGVKLVRQAGAKTNDL  118



>ref|XP_006348604.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Solanum 
tuberosum]
Length=594

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RAMAK+LYFN DGS  KKL AGV+ +A+LVGVTLGPKGRNVVL +KYG PKIVNDG TV 
Sbjct  33   RAMAKELYFNHDGSTTKKLLAGVDLVAELVGVTLGPKGRNVVLGNKYGPPKIVNDGETVL  92

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E++L+DP+E +G  LVR+A +KTN+L
Sbjct  93   KEIQLDDPLEYVGVKLVREAGAKTNNL  119



>ref|XP_010320797.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=617

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            RAMAK+LYFN DGS  KKL AGV+ +A+LVGVTLGPKGRNVVL +KYG PKIVNDG TV 
Sbjct  33   RAMAKELYFNHDGSTTKKLLAGVDLVAELVGVTLGPKGRNVVLGNKYGPPKIVNDGETVL  92

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +E++L+DP+E +G  LVR+A +KTN+L
Sbjct  93   KEIQLDDPLEYVGVKLVREAGAKTNNL  119



>gb|EMS68279.1| RuBisCO large subunit-binding protein subunit beta, chloroplastic 
[Triticum urartu]
Length=622

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  276  KRSKVRAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVND  455
            K++    + KDL+FN D SA KKLQAGV+ +A LVGVTLGPKGRNVVL +KYG PKIVND
Sbjct  23   KKTPPMPVYKDLHFNHDLSATKKLQAGVDLVARLVGVTLGPKGRNVVLANKYGPPKIVND  82

Query  456  GVTVAREVELEDPVENIGASLVRQAASKTNDL  551
            G TV +EVELEDP+EN+G  LVRQA ++TND+
Sbjct  83   GETVLKEVELEDPLENLGVKLVRQAGARTNDI  114



>ref|XP_003579836.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Brachypodium 
distachyon]
Length=586

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDL+FN D SA KKLQAGV+ +A LVGVTLGPKGRNVVL +KYG PKIVNDG TV +E+E
Sbjct  32   KDLHFNHDLSATKKLQAGVDLVARLVGVTLGPKGRNVVLSNKYGPPKIVNDGETVLKEIE  91

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA ++TND+
Sbjct  92   LEDPLENLGVKLVRQAGARTNDI  114



>ref|XP_008389355.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform 
X2 [Malus domestica]
Length=507

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + + KDL FN DG A KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGIPKDLIFNHDGLATKKLLAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELED VEN+G  LVRQA +KTNDL
Sbjct  92   KQIELEDAVENVGVKLVRQAGAKTNDL  118



>ref|XP_009418029.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=591

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  297  MAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVARE  476
            ++K+L+FN D SA KKLQAGV+ +A+LVGVTLGPKGRNVVL +KYG P+IVNDG TV +E
Sbjct  26   ISKELHFNHDLSATKKLQAGVDLVANLVGVTLGPKGRNVVLGNKYGPPRIVNDGETVLKE  85

Query  477  VELEDPVENIGASLVRQAASKTNDL  551
            VELEDP+EN+G  LVRQA ++TNDL
Sbjct  86   VELEDPLENVGVKLVRQAGARTNDL  110



>ref|XP_006653448.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Oryza 
brachyantha]
Length=583

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDL+FN D SA KKLQAGV+ +A LVGVTLGPKGRNVVL +KYG PKIVNDG TV +E+E
Sbjct  29   KDLHFNRDLSATKKLQAGVDLVARLVGVTLGPKGRNVVLSNKYGPPKIVNDGETVLKEIE  88

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA ++TND+
Sbjct  89   LEDPLENLGVKLVRQAGARTNDI  111



>gb|EEC67866.1| hypothetical protein OsI_35492 [Oryza sativa Indica Group]
Length=588

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDL+FN D SA KKLQAGV+ +A LVGVTLGPKGRNVVL +KYG PKIVNDG TV +E+E
Sbjct  34   KDLHFNRDLSATKKLQAGVDLVARLVGVTLGPKGRNVVLSNKYGPPKIVNDGETVLKEIE  93

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA ++TND+
Sbjct  94   LEDPLENLGVKLVRQAGARTNDV  116



>ref|XP_004975721.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like [Setaria 
italica]
Length=588

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDL+FN D SA KKLQAGV+ +A LVGVTLGPKGRNVVL +KYG PKIVNDG TV +E+E
Sbjct  33   KDLHFNRDLSATKKLQAGVDLVARLVGVTLGPKGRNVVLGNKYGPPKIVNDGETVLKEIE  92

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA ++TND+
Sbjct  93   LEDPLENLGVKLVRQAGARTNDI  115



>ref|XP_008389354.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic isoform X1 [Malus domestica]
Length=614

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + + KDL FN DG A KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGIPKDLIFNHDGLATKKLLAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELED VEN+G  LVRQA +KTNDL
Sbjct  92   KQIELEDAVENVGVKLVRQAGAKTNDL  118



>ref|XP_008351035.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic-like, 
partial [Malus domestica]
Length=427

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  291  RAMAKDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVA  470
            + + KDL FN DG A KKL AGV+ +A+LVGVTLGPKGRNVVL++KYG PKIVNDG TV 
Sbjct  32   KGIPKDLIFNHDGLATKKLLAGVDMVAELVGVTLGPKGRNVVLQNKYGPPKIVNDGETVL  91

Query  471  REVELEDPVENIGASLVRQAASKTNDL  551
            +++ELED VEN+G  LVRQA +K NDL
Sbjct  92   KQIELEDAVENVGVKLVRQAGAKXNDL  118



>ref|XP_008653444.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Zea mays]
 tpg|DAA44367.1| TPA: putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=588

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  303  KDLYFNTDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAREVE  482
            KDL+FN D SA KKLQAGV+ +A L+GVTLGPKGRNVVL +KYG PKIVNDG TV +E+E
Sbjct  33   KDLHFNRDLSATKKLQAGVDLVARLLGVTLGPKGRNVVLGNKYGPPKIVNDGETVLKEIE  92

Query  483  LEDPVENIGASLVRQAASKTNDL  551
            LEDP+EN+G  LVRQA ++TND+
Sbjct  93   LEDPLENLGVKLVRQAGARTNDI  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 612919574843