BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4900

Length=1222
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09802.1|  unnamed protein product                                259   2e-77   Coffea canephora [robusta coffee]
ref|XP_009782606.1|  PREDICTED: phosphatidylinositol glycan ancho...    258   4e-77   Nicotiana sylvestris
ref|XP_011072194.1|  PREDICTED: phosphatidylinositol glycan ancho...    258   7e-77   Sesamum indicum [beniseed]
ref|XP_010278563.1|  PREDICTED: phosphatidylinositol glycan ancho...    255   5e-76   Nelumbo nucifera [Indian lotus]
ref|XP_010055599.1|  PREDICTED: phosphatidylinositol glycan ancho...    255   1e-75   Eucalyptus grandis [rose gum]
gb|KCW72093.1|  hypothetical protein EUGRSUZ_E00536                     254   1e-75   Eucalyptus grandis [rose gum]
gb|EYU29835.1|  hypothetical protein MIMGU_mgv1a005883mg                253   3e-75   Erythranthe guttata [common monkey flower]
gb|KJB12324.1|  hypothetical protein B456_002G011900                    251   4e-75   Gossypium raimondii
ref|XP_010278562.1|  PREDICTED: phosphatidylinositol glycan ancho...    253   4e-75   Nelumbo nucifera [Indian lotus]
ref|XP_009388331.1|  PREDICTED: phosphatidylinositol glycan ancho...    252   5e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002509716.1|  conserved hypothetical protein                     253   9e-75   
gb|KJB12323.1|  hypothetical protein B456_002G011900                    251   1e-74   Gossypium raimondii
ref|XP_002276721.1|  PREDICTED: phosphatidylinositol glycan ancho...    252   1e-74   Vitis vinifera
ref|XP_007042808.1|  GPI transamidase subunit PIG-U isoform 3           251   3e-74   
ref|XP_007042806.1|  GPI transamidase subunit PIG-U isoform 1           250   3e-74   
dbj|BAF01992.1|  cell division cycle protein-related                    241   8e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113021.1|  PREDICTED: phosphatidylinositol glycan ancho...    247   9e-74   Brassica rapa
ref|XP_007042807.1|  GPI transamidase subunit PIG-U isoform 2           250   1e-73   
ref|XP_007042809.1|  GPI transamidase subunit PIG-U isoform 4           249   2e-73   
ref|XP_009113020.1|  PREDICTED: phosphatidylinositol glycan ancho...    248   3e-73   Brassica rapa
ref|XP_008786215.1|  PREDICTED: phosphatidylinositol glycan ancho...    245   3e-73   
emb|CDY45975.1|  BnaA09g12910D                                          248   4e-73   Brassica napus [oilseed rape]
ref|XP_010430395.1|  PREDICTED: phosphatidylinositol glycan ancho...    245   4e-73   Camelina sativa [gold-of-pleasure]
gb|KFK40542.1|  hypothetical protein AALP_AA2G009200                    246   1e-72   Arabis alpina [alpine rockcress]
ref|XP_009627449.1|  PREDICTED: phosphatidylinositol glycan ancho...    243   1e-72   Nicotiana tomentosiformis
gb|EEC73810.1|  hypothetical protein OsI_08523                          244   2e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_010430394.1|  PREDICTED: phosphatidylinositol glycan ancho...    245   3e-72   Camelina sativa [gold-of-pleasure]
ref|NP_176499.2|  GPI transamidase subunit PIG-U                        243   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473542.1|  PREDICTED: phosphatidylinositol glycan ancho...    243   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010418323.1|  PREDICTED: phosphatidylinositol glycan ancho...    243   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008786214.1|  PREDICTED: phosphatidylinositol glycan ancho...    244   4e-72   Phoenix dactylifera
ref|XP_002887978.1|  hypothetical protein ARALYDRAFT_475037             245   4e-72   
ref|XP_004298744.2|  PREDICTED: phosphatidylinositol glycan ancho...    245   4e-72   Fragaria vesca subsp. vesca
ref|NP_974075.1|  GPI transamidase subunit PIG-U                        243   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008346591.1|  PREDICTED: phosphatidylinositol glycan ancho...    235   6e-72   
ref|XP_008786213.1|  PREDICTED: phosphatidylinositol glycan ancho...    244   7e-72   Phoenix dactylifera
ref|XP_006391780.1|  hypothetical protein EUTSA_v10023435mg             244   1e-71   Eutrema salsugineum [saltwater cress]
ref|NP_850969.2|  GPI transamidase subunit PIG-U                        244   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418322.1|  PREDICTED: phosphatidylinositol glycan ancho...    243   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010473541.1|  PREDICTED: phosphatidylinositol glycan ancho...    243   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006358874.1|  PREDICTED: phosphatidylinositol glycan ancho...    243   2e-71   Solanum tuberosum [potatoes]
ref|XP_006647706.1|  PREDICTED: phosphatidylinositol glycan ancho...    243   2e-71   Oryza brachyantha
gb|KEH31711.1|  GPI transamidase subunit PIG-U                          243   3e-71   Medicago truncatula
ref|NP_001047781.1|  Os02g0688900                                       243   3e-71   
gb|EEE57603.1|  hypothetical protein OsJ_07980                          243   3e-71   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK07917.1|  predicted protein                                      242   4e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004953492.1|  PREDICTED: phosphatidylinositol glycan ancho...    242   5e-71   
emb|CDY67234.1|  BnaCnng54040D                                          242   6e-71   Brassica napus [oilseed rape]
gb|KEH31710.1|  GPI transamidase subunit PIG-U                          242   8e-71   Medicago truncatula
ref|XP_007209980.1|  hypothetical protein PRUPE_ppa005072mg             242   8e-71   Prunus persica
ref|XP_008238817.1|  PREDICTED: phosphatidylinositol glycan ancho...    241   1e-70   Prunus mume [ume]
ref|XP_002452728.1|  hypothetical protein SORBIDRAFT_04g031420          240   1e-70   Sorghum bicolor [broomcorn]
ref|XP_006579602.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   1e-70   
ref|XP_010235897.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   1e-70   
ref|XP_010545955.1|  PREDICTED: phosphatidylinositol glycan ancho...    241   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_004245643.1|  PREDICTED: phosphatidylinositol glycan ancho...    240   2e-70   
ref|NP_001148568.1|  GPI transamidase subunit PIG-U family protein      239   4e-70   Zea mays [maize]
gb|KDO63548.1|  hypothetical protein CISIN_1g0117602mg                  234   4e-70   Citrus sinensis [apfelsine]
ref|XP_007155557.1|  hypothetical protein PHAVU_003G211900g             239   4e-70   Phaseolus vulgaris [French bean]
ref|XP_003562742.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   9e-70   Brachypodium distachyon [annual false brome]
gb|KHN34428.1|  Phosphatidylinositol glycan anchor biosynthesis c...    239   1e-69   Glycine soja [wild soybean]
ref|XP_006579601.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   1e-69   Glycine max [soybeans]
ref|XP_008373832.1|  PREDICTED: phosphatidylinositol glycan ancho...    236   2e-69   
ref|XP_008373830.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   3e-69   
ref|XP_004515804.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   4e-69   Cicer arietinum [garbanzo]
ref|XP_003550876.1|  PREDICTED: phosphatidylinositol glycan ancho...    237   4e-69   Glycine max [soybeans]
ref|XP_008369469.1|  PREDICTED: phosphatidylinositol glycan ancho...    235   6e-69   
ref|XP_008369470.1|  PREDICTED: phosphatidylinositol glycan ancho...    236   1e-68   
ref|XP_004964641.1|  PREDICTED: phosphatidylinositol glycan ancho...    235   1e-68   Setaria italica
ref|XP_004515803.1|  PREDICTED: phosphatidylinositol glycan ancho...    236   2e-68   Cicer arietinum [garbanzo]
gb|EPS73832.1|  hypothetical protein M569_00921                         235   3e-68   Genlisea aurea
ref|XP_004964640.1|  PREDICTED: phosphatidylinositol glycan ancho...    235   3e-68   
ref|XP_006477405.1|  PREDICTED: phosphatidylinositol glycan ancho...    235   4e-68   
ref|XP_006440549.1|  hypothetical protein CICLE_v10019953mg             234   5e-68   
ref|XP_012086990.1|  PREDICTED: phosphatidylinositol glycan ancho...    234   6e-68   Jatropha curcas
ref|XP_012086988.1|  PREDICTED: phosphatidylinositol glycan ancho...    234   1e-67   Jatropha curcas
ref|XP_008437214.1|  PREDICTED: phosphatidylinositol glycan ancho...    233   1e-67   Cucumis melo [Oriental melon]
ref|XP_010933541.1|  PREDICTED: phosphatidylinositol glycan ancho...    230   9e-67   Elaeis guineensis
ref|XP_010933540.1|  PREDICTED: phosphatidylinositol glycan ancho...    230   1e-66   Elaeis guineensis
ref|XP_004143931.1|  PREDICTED: phosphatidylinositol glycan ancho...    230   2e-66   Cucumis sativus [cucumbers]
ref|XP_009344269.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    230   3e-66   
ref|XP_010112563.1|  Phosphatidylinositol glycan anchor biosynthe...    229   6e-66   
ref|XP_011029200.1|  PREDICTED: phosphatidylinositol glycan ancho...    225   2e-65   Populus euphratica
ref|XP_011029199.1|  PREDICTED: phosphatidylinositol glycan ancho...    226   7e-65   Populus euphratica
ref|XP_010676542.1|  PREDICTED: phosphatidylinositol glycan ancho...    226   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002299558.1|  hypothetical protein POPTR_0001s08870g             225   2e-64   
gb|KGN50142.1|  hypothetical protein Csa_5G155530                       231   4e-64   Cucumis sativus [cucumbers]
ref|XP_011624959.1|  PREDICTED: phosphatidylinositol glycan ancho...    220   1e-61   
ref|XP_002889963.1|  hypothetical protein ARALYDRAFT_471424             214   2e-60   
gb|ERN00380.1|  hypothetical protein AMTR_s00104p00124380               211   3e-60   Amborella trichopoda
ref|XP_011621261.1|  PREDICTED: phosphatidylinositol glycan ancho...    211   4e-59   Amborella trichopoda
gb|EAZ14305.1|  hypothetical protein OsJ_04231                          206   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006302210.1|  hypothetical protein CARUB_v10020222mg             210   9e-59   
ref|NP_973813.1|  GPI transamidase subunit PIG-U                        207   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563912.1|  GPI transamidase subunit PIG-U                        207   7e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EEC71873.1|  hypothetical protein OsI_04592                          209   2e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_010458703.1|  PREDICTED: phosphatidylinositol glycan ancho...    193   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010458704.1|  PREDICTED: phosphatidylinositol glycan ancho...    194   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002985010.1|  hypothetical protein SELMODRAFT_121519             193   1e-52   
ref|XP_002986198.1|  hypothetical protein SELMODRAFT_43879              192   2e-52   
ref|XP_001778404.1|  predicted protein                                  193   6e-52   
ref|XP_010476248.1|  PREDICTED: phosphatidylinositol glycan ancho...    189   3e-51   
ref|XP_010476249.1|  PREDICTED: phosphatidylinositol glycan ancho...    188   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010476247.1|  PREDICTED: phosphatidylinositol glycan ancho...    189   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            183   7e-49   Nicotiana tomentosiformis
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            181   8e-48   Nicotiana sylvestris
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            178   6e-47   Solanum lycopersicum
dbj|BAD81713.1|  putative transamidase complex subunit PIG-U            174   9e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       176   2e-46   Solanum tuberosum [potatoes]
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                175   8e-46   Erythranthe guttata [common monkey flower]
gb|AAF88086.1|AC025417_14  T12C24.26                                    172   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            172   8e-45   Sesamum indicum [beniseed]
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         164   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_009627450.1|  PREDICTED: phosphatidylinositol glycan ancho...    166   9e-44   Nicotiana tomentosiformis
emb|CDP02851.1|  unnamed protein product                                167   4e-43   Coffea canephora [robusta coffee]
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    167   5e-43   Phoenix dactylifera
ref|XP_002528403.1|  serine carboxypeptidase, putative                  167   7e-43   Ricinus communis
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             164   8e-43   
emb|CBI36578.3|  unnamed protein product                                167   1e-42   Vitis vinifera
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    167   1e-42   Phoenix dactylifera
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            167   1e-42   Vitis vinifera
gb|AAG51607.1|AC010795_11  unknown protein; 55290-58984                 167   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  162   1e-42   Citrus sinensis [apfelsine]
gb|KJB76660.1|  hypothetical protein B456_012G098600                    164   3e-42   Gossypium raimondii
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       164   7e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            164   8e-42   Nelumbo nucifera [Indian lotus]
gb|AFK34623.1|  unknown                                                 156   1e-41   Lotus japonicus
emb|CAN75200.1|  hypothetical protein VITISV_014887                     164   1e-41   Vitis vinifera
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             164   1e-41   Citrus clementina [clementine]
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    164   1e-41   Citrus sinensis [apfelsine]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             164   1e-41   Citrus clementina [clementine]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            164   1e-41   Vitis vinifera
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            163   2e-41   Pyrus x bretschneideri [bai li]
gb|KJB76659.1|  hypothetical protein B456_012G098600                    163   2e-41   Gossypium raimondii
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    162   4e-41   Theobroma cacao [chocolate]
ref|XP_012071557.1|  PREDICTED: serine carboxypeptidase II-2-like       162   5e-41   Jatropha curcas
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         162   6e-41   Gossypium arboreum [tree cotton]
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            161   7e-41   Fragaria vesca subsp. vesca
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            161   1e-40   
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             161   1e-40   Prunus persica
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            160   1e-40   Prunus mume [ume]
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         160   2e-40   
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             160   2e-40   
gb|KCW72094.1|  hypothetical protein EUGRSUZ_E00536                     159   2e-40   Eucalyptus grandis [rose gum]
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             157   3e-40   
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       159   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS71160.1|  hypothetical protein M569_03591                         158   5e-40   Genlisea aurea
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            159   7e-40   Elaeis guineensis
ref|XP_006845388.1|  PREDICTED: serine carboxypeptidase II-2            159   7e-40   Amborella trichopoda
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         158   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    157   1e-39   Populus euphratica
gb|KDP38716.1|  hypothetical protein JCGZ_04069                         152   3e-39   Jatropha curcas
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    156   5e-39   Populus euphratica
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            156   7e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       154   8e-38   Cucumis sativus [cucumbers]
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase II-2            152   9e-38   Cucumis sativus [cucumbers]
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            152   1e-37   Eucalyptus grandis [rose gum]
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       152   1e-37   Eucalyptus grandis [rose gum]
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            152   1e-37   Cucumis melo [Oriental melon]
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    151   4e-37   Arabis alpina [alpine rockcress]
gb|AEX12786.1|  hypothetical protein 2_8315_02                          142   5e-37   Pinus radiata
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            150   5e-37   Brachypodium distachyon [annual false brome]
gb|AEX12770.1|  hypothetical protein 2_8315_02                          142   5e-37   Pinus taeda
gb|AEX12772.1|  hypothetical protein 2_8315_02                          142   5e-37   Pinus taeda
gb|KHN02055.1|  Serine carboxypeptidase II-2                            150   6e-37   Glycine soja [wild soybean]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       150   7e-37   Glycine max [soybeans]
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             149   1e-36   Capsella rubella
gb|ABK24285.1|  unknown                                                 148   3e-36   Picea sitchensis
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       147   6e-36   Oryza brachyantha
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                146   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       146   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         146   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             146   2e-35   
emb|CDY23258.1|  BnaA08g12880D                                          146   2e-35   Brassica napus [oilseed rape]
emb|CDY55623.1|  BnaC03g77560D                                          146   2e-35   Brassica napus [oilseed rape]
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             145   3e-35   Phaseolus vulgaris [French bean]
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         145   4e-35   Camelina sativa [gold-of-pleasure]
gb|KJB78940.1|  hypothetical protein B456_013G026200                    144   4e-35   Gossypium raimondii
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         145   5e-35   Gossypium arboreum [tree cotton]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    144   6e-35   Glycine max [soybeans]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         145   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         144   7e-35   Brassica rapa
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         144   7e-35   Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          144   7e-35   Brassica napus [oilseed rape]
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    144   8e-35   
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             144   9e-35   Phaseolus vulgaris [French bean]
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          144   9e-35   Zea mays [maize]
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         144   9e-35   
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    144   9e-35   
gb|KJB78942.1|  hypothetical protein B456_013G026200                    143   9e-35   Gossypium raimondii
emb|CDX68696.1|  BnaC01g07570D                                          144   1e-34   
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         144   1e-34   Brassica rapa
gb|KJB78939.1|  hypothetical protein B456_013G026200                    143   1e-34   Gossypium raimondii
gb|KJB78938.1|  hypothetical protein B456_013G026200                    143   2e-34   Gossypium raimondii
emb|CDX72270.1|  BnaC07g42920D                                          144   2e-34   
ref|NP_001057009.1|  Os06g0186400                                       143   3e-34   
ref|XP_006850617.1|  PREDICTED: serine carboxypeptidase-like 27         142   3e-34   Amborella trichopoda
emb|CDP11023.1|  unnamed protein product                                142   3e-34   Coffea canephora [robusta coffee]
gb|EMS63096.1|  Phosphatidylinositol glycan anchor biosynthesis c...    140   4e-34   Triticum urartu
emb|CDX68695.1|  BnaC01g07580D                                          142   4e-34   
dbj|BAJ99024.1|  predicted protein                                      142   6e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         142   6e-34   Nelumbo nucifera [Indian lotus]
dbj|BAK02147.1|  predicted protein                                      142   7e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    141   7e-34   Solanum tuberosum [potatoes]
emb|CDY28217.1|  BnaA01g06320D                                          141   8e-34   Brassica napus [oilseed rape]
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             141   8e-34   
emb|CDY28216.1|  BnaA01g06330D                                          141   9e-34   Brassica napus [oilseed rape]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         141   9e-34   Glycine soja [wild soybean]
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    141   1e-33   Glycine max [soybeans]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             141   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_002534550.1|  serine carboxypeptidase, putative                  139   2e-33   
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         140   2e-33   Solanum lycopersicum
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                   139   2e-33   Citrus sinensis [apfelsine]
gb|KEH38195.1|  serine carboxypeptidase-like protein                    139   3e-33   Medicago truncatula
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       140   3e-33   Medicago truncatula
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       139   3e-33   Setaria italica
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             139   3e-33   Citrus clementina [clementine]
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27         139   4e-33   Cucumis sativus [cucumbers]
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         139   4e-33   Glycine soja [wild soybean]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    139   4e-33   Glycine max [soybeans]
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         139   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         139   5e-33   Populus euphratica
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         139   5e-33   Tarenaya hassleriana [spider flower]
emb|CDO99730.1|  unnamed protein product                                139   6e-33   Coffea canephora [robusta coffee]
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         139   6e-33   Nelumbo nucifera [Indian lotus]
gb|KJB76564.1|  hypothetical protein B456_012G094900                    136   8e-33   Gossypium raimondii
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         138   8e-33   Populus euphratica
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         138   8e-33   Populus euphratica
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         138   9e-33   Sesamum indicum [beniseed]
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               138   9e-33   Medicago truncatula
gb|KJB76565.1|  hypothetical protein B456_012G094900                    136   1e-32   Gossypium raimondii
ref|XP_012086498.1|  PREDICTED: serine carboxypeptidase-like 27         138   1e-32   Jatropha curcas
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               138   1e-32   Medicago truncatula
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         138   1e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         137   1e-32   Fragaria vesca subsp. vesca
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               137   2e-32   Medicago truncatula
gb|AES62200.2|  serine carboxypeptidase-like protein                    137   2e-32   Medicago truncatula
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               137   2e-32   
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         137   2e-32   Brassica rapa
gb|AFK43035.1|  unknown                                                 137   2e-32   Medicago truncatula
gb|AES66787.2|  serine carboxypeptidase-like protein                    137   2e-32   Medicago truncatula
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         137   2e-32   Nicotiana tomentosiformis
dbj|BAK05698.1|  predicted protein                                      135   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY40438.1|  BnaA04g20790D                                          137   3e-32   Brassica napus [oilseed rape]
ref|XP_003596536.1|  Serine carboxypeptidase                            137   3e-32   
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             137   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         137   3e-32   Nicotiana sylvestris
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       137   3e-32   Cicer arietinum [garbanzo]
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         136   4e-32   Cucumis melo [Oriental melon]
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       136   4e-32   Medicago truncatula
ref|XP_007009788.1|  Serine carboxypeptidase-like 27 isoform 2          135   5e-32   
gb|KJB76569.1|  hypothetical protein B456_012G094900                    136   5e-32   Gossypium raimondii
gb|KJB76563.1|  hypothetical protein B456_012G094900                    136   5e-32   Gossypium raimondii
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    135   6e-32   Nelumbo nucifera [Indian lotus]
gb|KJB76567.1|  hypothetical protein B456_012G094900                    136   7e-32   Gossypium raimondii
gb|KJB76566.1|  hypothetical protein B456_012G094900                    136   7e-32   Gossypium raimondii
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    135   7e-32   Fragaria vesca subsp. vesca
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             135   7e-32   Eutrema salsugineum [saltwater cress]
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    135   8e-32   Fragaria vesca subsp. vesca
emb|CDY32091.1|  BnaC04g44750D                                          135   8e-32   Brassica napus [oilseed rape]
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    135   9e-32   
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    135   9e-32   Nelumbo nucifera [Indian lotus]
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    135   1e-31   Hordeum vulgare [barley]
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    135   1e-31   Arabis alpina [alpine rockcress]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         135   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          135   1e-31   
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    135   1e-31   Cicer arietinum [garbanzo]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   134   2e-31   Citrus sinensis [apfelsine]
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             134   2e-31   Citrus clementina [clementine]
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         134   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI31484.3|  unnamed protein product                                134   3e-31   Vitis vinifera
gb|AFK37459.1|  unknown                                                 134   3e-31   Lotus japonicus
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         134   3e-31   Vitis vinifera
emb|CDY40439.1|  BnaA04g20780D                                          134   4e-31   Brassica napus [oilseed rape]
gb|EPS66906.1|  hypothetical protein M569_07869                         133   4e-31   Genlisea aurea
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              133   4e-31   Fragaria vesca subsp. vesca
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                132   4e-31   Erythranthe guttata [common monkey flower]
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         133   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         133   5e-31   
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         133   5e-31   
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         133   5e-31   
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         133   6e-31   
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         133   6e-31   
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         133   6e-31   
gb|EYU39590.1|  hypothetical protein MIMGU_mgv1a0101821mg               127   7e-31   
ref|NP_181121.1|  serine carboxypeptidase-like 26                       132   8e-31   
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28         132   8e-31   
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    132   8e-31   
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         132   9e-31   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         132   1e-30   
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         132   1e-30   
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         132   1e-30   
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         132   1e-30   
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         132   1e-30   
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     132   1e-30   
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         132   1e-30   
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         132   2e-30   
gb|KJB77375.1|  hypothetical protein B456_012G134700                    132   2e-30   
gb|KJB77374.1|  hypothetical protein B456_012G134700                    131   2e-30   
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             131   2e-30   
gb|KJB77373.1|  hypothetical protein B456_012G134700                    132   2e-30   
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    131   2e-30   
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       132   2e-30   
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    131   2e-30   
ref|XP_010933542.1|  PREDICTED: phosphatidylinositol glycan ancho...    130   2e-30   
emb|CDY35977.1|  BnaA05g29730D                                          131   2e-30   
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         127   2e-30   
emb|CDY28004.1|  BnaC05g44060D                                          131   3e-30   
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    131   3e-30   
gb|KHN35601.1|  Serine carboxypeptidase II-3                            131   3e-30   
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             131   3e-30   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         130   4e-30   
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         130   4e-30   
emb|CBI21207.3|  unnamed protein product                                130   4e-30   
ref|XP_006373363.1|  hypothetical protein POPTR_0017s12960g             130   4e-30   
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          130   5e-30   
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             130   5e-30   
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             130   6e-30   
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             130   6e-30   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         130   6e-30   
ref|NP_187456.1|  serine carboxypeptidase-like 27                       130   7e-30   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         130   8e-30   
gb|KJB07560.1|  hypothetical protein B456_001G032600                    129   8e-30   
gb|KJB76572.1|  hypothetical protein B456_012G095000                    129   9e-30   
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 129   1e-29   
ref|XP_012086520.1|  PREDICTED: serine carboxypeptidase-like 28         129   1e-29   
ref|XP_007439710.1|  PREDICTED: phosphatidylinositol glycan ancho...    128   1e-29   
gb|KJB76570.1|  hypothetical protein B456_012G095000                    129   1e-29   
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         129   1e-29   
ref|XP_010260054.1|  PREDICTED: serine carboxypeptidase-like 25 i...    129   1e-29   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    129   1e-29   
ref|XP_009874062.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   1e-29   
gb|KJB76571.1|  hypothetical protein B456_012G095000                    129   1e-29   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       129   1e-29   
ref|XP_006307624.1|  hypothetical protein CARUB_v10009259mg             129   1e-29   
emb|CAN74854.1|  hypothetical protein VITISV_028701                     129   1e-29   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    129   1e-29   
gb|KJB07562.1|  hypothetical protein B456_001G032600                    129   1e-29   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    129   1e-29   
gb|KJB07564.1|  hypothetical protein B456_001G032600                    129   2e-29   
gb|KJB07559.1|  hypothetical protein B456_001G032600                    129   2e-29   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    129   2e-29   
ref|NP_001152245.1|  lysosomal protective protein precursor             129   2e-29   
ref|XP_008400714.1|  PREDICTED: phosphatidylinositol glycan ancho...    128   3e-29   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          128   3e-29   
ref|XP_003756973.1|  PREDICTED: phosphatidylinositol glycan ancho...    128   3e-29   
ref|XP_005295443.1|  PREDICTED: phosphatidylinositol glycan ancho...    127   3e-29   
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         128   3e-29   
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       128   3e-29   
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         128   3e-29   
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         128   3e-29   
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         128   3e-29   
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  126   3e-29   
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    128   3e-29   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            128   3e-29   
ref|XP_009513461.1|  PREDICTED: phosphatidylinositol glycan ancho...    124   3e-29   
gb|KFW87047.1|  Phosphatidylinositol glycan anchor biosynthesis c...    124   3e-29   
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         127   4e-29   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            127   4e-29   
ref|XP_001371434.1|  PREDICTED: phosphatidylinositol glycan ancho...    127   4e-29   
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         127   4e-29   
ref|XP_007579281.1|  PREDICTED: phosphatidylinositol glycan ancho...    127   4e-29   
ref|XP_005091265.1|  PREDICTED: phosphatidylinositol glycan ancho...    127   4e-29   
ref|NP_001151874.1|  LOC100285510 precursor                             127   4e-29   
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         127   5e-29   
gb|EOB02388.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   5e-29   
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       127   5e-29   
ref|XP_003976608.1|  PREDICTED: phosphatidylinositol glycan ancho...    127   5e-29   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         127   5e-29   
ref|XP_005821936.1|  hypothetical protein GUITHDRAFT_118887             124   6e-29   
ref|XP_005295442.1|  PREDICTED: phosphatidylinositol glycan ancho...    127   6e-29   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         127   6e-29   
ref|XP_012071522.1|  PREDICTED: serine carboxypeptidase 24 isofor...    126   6e-29   
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    126   6e-29   
ref|XP_007057220.1|  PREDICTED: phosphatidylinositol glycan ancho...    127   6e-29   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  127   7e-29   
ref|XP_012091548.1|  PREDICTED: serine carboxypeptidase-like 32         127   7e-29   
ref|NP_001047514.1|  Os02g0634700                                       127   7e-29   
ref|NP_001016206.1|  phosphatidylinositol glycan anchor biosynthe...    126   7e-29   
ref|XP_003451893.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   7e-29   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       127   7e-29   
ref|XP_002520355.1|  serine carboxypeptidase, putative                  127   7e-29   
ref|XP_003220541.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   7e-29   
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         127   8e-29   
ref|XP_417310.2|  PREDICTED: phosphatidylinositol glycan anchor b...    126   8e-29   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              127   8e-29   
gb|EEC73659.1|  hypothetical protein OsI_08191                          127   8e-29   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         127   8e-29   
ref|XP_007474288.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   8e-29   
emb|CDP10248.1|  unnamed protein product                                126   8e-29   
gb|KFQ82004.1|  Phosphatidylinositol glycan anchor biosynthesis c...    126   8e-29   
ref|XP_009982196.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   8e-29   
ref|XP_010720523.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   9e-29   
gb|KFV15897.1|  Phosphatidylinositol glycan anchor biosynthesis c...    126   9e-29   
emb|CBI29056.3|  unnamed protein product                                126   9e-29   
gb|KFO10298.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   9e-29   
ref|XP_010505097.1|  PREDICTED: serine carboxypeptidase-like 28         126   9e-29   
gb|ELT93166.1|  hypothetical protein CAPTEDRAFT_175379                  126   9e-29   
ref|XP_006131145.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   1e-28   
ref|XP_012071521.1|  PREDICTED: serine carboxypeptidase 24 isofor...    126   1e-28   
gb|KFP96270.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
ref|XP_006639729.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   1e-28   
ref|XP_008806723.1|  PREDICTED: serine carboxypeptidase-like 33 i...    126   1e-28   
gb|KFU91292.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
gb|KFR06716.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         126   1e-28   
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       126   1e-28   
ref|XP_010299561.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
ref|XP_008806724.1|  PREDICTED: serine carboxypeptidase-like 33 i...    126   1e-28   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    126   1e-28   
gb|KFV40017.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
gb|KFP60678.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
gb|KFP53118.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
gb|KFP09355.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
ref|XP_009636095.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
ref|XP_008504592.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
gb|KFV47283.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         126   1e-28   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       126   1e-28   
ref|XP_009962160.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
ref|XP_009816971.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
gb|KEH32355.1|  serine carboxypeptidase-like protein                    126   1e-28   
gb|KFO97990.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
gb|EMC80393.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
ref|XP_005018115.1|  PREDICTED: phosphatidylinositol glycan ancho...    126   1e-28   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                126   1e-28   
ref|XP_011018041.1|  PREDICTED: serine carboxypeptidase 24-like i...    125   1e-28   
gb|KFV83565.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
gb|KFQ46534.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
ref|XP_009693560.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
ref|XP_009066552.1|  hypothetical protein LOTGIDRAFT_108975             125   1e-28   
gb|AES71591.2|  serine carboxypeptidase-like protein                    126   1e-28   
ref|XP_009471646.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
ref|XP_009959376.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
gb|KFZ67286.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   1e-28   
emb|CAG10747.1|  unnamed protein product                                125   1e-28   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   126   1e-28   
ref|XP_004559109.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
ref|XP_011474009.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   1e-28   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       126   1e-28   
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    125   1e-28   
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         126   2e-28   
gb|KFQ02189.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
ref|XP_006297634.1|  hypothetical protein CARUB_v10013654mg             125   2e-28   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         125   2e-28   
emb|CBI18754.3|  unnamed protein product                                126   2e-28   
ref|XP_010008888.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
ref|XP_010208875.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
gb|KFP28843.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
ref|XP_011596086.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
gb|KFV92087.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
emb|CAN82217.1|  hypothetical protein VITISV_020424                     126   2e-28   
ref|NP_181120.2|  serine carboxypeptidase-like 28                       125   2e-28   
ref|XP_005435053.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
gb|KFW70841.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         125   2e-28   
ref|XP_009915124.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
ref|XP_009488751.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
gb|KGL75860.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
ref|XP_010140442.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
ref|XP_005229381.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
ref|XP_005512274.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
gb|KGL94360.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
gb|KFO93459.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         126   2e-28   
ref|XP_009575576.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
gb|KFQ65711.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
gb|KFM10197.1|  Phosphatidylinositol glycan anchor biosynthesis c...    125   2e-28   
gb|ACA61622.1|  hypothetical protein AP7_B10.2                          120   2e-28   
emb|CDO99728.1|  unnamed protein product                                125   2e-28   
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             125   2e-28   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24              125   2e-28   
ref|XP_007474289.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
ref|XP_006294164.1|  hypothetical protein CARUB_v10023157mg             125   2e-28   
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    125   2e-28   
ref|XP_009677576.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             125   2e-28   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    125   2e-28   
gb|KFO54058.1|  Phosphatidylinositol glycan anchor biosynthesis c...    124   2e-28   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         125   2e-28   
ref|XP_010562851.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
ref|XP_006410746.1|  hypothetical protein EUTSA_v10016610mg             125   2e-28   
ref|XP_006266689.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         125   2e-28   
gb|KFW10014.1|  Phosphatidylinositol glycan anchor biosynthesis c...    124   2e-28   
ref|XP_006038211.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   2e-28   
emb|CAN75418.1|  hypothetical protein VITISV_014880                     125   2e-28   
ref|XP_006453595.1|  hypothetical protein CICLE_v10008182mg             124   3e-28   
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34         125   3e-28   
ref|XP_010118277.1|  PREDICTED: phosphatidylinositol glycan ancho...    124   3e-28   
ref|XP_009998160.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   3e-28   
ref|XP_009884630.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   3e-28   
gb|KFP41745.1|  Phosphatidylinositol glycan anchor biosynthesis c...    124   3e-28   
ref|XP_009281546.1|  PREDICTED: phosphatidylinositol glycan ancho...    124   3e-28   
ref|XP_009563654.1|  PREDICTED: phosphatidylinositol glycan ancho...    125   3e-28   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    125   3e-28   
ref|XP_009327633.1|  PREDICTED: phosphatidylinositol glycan ancho...    124   3e-28   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         125   3e-28   
emb|CAN79972.1|  hypothetical protein VITISV_010072                     124   3e-28   
ref|XP_010914643.1|  PREDICTED: serine carboxypeptidase-like 33         125   3e-28   



>emb|CDP09802.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVF+FFR+FFLIV H NILFMILPLA+RLY+RPCFLAFVY
Sbjct  311   FILTVKDLSPNIGVLWYFFAEVFEFFRNFFLIVCHANILFMILPLAIRLYHRPCFLAFVY  370

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             MAI S+LKSYPSVGDSALYLGLLALF NEL+EM FSFFLFCGYVGVSLLSPVMHNLWIWR
Sbjct  371   MAISSILKSYPSVGDSALYLGLLALFANELAEMQFSFFLFCGYVGVSLLSPVMHNLWIWR  430

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YACFQ
Sbjct  431   GTGNANFYFATAMAYACFQ  449



>ref|XP_009782606.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X1 [Nicotiana sylvestris]
 ref|XP_009782607.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X2 [Nicotiana sylvestris]
 ref|XP_009782608.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X3 [Nicotiana sylvestris]
Length=464

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVF+FFR+FFLIVFHVNILFMILPLA+RL +RPCFLAFVY
Sbjct  301   FILTVKDLSPNIGVLWYFFAEVFEFFRNFFLIVFHVNILFMILPLAIRLKHRPCFLAFVY  360

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             MAICSMLK YPSVGDSALYL LL LF NEL+EM FSFFLFCGYVGVSLLSPVMHNLWIWR
Sbjct  361   MAICSMLKPYPSVGDSALYLALLVLFFNELAEMQFSFFLFCGYVGVSLLSPVMHNLWIWR  420

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT M YACFQ
Sbjct  421   GTGNANFYFATGMAYACFQ  439



>ref|XP_011072194.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Sesamum indicum]
Length=469

 Score =   258 bits (658),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFR+FFLIVFHVNILFMILPLA+RL +RPCFL FVY
Sbjct  304   FILTVKDLSPNIGVLWYFFAEVFDFFRNFFLIVFHVNILFMILPLAIRLNHRPCFLVFVY  363

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYL LL LF+NEL+EM FSFFLFCGYVGVSLLSPVMHNLWIWR
Sbjct  364   LAISSMLKSYPSVGDSALYLSLLVLFVNELAEMQFSFFLFCGYVGVSLLSPVMHNLWIWR  423

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YACFQ
Sbjct  424   GTGNANFYFATAIAYACFQ  442



>ref|XP_010278563.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Nelumbo nucifera]
Length=463

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++DLSPNIGVLWYFFAEVFDFFR FFLIVFH+NILFMILPLA+RL +RPCFLAFVY
Sbjct  299   FILTMEDLSPNIGVLWYFFAEVFDFFRDFFLIVFHINILFMILPLAIRLKHRPCFLAFVY  358

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLG+L LFINEL+EM FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  359   IAISSMLKSYPSVGDSALYLGILGLFINELAEMKFSFFLFCGYIGVSLLSPVMHNLWIWR  418

Query  862   GTGNANFYFATAMGYACFQ----GEVVGFARNRRTM  767
             GTGNANFYFATA+ YAC Q     E VG   N   M
Sbjct  419   GTGNANFYFATAIAYACLQIILVVESVGAMLNHDRM  454



>ref|XP_010055599.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Eucalyptus grandis]
 gb|KCW72092.1| hypothetical protein EUGRSUZ_E00536 [Eucalyptus grandis]
Length=496

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFR FFLIVFHVNILFM+LPLA+RL +RP FLAFVY
Sbjct  327   FILTVKDLSPNIGVLWYFFAEVFDFFRDFFLIVFHVNILFMMLPLAIRLKHRPGFLAFVY  386

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SM KSYPS+GDSALYLG+LALF+NEL+EM FSFFLFCGYVGVSLLSPVMHNLWIWR
Sbjct  387   LAISSMFKSYPSIGDSALYLGVLALFVNELAEMKFSFFLFCGYVGVSLLSPVMHNLWIWR  446

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YAC Q
Sbjct  447   GTGNANFYFATAMAYACLQ  465



>gb|KCW72093.1| hypothetical protein EUGRSUZ_E00536 [Eucalyptus grandis]
Length=466

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFR FFLIVFHVNILFM+LPLA+RL +RP FLAFVY
Sbjct  327   FILTVKDLSPNIGVLWYFFAEVFDFFRDFFLIVFHVNILFMMLPLAIRLKHRPGFLAFVY  386

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SM KSYPS+GDSALYLG+LALF+NEL+EM FSFFLFCGYVGVSLLSPVMHNLWIWR
Sbjct  387   LAISSMFKSYPSIGDSALYLGVLALFVNELAEMKFSFFLFCGYVGVSLLSPVMHNLWIWR  446

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YAC Q
Sbjct  447   GTGNANFYFATAMAYACLQ  465



>gb|EYU29835.1| hypothetical protein MIMGU_mgv1a005883mg [Erythranthe guttata]
Length=466

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             F LTVKDLSPNIGVLWYFFAEVFDFFR+FF+IVFHVNILFMILPLA+RL +RPCFL FVY
Sbjct  302   FTLTVKDLSPNIGVLWYFFAEVFDFFRNFFVIVFHVNILFMILPLAIRLNHRPCFLVFVY  361

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYL LL LF+NELSEM  SFFLFCGYVGVSLLSPVMHNLWIWR
Sbjct  362   LAISSMLKSYPSVGDSALYLSLLVLFVNELSEMKLSFFLFCGYVGVSLLSPVMHNLWIWR  421

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YA FQ
Sbjct  422   GTGNANFYFATAMAYASFQ  440



>gb|KJB12324.1| hypothetical protein B456_002G011900 [Gossypium raimondii]
Length=397

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVF+FFR+FFLIVFHVNILFMILPLA+RL +RPC+LAFVY
Sbjct  228   FILTVEDLSPNIGVLWYFFAEVFEFFRNFFLIVFHVNILFMILPLAIRLRHRPCYLAFVY  287

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AICSMLKSYPSVGDSALYLGLL  F+NEL++M FS FLFCGYVGVSLLSPVMHNLWIWR
Sbjct  288   VAICSMLKSYPSVGDSALYLGLLGWFVNELADMQFSLFLFCGYVGVSLLSPVMHNLWIWR  347

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF TAM YAC Q
Sbjct  348   GTGNANFYFTTAMVYACLQ  366



>ref|XP_010278562.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Nelumbo nucifera]
Length=478

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++DLSPNIGVLWYFFAEVFDFFR FFLIVFH+NILFMILPLA+RL +RPCFLAFVY
Sbjct  299   FILTMEDLSPNIGVLWYFFAEVFDFFRDFFLIVFHINILFMILPLAIRLKHRPCFLAFVY  358

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLG+L LFINEL+EM FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  359   IAISSMLKSYPSVGDSALYLGILGLFINELAEMKFSFFLFCGYIGVSLLSPVMHNLWIWR  418

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  419   GTGNANFYFATAIAYACLQ  437



>ref|XP_009388331.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Musa acuminata subsp. malaccensis]
Length=461

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFHVNILFMILPLA+RL +R CFLAFVY
Sbjct  299   FILTVEDLSPNIGVLWYFFAEVFDFFRNFFLIVFHVNILFMILPLAIRLKHRSCFLAFVY  358

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLLALF NEL++M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  359   IAISSMLKSYPSVGDSALYLGLLALFCNELADMHFSFFLFCGYIGVSLLSPVMHNLWIWR  418

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + YAC Q  +V
Sbjct  419   GTGNANFYFATGLAYACLQTVLV  441



>ref|XP_002509716.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51103.1| conserved hypothetical protein [Ricinus communis]
Length=490

 Score =   253 bits (645),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+D+SPNIGVLWYFFAEVFDFFR+FFLIVFH NILFM+LPLA+RLY+RPCFLAFVY
Sbjct  318   FILTVEDMSPNIGVLWYFFAEVFDFFRNFFLIVFHTNILFMVLPLAIRLYHRPCFLAFVY  377

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALY+GLL LF++EL++M FSFF+FCGYVGVSLLSPVMHNLWIWR
Sbjct  378   IAISSMLKSYPSVGDSALYMGLLGLFLDELADMQFSFFIFCGYVGVSLLSPVMHNLWIWR  437

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  438   GTGNANFYFATAIAYACLQ  456



>gb|KJB12323.1| hypothetical protein B456_002G011900 [Gossypium raimondii]
Length=459

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVF+FFR+FFLIVFHVNILFMILPLA+RL +RPC+LAFVY
Sbjct  290   FILTVEDLSPNIGVLWYFFAEVFEFFRNFFLIVFHVNILFMILPLAIRLRHRPCYLAFVY  349

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AICSMLKSYPSVGDSALYLGLL  F+NEL++M FS FLFCGYVGVSLLSPVMHNLWIWR
Sbjct  350   VAICSMLKSYPSVGDSALYLGLLGWFVNELADMQFSLFLFCGYVGVSLLSPVMHNLWIWR  409

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF TAM YAC Q
Sbjct  410   GTGNANFYFTTAMVYACLQ  428



>ref|XP_002276721.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Vitis vinifera]
 emb|CBI34718.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV DLSPNIGVLWYFFAEVFD+FR+FFLIVFHVNILFMILPLA+RL +RPCFLAFVY
Sbjct  310   FILTVPDLSPNIGVLWYFFAEVFDYFRNFFLIVFHVNILFMILPLAIRLNHRPCFLAFVY  369

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYLGLL LF+ EL++M FSFFLFCGYVG+S LSPVMHNLWIWR
Sbjct  370   IAISSLLKSYPSVGDSALYLGLLGLFVKELADMQFSFFLFCGYVGISFLSPVMHNLWIWR  429

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YACFQ
Sbjct  430   GTGNANFYFATAMAYACFQ  448



>ref|XP_007042808.1| GPI transamidase subunit PIG-U isoform 3 [Theobroma cacao]
 gb|EOX98639.1| GPI transamidase subunit PIG-U isoform 3 [Theobroma cacao]
Length=462

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFHVNILFMI+PLA+RL++RPCFLAFVY
Sbjct  293   FILTVEDLSPNIGVLWYFFAEVFDFFRNFFLIVFHVNILFMIMPLAIRLHHRPCFLAFVY  352

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL  F+NEL+++ FSFFLFCGYVGVSLLSPVMH LWIWR
Sbjct  353   IAIFSMLKSYPSVGDSALYLGLLGWFVNELADIQFSFFLFCGYVGVSLLSPVMHTLWIWR  412

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YAC Q
Sbjct  413   GTGNANFYFATAMVYACLQ  431



>ref|XP_007042806.1| GPI transamidase subunit PIG-U isoform 1 [Theobroma cacao]
 gb|EOX98637.1| GPI transamidase subunit PIG-U isoform 1 [Theobroma cacao]
Length=466

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFHVNILFMI+PLA+RL++RPCFLAFVY
Sbjct  297   FILTVEDLSPNIGVLWYFFAEVFDFFRNFFLIVFHVNILFMIMPLAIRLHHRPCFLAFVY  356

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL  F+NEL+++ FSFFLFCGYVGVSLLSPVMH LWIWR
Sbjct  357   IAIFSMLKSYPSVGDSALYLGLLGWFVNELADIQFSFFLFCGYVGVSLLSPVMHTLWIWR  416

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YAC Q
Sbjct  417   GTGNANFYFATAMVYACLQ  435



>dbj|BAF01992.1| cell division cycle protein-related [Arabidopsis thaliana]
Length=210

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIV HVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  42    FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVLHVNILFMLLPLAIRLKHRPCFLAFIY  101

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  102   LAISSILKSYPSVGDSALYLSLWALFVNELLDMKFSFFLFCGYLGISLLSPVMHNLWIWR  161

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  162   GTGNANFYFGNAIGYACFQ  180



>ref|XP_009113021.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X2 [Brassica rapa]
Length=399

 Score =   247 bits (631),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFRSFFLIVFHVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  231   FILSIEDLSPNIGVFWYFFAEVFDFFRSFFLIVFHVNILFMLLPLAIRLKHRPCFLAFIY  290

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL++M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  291   LAISSLLKSYPSVGDSALYLSLWALFVNELADMKFSFFLFCGYLGVSLLSPVMHNLWIWR  350

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  351   GTGNANFYFGNAIGYACFQ  369



>ref|XP_007042807.1| GPI transamidase subunit PIG-U isoform 2 [Theobroma cacao]
 gb|EOX98638.1| GPI transamidase subunit PIG-U isoform 2 [Theobroma cacao]
Length=505

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFHVNILFMI+PLA+RL++RPCFLAFVY
Sbjct  336   FILTVEDLSPNIGVLWYFFAEVFDFFRNFFLIVFHVNILFMIMPLAIRLHHRPCFLAFVY  395

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL  F+NEL+++ FSFFLFCGYVGVSLLSPVMH LWIWR
Sbjct  396   IAIFSMLKSYPSVGDSALYLGLLGWFVNELADIQFSFFLFCGYVGVSLLSPVMHTLWIWR  455

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YAC Q
Sbjct  456   GTGNANFYFATAMVYACLQ  474



>ref|XP_007042809.1| GPI transamidase subunit PIG-U isoform 4 [Theobroma cacao]
 gb|EOX98640.1| GPI transamidase subunit PIG-U isoform 4 [Theobroma cacao]
Length=501

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFHVNILFMI+PLA+RL++RPCFLAFVY
Sbjct  332   FILTVEDLSPNIGVLWYFFAEVFDFFRNFFLIVFHVNILFMIMPLAIRLHHRPCFLAFVY  391

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL  F+NEL+++ FSFFLFCGYVGVSLLSPVMH LWIWR
Sbjct  392   IAIFSMLKSYPSVGDSALYLGLLGWFVNELADIQFSFFLFCGYVGVSLLSPVMHTLWIWR  451

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YAC Q
Sbjct  452   GTGNANFYFATAMVYACLQ  470



>ref|XP_009113020.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X1 [Brassica rapa]
Length=477

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFRSFFLIVFHVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  309   FILSIEDLSPNIGVFWYFFAEVFDFFRSFFLIVFHVNILFMLLPLAIRLKHRPCFLAFIY  368

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL++M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  369   LAISSLLKSYPSVGDSALYLSLWALFVNELADMKFSFFLFCGYLGVSLLSPVMHNLWIWR  428

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  429   GTGNANFYFGNAIGYACFQ  447



>ref|XP_008786215.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Phoenix dactylifera]
Length=362

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV DLSPNIGVLWYFFAEVFDFFR+FFLIVF++NILFM+LPLA+RL +RPCFLAFVY
Sbjct  201   FILTVVDLSPNIGVLWYFFAEVFDFFRNFFLIVFNMNILFMLLPLAIRLKHRPCFLAFVY  260

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL LF NEL+ M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  261   LAISSMLKSYPSVGDSALYLGLLGLFANELAGMQFSFFLFCGYIGVSLLSPVMHNLWIWR  320

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT + YAC Q
Sbjct  321   GTGNANFYFATGIAYACLQ  339



>emb|CDY45975.1| BnaA09g12910D [Brassica napus]
Length=477

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFRSFFLIVFHVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  309   FILSIEDLSPNIGVFWYFFAEVFDFFRSFFLIVFHVNILFMLLPLAIRLKHRPCFLAFIY  368

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL++M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  369   LAISSLLKSYPSVGDSALYLSLWALFVNELADMKFSFFLFCGYLGVSLLSPVMHNLWIWR  428

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  429   GTGNANFYFGNAIGYACFQ  447



>ref|XP_010430395.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=391

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVN+LFM+LPLA+RL +RPCFLAFVY
Sbjct  223   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNVLFMLLPLAIRLKHRPCFLAFVY  282

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  283   LAISSILKSYPSVGDSALYLSLCALFVNELVDMKFSFFLFCGYLGISLLSPVMHNLWIWR  342

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  343   GTGNANFYFGNAIGYACFQ  361



>gb|KFK40542.1| hypothetical protein AALP_AA2G009200 [Arabis alpina]
Length=477

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVNILF++LPLA+RL +RPCFLAF+Y
Sbjct  309   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNILFLLLPLAIRLKHRPCFLAFIY  368

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AICS+LKSYPSVGD+ALYL L ALF+NEL++M FS+FLFCGY+G+SLLSPVMHNLWIWR
Sbjct  369   LAICSILKSYPSVGDAALYLSLWALFVNELTDMKFSYFLFCGYLGISLLSPVMHNLWIWR  428

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  429   GTGNANFYFGNAIGYACFQ  447



>ref|XP_009627449.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Nicotiana tomentosiformis]
Length=372

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVF+FFR+FFLIVFHVNILFMILPLA+RL +RPCFLAFVY
Sbjct  209   FILTVKDLSPNIGVLWYFFAEVFEFFRNFFLIVFHVNILFMILPLAIRLKHRPCFLAFVY  268

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             MAICSMLK YPSVGDSALYL LLALF NEL+EM FSFFLFCGYVGVSLLSPVMHNLWIWR
Sbjct  269   MAICSMLKPYPSVGDSALYLALLALFCNELAEMQFSFFLFCGYVGVSLLSPVMHNLWIWR  328

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT M YACFQ
Sbjct  329   GTGNANFYFATGMAYACFQ  347



>gb|EEC73810.1| hypothetical protein OsI_08523 [Oryza sativa Indica Group]
Length=400

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVF++NI+FM+LPLA+RL +RPCFLAF+Y
Sbjct  238   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFNMNIVFMVLPLAIRLKHRPCFLAFIY  297

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI ++LKSYPSVGDSALYLGLL LF NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  298   TAIVAILKSYPSVGDSALYLGLLGLFANELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  357

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  358   GTGNANFYFATGLAYTCLQTVLV  380



>ref|XP_010430394.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=468

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVN+LFM+LPLA+RL +RPCFLAFVY
Sbjct  300   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNVLFMLLPLAIRLKHRPCFLAFVY  359

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  360   LAISSILKSYPSVGDSALYLSLCALFVNELVDMKFSFFLFCGYLGISLLSPVMHNLWIWR  419

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  420   GTGNANFYFGNAIGYACFQ  438



>ref|NP_176499.2| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 gb|AAL38264.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91122.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34056.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=397

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIV HVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  229   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVLHVNILFMLLPLAIRLKHRPCFLAFIY  288

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  289   LAISSILKSYPSVGDSALYLSLWALFVNELLDMKFSFFLFCGYLGISLLSPVMHNLWIWR  348

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  349   GTGNANFYFGNAIGYACFQ  367



>ref|XP_010473542.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=391

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVN+LFM+LPL +RL +RPCFLAFVY
Sbjct  223   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNVLFMLLPLVIRLKHRPCFLAFVY  282

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  283   LAISSILKSYPSVGDSALYLSLWALFVNELIDMKFSFFLFCGYLGISLLSPVMHNLWIWR  342

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  343   GTGNANFYFGNAIGYACFQ  361



>ref|XP_010418323.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=388

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVN+LFM+LPL +RL +RPCFLAFVY
Sbjct  220   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNVLFMLLPLVIRLKHRPCFLAFVY  279

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  280   LAISSILKSYPSVGDSALYLSLWALFVNELVDMKFSFFLFCGYLGISLLSPVMHNLWIWR  339

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  340   GTGNANFYFGNAIGYACFQ  358



>ref|XP_008786214.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Phoenix dactylifera]
Length=445

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV DLSPNIGVLWYFFAEVFDFFR+FFLIVF++NILFM+LPLA+RL +RPCFLAFVY
Sbjct  284   FILTVVDLSPNIGVLWYFFAEVFDFFRNFFLIVFNMNILFMLLPLAIRLKHRPCFLAFVY  343

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL LF NEL+ M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  344   LAISSMLKSYPSVGDSALYLGLLGLFANELAGMQFSFFLFCGYIGVSLLSPVMHNLWIWR  403

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT + YAC Q
Sbjct  404   GTGNANFYFATGIAYACLQ  422



>ref|XP_002887978.1| hypothetical protein ARALYDRAFT_475037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64237.1| hypothetical protein ARALYDRAFT_475037 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  299   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNILFMLLPLAIRLKHRPCFLAFIY  358

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  359   LAISSILKSYPSVGDSALYLSLWALFVNELIDMKFSFFLFCGYLGISLLSPVMHNLWIWR  418

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  419   GTGNANFYFGNAIGYACFQ  437



>ref|XP_004298744.2| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Fragaria vesca subsp. vesca]
Length=473

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV DLSPNIGVLWYFFAEVFDFFR+FFLIVF +NILFMI PLA+RL++RPCFLAFVY
Sbjct  304   FILTVPDLSPNIGVLWYFFAEVFDFFRNFFLIVFQMNILFMIFPLAIRLHHRPCFLAFVY  363

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALYLGLL  F+ ELSEM FSFFLFC YVGVSLLSPVMHNLWIWR
Sbjct  364   ITISSMLKSYPSVGDSALYLGLLGWFVFELSEMKFSFFLFCVYVGVSLLSPVMHNLWIWR  423

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATAM YAC Q
Sbjct  424   GTGNANFYFATAMAYACLQ  442



>ref|NP_974075.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 dbj|BAH19432.1| AT1G63110 [Arabidopsis thaliana]
 gb|AEE34057.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=407

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIV HVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  239   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVLHVNILFMLLPLAIRLKHRPCFLAFIY  298

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  299   LAISSILKSYPSVGDSALYLSLWALFVNELLDMKFSFFLFCGYLGISLLSPVMHNLWIWR  358

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  359   GTGNANFYFGNAIGYACFQ  377



>ref|XP_008346591.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Malus domestica]
Length=175

 Score =   235 bits (599),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFH+NILF+I PLA+RL +RPCFLAFVY
Sbjct  6     FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHMNILFIIFPLAIRLKHRPCFLAFVY  65

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALY+GLL  F+NELSEM FSF LF  YVGV LLSPVMHNLWIWR
Sbjct  66    ITISSMLKSYPSVGDSALYIGLLGWFVNELSEMRFSFCLFSVYVGVFLLSPVMHNLWIWR  125

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  126   GTGNANFYFATAITYACLQ  144



>ref|XP_008786213.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Phoenix dactylifera]
Length=456

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV DLSPNIGVLWYFFAEVFDFFR+FFLIVF++NILFM+LPLA+RL +RPCFLAFVY
Sbjct  295   FILTVVDLSPNIGVLWYFFAEVFDFFRNFFLIVFNMNILFMLLPLAIRLKHRPCFLAFVY  354

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL LF NEL+ M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  355   LAISSMLKSYPSVGDSALYLGLLGLFANELAGMQFSFFLFCGYIGVSLLSPVMHNLWIWR  414

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT + YAC Q
Sbjct  415   GTGNANFYFATGIAYACLQ  433



>ref|XP_006391780.1| hypothetical protein EUTSA_v10023435mg [Eutrema salsugineum]
 gb|ESQ29066.1| hypothetical protein EUTSA_v10023435mg [Eutrema salsugineum]
Length=474

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  306   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNILFMLLPLAIRLKHRPCFLAFIY  365

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  366   LTISSILKSYPSVGDSALYLSLWALFVNELVDMKFSFFLFCGYLGISLLSPVMHNLWIWR  425

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  426   GTGNANFYFGNAIGYACFQ  444



>ref|NP_850969.2| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 gb|AEE34055.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=469

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIV HVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  301   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVLHVNILFMLLPLAIRLKHRPCFLAFIY  360

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  361   LAISSILKSYPSVGDSALYLSLWALFVNELLDMKFSFFLFCGYLGISLLSPVMHNLWIWR  420

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  421   GTGNANFYFGNAIGYACFQ  439



>ref|XP_010418322.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=465

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVN+LFM+LPL +RL +RPCFLAFVY
Sbjct  297   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNVLFMLLPLVIRLKHRPCFLAFVY  356

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  357   LAISSILKSYPSVGDSALYLSLWALFVNELVDMKFSFFLFCGYLGISLLSPVMHNLWIWR  416

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  417   GTGNANFYFGNAIGYACFQ  435



>ref|XP_010473541.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=468

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVN+LFM+LPL +RL +RPCFLAFVY
Sbjct  300   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNVLFMLLPLVIRLKHRPCFLAFVY  359

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  360   LAISSILKSYPSVGDSALYLSLWALFVNELIDMKFSFFLFCGYLGISLLSPVMHNLWIWR  419

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  420   GTGNANFYFGNAIGYACFQ  438



>ref|XP_006358874.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Solanum tuberosum]
Length=462

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVF+FFR FFLIVFHVNILFMILPLA+RL +RPCFLAFVY
Sbjct  299   FILTVKDLSPNIGVLWYFFAEVFEFFRDFFLIVFHVNILFMILPLAIRLKHRPCFLAFVY  358

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             MAICSMLK YPSVGDSALYL LLALF NEL+EM FSFFLFCG+VGVSLLSPVMHNLWIWR
Sbjct  359   MAICSMLKPYPSVGDSALYLALLALFFNELAEMQFSFFLFCGFVGVSLLSPVMHNLWIWR  418

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT M YACFQ
Sbjct  419   GTGNANFYFATGMAYACFQ  437



>ref|XP_006647706.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Oryza brachyantha]
Length=453

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVF++NI FM+LPLA+RL +RPCFLAFVY
Sbjct  291   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFNMNIAFMVLPLAIRLKHRPCFLAFVY  350

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPSVGDSALYLGLL LF NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  351   TAIVAMLKSYPSVGDSALYLGLLGLFANELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  410

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  411   GTGNANFYFATGLAYTCLQTVLV  433



>gb|KEH31711.1| GPI transamidase subunit PIG-U [Medicago truncatula]
Length=480

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++DLSPNIGV WYFFAEVFDFFRSFFLIVFH NIL MILPLA+RL +RPCFLAFVY
Sbjct  311   FILTIQDLSPNIGVFWYFFAEVFDFFRSFFLIVFHGNILLMILPLALRLNHRPCFLAFVY  370

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + + SMLKSYPSVGDSALYLGLL LF  EL +M FSFFLF GYVGVSLLSPVMHNLWIWR
Sbjct  371   IVLSSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLFSGYVGVSLLSPVMHNLWIWR  430

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+GYAC Q
Sbjct  431   GTGNANFYFATAIGYACLQ  449



>ref|NP_001047781.1| Os02g0688900 [Oryza sativa Japonica Group]
 dbj|BAD07667.1| putative cell division control protein CDC91 [Oryza sativa Japonica 
Group]
 dbj|BAF09695.1| Os02g0688900 [Oryza sativa Japonica Group]
 dbj|BAG89816.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVF++NI+FM+LPLA+RL +RPCFLAF+Y
Sbjct  291   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFNMNIVFMVLPLAIRLKHRPCFLAFIY  350

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI ++LKSYPSVGDSALYLGLL LF NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  351   TAIVAILKSYPSVGDSALYLGLLGLFANELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  410

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  411   GTGNANFYFATGLAYTCLQTVLV  433



>gb|EEE57603.1| hypothetical protein OsJ_07980 [Oryza sativa Japonica Group]
Length=460

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVF++NI+FM+LPLA+RL +RPCFLAF+Y
Sbjct  298   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFNMNIVFMVLPLAIRLKHRPCFLAFIY  357

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI ++LKSYPSVGDSALYLGLL LF NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  358   TAIVAILKSYPSVGDSALYLGLLGLFANELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  417

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  418   GTGNANFYFATGLAYTCLQTVLV  440



>dbj|BAK07917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  291   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFNMNIIFMVLPLAIRLKHRPCFLAFVY  350

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPS GDSALY+GLL LF NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  351   TAIVAMLKSYPSAGDSALYIGLLGLFANELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  410

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  411   GTGNANFYFATGLAYTCLQTVLV  433



>ref|XP_004953492.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Setaria italica]
Length=452

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  290   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFNMNIIFMVLPLAIRLKHRPCFLAFVY  349

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPS GDSALYLGLL LF NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  350   TAIIAMLKSYPSAGDSALYLGLLGLFANELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  409

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  410   GTGNANFYFATGLAYTCLQTVLV  432



>emb|CDY67234.1| BnaCnng54040D [Brassica napus]
Length=478

 Score =   242 bits (618),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 131/140 (94%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  309   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNILFMLLPLAIRLKHRPCFLAFIY  368

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELS-EMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             +AI S+LKSYPSVGDSALYL L ALF+NEL+ +M FSFFLFCGY+GVSLLSPVMHNLWIW
Sbjct  369   LAISSLLKSYPSVGDSALYLSLWALFVNELAVDMKFSFFLFCGYLGVSLLSPVMHNLWIW  428

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFYF  A+GYACFQ
Sbjct  429   RGTGNANFYFGNAIGYACFQ  448



>gb|KEH31710.1| GPI transamidase subunit PIG-U [Medicago truncatula]
Length=478

 Score =   242 bits (617),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++DLSPNIGV WYFFAEVFDFFRSFFLIVFH NIL MILPLA+RL +RPCFLAFVY
Sbjct  311   FILTIQDLSPNIGVFWYFFAEVFDFFRSFFLIVFHGNILLMILPLALRLNHRPCFLAFVY  370

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + + SMLKSYPSVGDSALYLGLL LF  EL +M FSFFLF GYVGVSLLSPVMHNLWIWR
Sbjct  371   IVLSSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLFSGYVGVSLLSPVMHNLWIWR  430

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+GYAC Q
Sbjct  431   GTGNANFYFATAIGYACLQ  449



>ref|XP_007209980.1| hypothetical protein PRUPE_ppa005072mg [Prunus persica]
 gb|EMJ11179.1| hypothetical protein PRUPE_ppa005072mg [Prunus persica]
Length=478

 Score =   242 bits (617),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFH+NILFMI PLA+RL +RPCFLAFVY
Sbjct  309   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHMNILFMIFPLAIRLKHRPCFLAFVY  368

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALY GLL  F+NELSEM FSF LF  YVGVSLLSPVMHNLWIWR
Sbjct  369   ITISSMLKSYPSVGDSALYFGLLGWFVNELSEMQFSFCLFSVYVGVSLLSPVMHNLWIWR  428

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  429   GTGNANFYFATAITYACLQ  447



>ref|XP_008238817.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Prunus mume]
Length=478

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFH+NILFMI PLA+RL +RPCFLAFVY
Sbjct  309   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHMNILFMIFPLAIRLKHRPCFLAFVY  368

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALY GLL  F+NELSEM FSF LF  YVGVSLLSPVMHNLWIWR
Sbjct  369   ITISSMLKSYPSVGDSALYFGLLGWFVNELSEMQFSFCLFSVYVGVSLLSPVMHNLWIWR  428

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  429   GTGNANFYFATAITYACLQ  447



>ref|XP_002452728.1| hypothetical protein SORBIDRAFT_04g031420 [Sorghum bicolor]
 gb|EES05704.1| hypothetical protein SORBIDRAFT_04g031420 [Sorghum bicolor]
Length=442

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFR+FFLIVF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  280   FILTVKDLSPNIGVLWYFFAEVFDFFRNFFLIVFNMNIIFMVLPLAVRLKHRPCFLAFVY  339

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI ++LKSYPS GDSALYLGLL LF+NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  340   TAIVAILKSYPSAGDSALYLGLLGLFVNELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  399

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT + Y C Q
Sbjct  400   GTGNANFYFATGLAYTCLQ  418



>ref|XP_006579602.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Glycine max]
 ref|XP_006579603.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Glycine max]
 ref|XP_006579604.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X4 [Glycine max]
Length=362

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT +DLSPNIGVLWYFFAEVFDFFR+FFLIVFH NIL MI PLA+RL +RPCFLAFVY
Sbjct  193   FILTTQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHGNILLMIAPLALRLNHRPCFLAFVY  252

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALYLGLL LF  EL +M FSFFLF GYVGVSLLSPVMHNLWIWR
Sbjct  253   IVISSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLFSGYVGVSLLSPVMHNLWIWR  312

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  313   GTGNANFYFATAIAYACLQ  331



>ref|XP_010235897.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Brachypodium distachyon]
Length=361

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFD FR+FFLIVF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  199   FILTVKDLSPNIGVLWYFFAEVFDVFRNFFLIVFNMNIVFMVLPLAIRLKHRPCFLAFVY  258

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPS GDSALYLGLL LF NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  259   TAIVAMLKSYPSAGDSALYLGLLGLFANELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  318

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  319   GTGNANFYFATGLAYTCLQTVLV  341



>ref|XP_010545955.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Tarenaya hassleriana]
Length=469

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFL+VFHVNILFM+LPLA+RL +RPCFLAFVY
Sbjct  299   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLVVFHVNILFMLLPLAIRLKHRPCFLAFVY  358

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL++M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  359   VAISSILKSYPSVGDSALYLSLWALFVNELADMKFSFFLFCGYLGISLLSPVMHNLWIWR  418

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYA FQ
Sbjct  419   GTGNANFYFGNAIGYAFFQ  437



>ref|XP_004245643.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Solanum lycopersicum]
Length=463

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVF+FFR FFLIVFHVNILFMILPLA+RL +RPCFLAFVY
Sbjct  300   FILTVKDLSPNIGVLWYFFAEVFEFFRDFFLIVFHVNILFMILPLAIRLKHRPCFLAFVY  359

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             MAICS+LK YPSVGDSALYL LLALF NEL+EM FSFFLFCG+VGVSLLSPVMHNLWIWR
Sbjct  360   MAICSILKPYPSVGDSALYLALLALFFNELAEMQFSFFLFCGFVGVSLLSPVMHNLWIWR  419

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT M YACFQ
Sbjct  420   GTGNANFYFATGMAYACFQ  438



>ref|NP_001148568.1| GPI transamidase subunit PIG-U family protein [Zea mays]
 gb|ACG32078.1| GPI transamidase subunit PIG-U family protein [Zea mays]
 gb|ACN35439.1| unknown [Zea mays]
 gb|AFW72851.1| GPI transamidase subunit PIG-U family [Zea mays]
Length=452

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFR+FFL+VF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  290   FILTVKDLSPNIGVLWYFFAEVFDFFRNFFLMVFNMNIIFMVLPLAIRLKHRPCFLAFVY  349

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI ++LKSYPS GDSALYLGLL LF+NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  350   TAIVAILKSYPSAGDSALYLGLLGLFVNELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  409

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT + Y C Q
Sbjct  410   GTGNANFYFATGLAYTCLQ  428



>gb|KDO63548.1| hypothetical protein CISIN_1g0117602mg, partial [Citrus sinensis]
Length=287

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVF+FFR+FFLIVFH+NIL MILPLA+RL +RPCFLAFVY
Sbjct  118   FILTVEDLSPNIGVLWYFFAEVFEFFRNFFLIVFHMNILVMILPLAIRLNHRPCFLAFVY  177

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL  F+ EL+++ FSFFLF G VGVSLLSPVMHNLWIWR
Sbjct  178   IAISSMLKSYPSVGDSALYLGLLGWFVFELADLQFSFFLFWGCVGVSLLSPVMHNLWIWR  237

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFY+ATAM +ACFQ
Sbjct  238   GTGNANFYYATAMAFACFQ  256



>ref|XP_007155557.1| hypothetical protein PHAVU_003G211900g [Phaseolus vulgaris]
 gb|ESW27551.1| hypothetical protein PHAVU_003G211900g [Phaseolus vulgaris]
Length=469

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 5/160 (3%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++DLSPNIGVLWYFFAEVFDFFR+FFLIVFH N+L M+ PLA+RL +RPCFLAFVY
Sbjct  300   FILTIQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHGNVLLMLAPLALRLNHRPCFLAFVY  359

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALYLGLL LF  EL +M FSFFL  GYVGVSLLSPVMHNLWIWR
Sbjct  360   IVISSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLLSGYVGVSLLSPVMHNLWIWR  419

Query  862   GTGNANFYFATAMGYACFQ-----GEVVGFARNRRTMPEL  758
             GTGNANFYFATA+ YACFQ       V     + RT+ +L
Sbjct  420   GTGNANFYFATAIAYACFQIILVVESVSAMLNHDRTLTKL  459



>ref|XP_003562742.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Brachypodium distachyon]
Length=454

 Score =   238 bits (608),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFD FR+FFLIVF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  292   FILTVKDLSPNIGVLWYFFAEVFDVFRNFFLIVFNMNIVFMVLPLAIRLKHRPCFLAFVY  351

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPS GDSALYLGLL LF NEL+EM F+FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  352   TAIVAMLKSYPSAGDSALYLGLLGLFANELAEMQFTFFLFFGYIGVSLLSPVMHNLWIWR  411

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  412   GTGNANFYFATGLAYTCLQTVLV  434



>gb|KHN34428.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Glycine soja]
Length=468

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT +DLSPNIGVLWYFFAEVFDFFR+FFLIVFH NIL MI PLA+RL +RPCFLAFVY
Sbjct  299   FILTTQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHGNILLMIAPLALRLNHRPCFLAFVY  358

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALYLGLL LF  EL +M FSFFLF GYVGVSLLSPVMHNLWIWR
Sbjct  359   IVISSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLFSGYVGVSLLSPVMHNLWIWR  418

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  419   GTGNANFYFATAIAYACLQ  437



>ref|XP_006579601.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Glycine max]
Length=448

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT +DLSPNIGVLWYFFAEVFDFFR+FFLIVFH NIL MI PLA+RL +RPCFLAFVY
Sbjct  279   FILTTQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHGNILLMIAPLALRLNHRPCFLAFVY  338

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALYLGLL LF  EL +M FSFFLF GYVGVSLLSPVMHNLWIWR
Sbjct  339   IVISSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLFSGYVGVSLLSPVMHNLWIWR  398

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  399   GTGNANFYFATAIAYACLQ  417



>ref|XP_008373832.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Malus domestica]
Length=400

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFH+NILF+I PLA+RL +RPCFLAFVY
Sbjct  231   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHMNILFIIFPLAIRLKHRPCFLAFVY  290

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALY+GLL  F+NELSEM FSF LF  YVGV LLSPVMHNLWIWR
Sbjct  291   ITISSMLKSYPSVGDSALYIGLLGWFVNELSEMRFSFCLFSVYVGVFLLSPVMHNLWIWR  350

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  351   GTGNANFYFATAITYACLQ  369



>ref|XP_008373830.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Malus domestica]
Length=479

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFH+NILF+I PLA+RL +RPCFLAFVY
Sbjct  310   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHMNILFIIFPLAIRLKHRPCFLAFVY  369

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALY+GLL  F+NELSEM FSF LF  YVGV LLSPVMHNLWIWR
Sbjct  370   ITISSMLKSYPSVGDSALYIGLLGWFVNELSEMRFSFCLFSVYVGVFLLSPVMHNLWIWR  429

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  430   GTGNANFYFATAITYACLQ  448



>ref|XP_004515804.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Cicer arietinum]
Length=475

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++DLSPNIG LWYFFAEVFDFFRSFFLIVFH NIL MI+PLA+RL +RP FLAFVY
Sbjct  306   FILTIQDLSPNIGALWYFFAEVFDFFRSFFLIVFHGNILLMIVPLALRLNHRPFFLAFVY  365

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALYLGLL LF  EL +M FSFFLF GYVGVSLLSPVMHNLWIWR
Sbjct  366   IVISSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLFSGYVGVSLLSPVMHNLWIWR  425

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+GYAC Q
Sbjct  426   GTGNANFYFATAIGYACLQ  444



>ref|XP_003550876.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Glycine max]
 gb|KHN14116.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Glycine soja]
Length=468

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++DLSPNIGVLWYFFAEVFDFFR+FFLIVFH NIL MI PLA+RL +RPCFLAFVY
Sbjct  299   FILTIQDLSPNIGVLWYFFAEVFDFFRNFFLIVFHGNILLMIAPLALRLNHRPCFLAFVY  358

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALYLGLL LF  EL +M FSFFLF GY+GVSLLSPVMHNLWIWR
Sbjct  359   IVISSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLFSGYIGVSLLSPVMHNLWIWR  418

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ Y C Q
Sbjct  419   GTGNANFYFATAIAYVCLQ  437



>ref|XP_008369469.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X1 [Malus domestica]
Length=412

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVF +NILF+I PLA+RL +RPCFLAFVY
Sbjct  243   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFQMNILFLIFPLAIRLKHRPCFLAFVY  302

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALY GLL  F+NELSEM FSF LF  YVG+SLLSPVMHNLWIWR
Sbjct  303   ITISSMLKSYPSVGDSALYFGLLGWFVNELSEMRFSFCLFSVYVGISLLSPVMHNLWIWR  362

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  363   GTGNANFYFATAITYACLQ  381



>ref|XP_008369470.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X2 [Malus domestica]
Length=481

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVF +NILF+I PLA+RL +RPCFLAFVY
Sbjct  312   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFQMNILFLIFPLAIRLKHRPCFLAFVY  371

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALY GLL  F+NELSEM FSF LF  YVG+SLLSPVMHNLWIWR
Sbjct  372   ITISSMLKSYPSVGDSALYFGLLGWFVNELSEMRFSFCLFSVYVGISLLSPVMHNLWIWR  431

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  432   GTGNANFYFATAITYACLQ  450



>ref|XP_004964641.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Setaria italica]
Length=447

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFL VF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  285   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLTVFNMNIIFMVLPLAIRLKHRPCFLAFVY  344

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPS GDSALYLGLL LF NEL+EM F+FFL  GY+GVSL SPVMHNLWIWR
Sbjct  345   TAIVAMLKSYPSAGDSALYLGLLGLFANELAEMQFTFFLCFGYIGVSLHSPVMHNLWIWR  404

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  405   GTGNANFYFATGLAYTCLQTVLV  427



>ref|XP_004515803.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Cicer arietinum]
Length=475

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++DLSPNIG LWYFFAEVFDFFRSFFLIV H NIL MI+PLA+RL +RP FLAFVY
Sbjct  306   FILTIQDLSPNIGALWYFFAEVFDFFRSFFLIVIHGNILLMIVPLALRLNHRPFFLAFVY  365

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALYLGLL LF  EL +M FSFFLF GYVGVSLLSPVMHNLWIWR
Sbjct  366   IVISSMLKSYPSVGDSALYLGLLGLFAYELKDMQFSFFLFSGYVGVSLLSPVMHNLWIWR  425

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+GYAC Q
Sbjct  426   GTGNANFYFATAIGYACLQ  444



>gb|EPS73832.1| hypothetical protein M569_00921, partial [Genlisea aurea]
Length=462

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL + DLSPNIGVLWY FAEVFDFFR FFL+VFH NILF++LPLA+RL +RPCFLAFVY
Sbjct  304   FILNINDLSPNIGVLWYLFAEVFDFFRDFFLMVFHANILFVLLPLAIRLNHRPCFLAFVY  363

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGD+ LYL LL+LF+NEL+EM FSF LF GYVGVSLLSPVMHNLWIWR
Sbjct  364   VTISSMLKSYPSVGDAGLYLSLLSLFVNELAEMKFSFLLFWGYVGVSLLSPVMHNLWIWR  423

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFATA+ YAC Q  VV
Sbjct  424   GTGNANFYFATAIAYACLQIIVV  446



>ref|XP_004964640.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Setaria italica]
Length=480

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFL VF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  318   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLTVFNMNIIFMVLPLAIRLKHRPCFLAFVY  377

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPS GDSALYLGLL LF NEL+EM F+FFL  GY+GVSL SPVMHNLWIWR
Sbjct  378   TAIVAMLKSYPSAGDSALYLGLLGLFANELAEMQFTFFLCFGYIGVSLHSPVMHNLWIWR  437

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  438   GTGNANFYFATGLAYTCLQTVLV  460



>ref|XP_006477405.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Citrus sinensis]
Length=504

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVF+FFR+FFLIVFH+NIL MILPLA+RL +RPCFLAFVY
Sbjct  335   FILTVEDLSPNIGVLWYFFAEVFEFFRNFFLIVFHMNILVMILPLAIRLNHRPCFLAFVY  394

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL  F+ EL+++ FSFFLF G VGVSLLSPVMHNLWIWR
Sbjct  395   IAISSMLKSYPSVGDSALYLGLLGWFVFELADLQFSFFLFWGCVGVSLLSPVMHNLWIWR  454

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFY+ATAM +ACFQ
Sbjct  455   GTGNANFYYATAMAFACFQ  473



>ref|XP_006440549.1| hypothetical protein CICLE_v10019953mg [Citrus clementina]
 gb|ESR53789.1| hypothetical protein CICLE_v10019953mg [Citrus clementina]
Length=478

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVF+FFR+FFLIVFH+NIL MILPLA+RL +RPCFLAF Y
Sbjct  309   FILTVEDLSPNIGVLWYFFAEVFEFFRNFFLIVFHMNILVMILPLAIRLNHRPCFLAFAY  368

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL  F+ EL+++ FSFFLF G VGVSLLSPVMHNLWIWR
Sbjct  369   IAISSMLKSYPSVGDSALYLGLLGWFVFELADLQFSFFLFWGCVGVSLLSPVMHNLWIWR  428

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFY+ATAM +ACFQ
Sbjct  429   GTGNANFYYATAMAFACFQ  447



>ref|XP_012086990.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Jatropha curcas]
 gb|KDP25499.1| hypothetical protein JCGZ_20655 [Jatropha curcas]
Length=473

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFH NILFM+LPLA+RL++RPCFLAF+Y
Sbjct  296   FILTVEDLSPNIGVLWYFFAEVFDFFRNFFLIVFHANILFMVLPLAIRLHHRPCFLAFIY  355

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL LF++EL++M FSFF+FCGYVGV LLSPVMHNLWIWR
Sbjct  356   VAISSMLKSYPSVGDSALYLGLLVLFLDELADMQFSFFIFCGYVGVPLLSPVMHNLWIWR  415

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  416   GTGNANFYFATAIAYACLQ  434



>ref|XP_012086988.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Jatropha curcas]
 ref|XP_012086989.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Jatropha curcas]
Length=489

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVFH NILFM+LPLA+RL++RPCFLAF+Y
Sbjct  312   FILTVEDLSPNIGVLWYFFAEVFDFFRNFFLIVFHANILFMVLPLAIRLHHRPCFLAFIY  371

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL LF++EL++M FSFF+FCGYVGV LLSPVMHNLWIWR
Sbjct  372   VAISSMLKSYPSVGDSALYLGLLVLFLDELADMQFSFFIFCGYVGVPLLSPVMHNLWIWR  431

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YAC Q
Sbjct  432   GTGNANFYFATAIAYACLQ  450



>ref|XP_008437214.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Cucumis melo]
Length=463

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWY FAEVF+FFR F+LIVFH+NILFMILPL++RL +RP FLAFV 
Sbjct  297   FILTVQDLSPNIGVLWYLFAEVFEFFRDFYLIVFHINILFMILPLSIRLCHRPLFLAFVL  356

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             ++I +MLKSYPSVGDSALYL  + LFI+EL ++ FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  357   LSISAMLKSYPSVGDSALYLSFMGLFIDELVDLEFSFFLFCGYIGISLLSPVMHNLWIWR  416

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFA AM YACFQ
Sbjct  417   GTGNANFYFANAMAYACFQ  435



>ref|XP_010933541.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Elaeis guineensis]
Length=441

 Score =   230 bits (587),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVF++NILFM+LPLAMRL +RPCFLAFVY
Sbjct  279   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFNMNILFMLLPLAMRLKHRPCFLAFVY  338

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGD+ALYLGLL LF NEL+ M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  339   LAISSMLKSYPSVGDAALYLGLLGLFANELAGMQFSFFLFCGYIGVSLLSPVMHNLWIWR  398

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + YAC Q  +V
Sbjct  399   GTGNANFYFATGIAYACLQTVLV  421



>ref|XP_010933540.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Elaeis guineensis]
Length=457

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVF++NILFM+LPLAMRL +RPCFLAFVY
Sbjct  295   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFNMNILFMLLPLAMRLKHRPCFLAFVY  354

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGD+ALYLGLL LF NEL+ M FSFFLFCGY+GVSLLSPVMHNLWIWR
Sbjct  355   LAISSMLKSYPSVGDAALYLGLLGLFANELAGMQFSFFLFCGYIGVSLLSPVMHNLWIWR  414

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + YAC Q  +V
Sbjct  415   GTGNANFYFATGIAYACLQTVLV  437



>ref|XP_004143931.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Cucumis sativus]
Length=462

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWY FAEVF+FFR F+LIVFH+NILFMILPL++RL +RP FLAFV 
Sbjct  297   FILTVQDLSPNIGVLWYLFAEVFEFFRDFYLIVFHINILFMILPLSIRLCHRPLFLAFVL  356

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             ++I +MLKSYPSVGDSALYL  + LF++ L ++ FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  357   LSISAMLKSYPSVGDSALYLSFMGLFVDVLVDLEFSFFLFCGYIGISLLSPVMHNLWIWR  416

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFA AM YACFQ
Sbjct  417   GTGNANFYFANAMAYACFQ  435



>ref|XP_009344269.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol glycan anchor 
biosynthesis class U protein-like [Pyrus x bretschneideri]
Length=485

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWYFFAEVFDFFR+FFLIVF +NILFMI PLA+RL +RPCFLAFVY
Sbjct  315   FILTVQDLSPNIGVLWYFFAEVFDFFRNFFLIVFQMNILFMIFPLAIRLKHRPCFLAFVY  374

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             + I SMLKSYPSVGDSALY GLL  F+NELSEM FSF LF  YVG+SLLSPVMHNLWIWR
Sbjct  375   ITISSMLKSYPSVGDSALYFGLLGWFVNELSEMRFSFCLFSVYVGISLLSPVMHNLWIWR  434

Query  862   GTGNANFY-FATAMGYACFQ  806
             GTGNANF  FATA+ YAC Q
Sbjct  435   GTGNANFLNFATAITYACLQ  454



>ref|XP_010112563.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Morus notabilis]
 gb|EXC34110.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Morus notabilis]
Length=463

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 132/143 (92%), Gaps = 4/143 (3%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV DLSPNIGVLWYFFAEVF+FFR+FFLIVFH+NILFM+LPLA+RL +RPCFLAFVY
Sbjct  250   FILTVPDLSPNIGVLWYFFAEVFEFFRNFFLIVFHMNILFMVLPLAIRLNHRPCFLAFVY  309

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELS----EMPFSFFLFCGYVGVSLLSPVMHNL  875
             +AI SMLKSYPSVGD+ALYLGLL LF+NEL+    +M FSFFLFC YVGVSLLSPVMHNL
Sbjct  310   IAISSMLKSYPSVGDAALYLGLLGLFVNELAGKFIDMQFSFFLFCVYVGVSLLSPVMHNL  369

Query  874   WIWRGTGNANFYFATAMGYACFQ  806
             WIWRGTGNANFYFATAM YACFQ
Sbjct  370   WIWRGTGNANFYFATAMAYACFQ  392



>ref|XP_011029200.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X2 [Populus euphratica]
Length=399

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++D+SPNIGVLWYFFAEVFDFFRSFFLIVFH+NILFMILPLA+RL +RPCFLAF+Y
Sbjct  230   FILTMEDMSPNIGVLWYFFAEVFDFFRSFFLIVFHLNILFMILPLAIRLKHRPCFLAFIY  289

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL LF++EL++M FSFFL CGY+GVSLLSPVMHNLWIWR
Sbjct  290   IAISSMLKSYPSVGDSALYLGLLGLFLDELADMKFSFFLLCGYIGVSLLSPVMHNLWIWR  349

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFY+AT M YAC Q
Sbjct  350   GTGNANFYYATGMAYACLQ  368



>ref|XP_011029199.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X1 [Populus euphratica]
Length=466

 Score =   226 bits (576),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++D+SPNIGVLWYFFAEVFDFFRSFFLIVFH+NILFMILPLA+RL +RPCFLAF+Y
Sbjct  297   FILTMEDMSPNIGVLWYFFAEVFDFFRSFFLIVFHLNILFMILPLAIRLKHRPCFLAFIY  356

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL LF++EL++M FSFFL CGY+GVSLLSPVMHNLWIWR
Sbjct  357   IAISSMLKSYPSVGDSALYLGLLGLFLDELADMKFSFFLLCGYIGVSLLSPVMHNLWIWR  416

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFY+AT M YAC Q
Sbjct  417   GTGNANFYYATGMAYACLQ  435



>ref|XP_010676542.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Beta vulgaris subsp. vulgaris]
Length=477

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL V+DLSPNIGVLWYFFAEVFDFFR+FFL+V H+NILFMILPLA+RL +RPCFLAFVY
Sbjct  313   FILRVEDLSPNIGVLWYFFAEVFDFFRNFFLLVIHINILFMILPLAIRLKHRPCFLAFVY  372

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AICSMLK+YPSV DSAL LGLL LFINEL++M FSF LFCGYVGV+LLSPVMHNLWIWR
Sbjct  373   VAICSMLKTYPSVADSALCLGLLGLFINELADMHFSFVLFCGYVGVNLLSPVMHNLWIWR  432

Query  862   GTGNANF  842
             GTGNANF
Sbjct  433   GTGNANF  439



>ref|XP_002299558.1| hypothetical protein POPTR_0001s08870g [Populus trichocarpa]
 gb|EEE84363.1| hypothetical protein POPTR_0001s08870g [Populus trichocarpa]
Length=467

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILT++D+SPNIGVLWYFFAEVFDFFRSFF+IVFH+NILFMILPLA+RL +RPCFLAF+Y
Sbjct  298   FILTMEDMSPNIGVLWYFFAEVFDFFRSFFMIVFHLNILFMILPLAIRLKHRPCFLAFIY  357

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI SMLKSYPSVGDSALYLGLL LF++EL++M FSFFL CGY+GVSLLSPVMHNLWIWR
Sbjct  358   IAISSMLKSYPSVGDSALYLGLLGLFLDELADMKFSFFLLCGYIGVSLLSPVMHNLWIWR  417

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFY+AT M YAC Q
Sbjct  418   GTGNANFYYATGMAYACLQ  436



>gb|KGN50142.1| hypothetical protein Csa_5G155530 [Cucumis sativus]
Length=816

 Score =   231 bits (588),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTV+DLSPNIGVLWY FAEVF+FFR F+LIVFH+NILFMILPL++RL +RP FLAFV 
Sbjct  651   FILTVQDLSPNIGVLWYLFAEVFEFFRDFYLIVFHINILFMILPLSIRLCHRPLFLAFVL  710

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             ++I +MLKSYPSVGDSALYL  + LF++ L ++ FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  711   LSISAMLKSYPSVGDSALYLSFMGLFVDVLVDLEFSFFLFCGYIGISLLSPVMHNLWIWR  770

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFA AM YACFQ
Sbjct  771   GTGNANFYFANAMAYACFQ  789



>ref|XP_011624959.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Amborella trichopoda]
Length=579

 Score =   220 bits (561),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL V+DLSPN+GV WYFFAEVFD+FR FFL+VFH NILFMI PL +RL +RPCFLAFVY
Sbjct  412   FILNVEDLSPNLGVFWYFFAEVFDYFRVFFLLVFHANILFMISPLFIRLNHRPCFLAFVY  471

Query  1042  MAICSMLKSYPSV-GDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             +AI S+LKSY SV G SALYLG++ LFI+EL+ M FS FL  GY+GVSLLSPVMHNLWIW
Sbjct  472   IAISSILKSYSSVIGASALYLGMMGLFIHELAGMRFSLFLLSGYIGVSLLSPVMHNLWIW  531

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFYFATA+ YACFQ
Sbjct  532   RGTGNANFYFATALAYACFQ  551



>ref|XP_002889963.1| hypothetical protein ARALYDRAFT_471424 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66222.1| hypothetical protein ARALYDRAFT_471424, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=484

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFM-ILPLAMRLYNRPCFLAFV  1046
             FIL ++DLSPNIGV WYFFAEVFDF R++ LIVF++ IL   I PLA RL +RPCFLAF 
Sbjct  317   FILRIEDLSPNIGVFWYFFAEVFDFSRNYLLIVFNLYILLTGIPPLAFRLKHRPCFLAFA  376

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+A  S+LKSYPSVGD+ALYL L ALF+NEL++M  SFF+FCGY+G SLLSPVMHN+WIW
Sbjct  377   YLAFSSILKSYPSVGDAALYLSLWALFVNELTDMEHSFFIFCGYIGFSLLSPVMHNIWIW  436

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFYF  AMGYACFQ
Sbjct  437   RGTGNANFYFGNAMGYACFQ  456



>gb|ERN00380.1| hypothetical protein AMTR_s00104p00124380 [Amborella trichopoda]
Length=347

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL V+DLSPN+GV WYFFAEVFDFFR FFL+VFH NILFMI PL +RL +RPCFLAFVY
Sbjct  185   FILNVEDLSPNLGVFWYFFAEVFDFFRDFFLLVFHANILFMISPLVIRLNHRPCFLAFVY  244

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYLG++ LF +EL+ M FS FL  GY+GVSLLSPVMHNLWIWR
Sbjct  245   IAISSILKSYPSVGDSALYLGMMGLFFHELAGMRFSLFLLSGYIGVSLLSPVMHNLWIWR  304

Query  862   GTGNANFYFATAMGYACFQ----GEVVGFARNRRTM  767
             GTGNANFYFATA+ YACFQ     E VG   N   M
Sbjct  305   GTGNANFYFATALAYACFQILLVVESVGTMLNHDRM  340



>ref|XP_011621261.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Amborella trichopoda]
Length=462

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL V+DLSPN+GV WYFFAEVFDFFR FFL+VFH NILFMI PL +RL +RPCFLAFVY
Sbjct  296   FILNVEDLSPNLGVFWYFFAEVFDFFRDFFLLVFHANILFMISPLVIRLNHRPCFLAFVY  355

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYLG++ LF +EL+ M FS FL  GY+GVSLLSPVMHNLWIWR
Sbjct  356   IAISSILKSYPSVGDSALYLGMMGLFFHELAGMRFSLFLLSGYIGVSLLSPVMHNLWIWR  415

Query  862   GTGNANFYFATAMGYACFQ----GEVVGFARNRRTM  767
             GTGNANFYFATA+ YACFQ     E VG   N   M
Sbjct  416   GTGNANFYFATALAYACFQILLVVESVGTMLNHDRM  451



>gb|EAZ14305.1| hypothetical protein OsJ_04231 [Oryza sativa Japonica Group]
Length=325

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 116/143 (81%), Gaps = 11/143 (8%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLW           SFFLIV ++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  188   FILTVKDLSPNIGVLW-----------SFFLIVINMNIVFMVLPLAIRLKHRPCFLAFVY  236

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPSVGDSALYLGLL LF  EL+EM  +FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  237   TAIVAMLKSYPSVGDSALYLGLLGLFATELAEMKLTFFLFFGYIGVSLLSPVMHNLWIWR  296

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  297   GTGNANFYFATGLAYTCIQTVLV  319



>ref|XP_006302210.1| hypothetical protein CARUB_v10020222mg [Capsella rubella]
 gb|EOA35108.1| hypothetical protein CARUB_v10020222mg [Capsella rubella]
Length=476

 Score =   210 bits (534),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIVFHVNILFM+LPLA+RL +RPCFLAF+Y
Sbjct  300   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVFHVNILFMLLPLAIRLKHRPCFLAFIY  359

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             +AI S+LKSYPSVGDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  360   LAISSILKSYPSVGDSALYLSLWALFVNELVDMKFSFFLFCGYLGISLLSPVMHNLWIWR  419



>ref|NP_973813.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 gb|AEE28918.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=390

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAM-RLYNRPCFLAFV  1046
             FIL ++DLSPNIGV WYFFAE F+F R++ LI+F++ IL   +P  M RL +RPCFLAF 
Sbjct  223   FILRIEDLSPNIGVFWYFFAEAFEFSRNYLLIIFNLYILLTSIPSLMFRLKHRPCFLAFA  282

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+A  S+LKSYPSVGD+ALYL L ALF+NEL++M +SFF+FCGY+G SLLSPVMHN WIW
Sbjct  283   YLAFTSILKSYPSVGDAALYLSLWALFVNELTDMEYSFFIFCGYIGFSLLSPVMHNFWIW  342

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFYF  AMGYACFQ
Sbjct  343   RGTGNANFYFGNAMGYACFQ  362



>ref|NP_563912.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 gb|AAK44067.1|AF370252_1 unknown protein [Arabidopsis thaliana]
 gb|AAL34242.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28917.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=474

 Score =   207 bits (528),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAM-RLYNRPCFLAFV  1046
             FIL ++DLSPNIGV WYFFAE F+F R++ LI+F++ IL   +P  M RL +RPCFLAF 
Sbjct  307   FILRIEDLSPNIGVFWYFFAEAFEFSRNYLLIIFNLYILLTSIPSLMFRLKHRPCFLAFA  366

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+A  S+LKSYPSVGD+ALYL L ALF+NEL++M +SFF+FCGY+G SLLSPVMHN WIW
Sbjct  367   YLAFTSILKSYPSVGDAALYLSLWALFVNELTDMEYSFFIFCGYIGFSLLSPVMHNFWIW  426

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFYF  AMGYACFQ
Sbjct  427   RGTGNANFYFGNAMGYACFQ  446



>gb|EEC71873.1| hypothetical protein OsI_04592 [Oryza sativa Indica Group]
Length=761

 Score =   209 bits (531),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 114/139 (82%), Gaps = 11/139 (8%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLW           SFFLIV ++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  253   FILTVKDLSPNIGVLW-----------SFFLIVINMNIVFMVLPLAIRLKHRPCFLAFVY  301

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPSVGDSALYLGLL LF  EL+EM  +FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  302   TAIVAMLKSYPSVGDSALYLGLLGLFATELAEMKLTFFLFFGYIGVSLLSPVMHNLWIWR  361

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT + Y C Q
Sbjct  362   GTGNANFYFATGLAYTCIQ  380



>ref|XP_010458703.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=390

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILP-LAMRLYNRPCFLAFV  1046
             FIL ++DLSPNIGV WYFFAE F+  R++ LIVF++ IL   LP LA R  +RPCFLAF 
Sbjct  223   FILNIEDLSPNIGVFWYFFAEAFESSRNYLLIVFNLYILLTSLPPLAFRFKHRPCFLAFA  282

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+ + S++KSYPS GD+ALYL L ALF+NELS+M   FF+ CG++GVSLLSPV+HN+WIW
Sbjct  283   YLVMSSIIKSYPSGGDAALYLSLWALFVNELSDMNNLFFILCGHIGVSLLSPVVHNIWIW  342

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFY+  AMGY CFQ
Sbjct  343   RGTGNANFYYGNAMGYVCFQ  362



>ref|XP_010458704.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=476

 Score =   194 bits (492),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILP-LAMRLYNRPCFLAFV  1046
             FIL ++DLSPNIGV WYFFAE F+  R++ LIVF++ IL   LP LA R  +RPCFLAF 
Sbjct  309   FILNIEDLSPNIGVFWYFFAEAFESSRNYLLIVFNLYILLTSLPPLAFRFKHRPCFLAFA  368

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+ + S++KSYPS GD+ALYL L ALF+NELS+M   FF+ CG++GVSLLSPV+HN+WIW
Sbjct  369   YLVMSSIIKSYPSGGDAALYLSLWALFVNELSDMNNLFFILCGHIGVSLLSPVVHNIWIW  428

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFY+  AMGY CFQ
Sbjct  429   RGTGNANFYYGNAMGYVCFQ  448



>ref|XP_002985010.1| hypothetical protein SELMODRAFT_121519 [Selaginella moellendorffii]
 gb|EFJ13885.1| hypothetical protein SELMODRAFT_121519 [Selaginella moellendorffii]
Length=466

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDL+PNIGV WYFF EVFDF+RSFFL+VFH NI  MI PL++  Y+RP FL+F+ 
Sbjct  295   FILTVKDLTPNIGVYWYFFTEVFDFYRSFFLMVFHGNIFCMIAPLSICFYHRPIFLSFIL  354

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             MA+ S LKSYPSVGD+ALYLGL+ LF +ELS+  ++F L   Y+ V+ L PVM NLWIWR
Sbjct  355   MAVVSTLKSYPSVGDAALYLGLMGLFTHELSDFKYAFLLLNSYICVAALGPVMFNLWIWR  414

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YA  Q
Sbjct  415   GTGNANFYFATALAYAFVQ  433



>ref|XP_002986198.1| hypothetical protein SELMODRAFT_43879, partial [Selaginella moellendorffii]
 gb|EFJ12729.1| hypothetical protein SELMODRAFT_43879, partial [Selaginella moellendorffii]
Length=442

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDL+PNIGV WYFF EVFDF+RSFFL+VFH NI  MI PL++  Y+RP FL+F+ 
Sbjct  285   FILTVKDLTPNIGVYWYFFTEVFDFYRSFFLMVFHGNIFCMIAPLSICFYHRPIFLSFIL  344

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             MA+ S LKSYPSVGD+ALYLGL+ LF +ELS+  ++F L   Y+ V+ L PVM NLWIWR
Sbjct  345   MAVVSTLKSYPSVGDAALYLGLMGLFTHELSDFKYAFLLLNSYICVAALGPVMFNLWIWR  404

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFATA+ YA  Q
Sbjct  405   GTGNANFYFATALAYAFVQ  423



>ref|XP_001778404.1| predicted protein [Physcomitrella patens]
 gb|EDQ56762.1| predicted protein [Physcomitrella patens]
Length=560

 Score =   193 bits (491),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             ++LTV DL+PN+G+ WYFF EVFDFFR+FFL+VFH NI FM+ PL +RL +RP FLAF+ 
Sbjct  380   YMLTVDDLTPNLGLFWYFFTEVFDFFRNFFLMVFHANIAFMVPPLTIRLRHRPIFLAFIL  439

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AICSM+KSYP+VGD+ALY+GL+AL ++ELSE+ + + L  GY+ +S+L PVM+NLWI+R
Sbjct  440   TAICSMIKSYPTVGDAALYIGLMALCVHELSELKYFYLLLNGYILISVLGPVMYNLWIFR  499

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT + YA  Q
Sbjct  500   GTGNANFYFATNLVYATLQ  518



>ref|XP_010476248.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=455

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 6/151 (4%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILP-LAMRLYNRPCFLAFV  1046
             FIL+++DLSPNIGV WYFFAE F+F R++ LIVF++ IL   LP LA R  +RPCFLAF 
Sbjct  309   FILSIEDLSPNIGVFWYFFAEAFEFSRNYLLIVFNLYILLTSLPPLAFRFKHRPCFLAFA  368

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+ + S++KSYPS GD+ALYL L ALF+NELS M   FF+ CG++G SLLSPV+HN+WIW
Sbjct  369   YLVMSSIIKSYPSGGDAALYLSLWALFVNELSAMNNLFFILCGHIGFSLLSPVVHNIWIW  428

Query  865   RGTGNANFYFATAMGYACFQGEVVGFARNRR  773
             RGTGNANFYF  A+GYA FQ +     RN R
Sbjct  429   RGTGNANFYFGNAIGYAGFQCK-----RNAR  454



>ref|XP_010476249.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Camelina sativa]
Length=421

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILP-LAMRLYNRPCFLAFV  1046
             FIL+++DLSPNIGV WYFFAE F+F R++ LIVF++ IL   LP LA R  +RPCFLAF 
Sbjct  223   FILSIEDLSPNIGVFWYFFAEAFEFSRNYLLIVFNLYILLTSLPPLAFRFKHRPCFLAFA  282

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+ + S++KSYPS GD+ALYL L ALF+NELS M   FF+ CG++G SLLSPV+HN+WIW
Sbjct  283   YLVMSSIIKSYPSGGDAALYLSLWALFVNELSAMNNLFFILCGHIGFSLLSPVVHNIWIW  342

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFYF  A+GYA FQ
Sbjct  343   RGTGNANFYFGNAIGYAGFQ  362



>ref|XP_010476247.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=507

 Score =   189 bits (481),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILP-LAMRLYNRPCFLAFV  1046
             FIL+++DLSPNIGV WYFFAE F+F R++ LIVF++ IL   LP LA R  +RPCFLAF 
Sbjct  309   FILSIEDLSPNIGVFWYFFAEAFEFSRNYLLIVFNLYILLTSLPPLAFRFKHRPCFLAFA  368

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+ + S++KSYPS GD+ALYL L ALF+NELS M   FF+ CG++G SLLSPV+HN+WIW
Sbjct  369   YLVMSSIIKSYPSGGDAALYLSLWALFVNELSAMNNLFFILCGHIGFSLLSPVVHNIWIW  428

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFYF  A+GYA FQ
Sbjct  429   RGTGNANFYFGNAIGYAGFQ  448



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   183 bits (465),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTV  279
            MS   WG  L+F L   T +  G    +S+V Q++LD V  LPG GFNV+F  Y+GYVTV
Sbjct  1    MSNLKWGF-LVFALFFITEVHLGSCFVNSNVVQKQLDKVTKLPGQGFNVNFENYAGYVTV  59

Query  280  NQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWN  459
            N+ES RALFYWFFEAV DPSSKPLVLWLNGGPGCSSIAYGLAEELGPFH+EKDGKTLYWN
Sbjct  60   NEESERALFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWN  119

Query  460  PYSWNLG  480
            PYSWNL 
Sbjct  120  PYSWNLA  126



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 100/127 (79%), Gaps = 3/127 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTV  279
            MS   WG  L+F L   T +  G     S+V Q++LD V  LPG GFNV+F  Y+GYVTV
Sbjct  1    MSNLKWGF-LVFALFFITEVHLGSCFVDSNVVQKQLDKVSKLPGQGFNVNFENYAGYVTV  59

Query  280  NQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWN  459
            N+ES RALFYWFFEAV +PSSKPLVLWLNGGPGCSSIAYGLAEELGPFH+EKDGKTLYWN
Sbjct  60   NEESERALFYWFFEAVDEPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWN  119

Query  460  PYSWNLG  480
            PYSWNL 
Sbjct  120  PYSWNLA  126



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   178 bits (451),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  136  LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWF  315
            +FV+L   SI G    +   Q++LD V  LPG GFNV+FA YSGYVTVN++S RALFYWF
Sbjct  7    VFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSERALFYWF  66

Query  316  FEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWNLG  480
            FEAV DPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNPYSWNL 
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNPYSWNLA  121



>dbj|BAD81713.1| putative transamidase complex subunit PIG-U [Oryza sativa Japonica 
Group]
Length=320

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 99/120 (83%), Gaps = 11/120 (9%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLW           SFFLIV ++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  188   FILTVKDLSPNIGVLW-----------SFFLIVINMNIVFMVLPLAIRLKHRPCFLAFVY  236

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPSVGDSALYLGLL LF  EL+EM  +FFLF GY+GVSLLSPVMHNLWIWR
Sbjct  237   TAIVAMLKSYPSVGDSALYLGLLGLFATELAEMKLTFFLFFGYIGVSLLSPVMHNLWIWR  296



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +1

Query  136  LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWF  315
            +FV+L    I G    +   Q+ LD V  LPG GFNV+FA YSGYVTVN+ES RALFYWF
Sbjct  7    VFVVLGLFFISGSFSVTPNAQKLLDRVSKLPGQGFNVNFAHYSGYVTVNEESERALFYWF  66

Query  316  FEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWNLG  480
            FEAV DPSSKPLVLWLNGGPGCSSIA+GLAEELGPFH+EKDGKTLYWNPYSWNL 
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEELGPFHIEKDGKTLYWNPYSWNLA  121



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   175 bits (444),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 7/130 (5%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATS--IDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAQYS  264
            MS  +W  +L+ V+L++    I  G G     +SS +QQ+LD V  LPG  FNVSFA YS
Sbjct  1    MSTFNWVFNLVLVILISELHLISCGAGLSSSKNSSYEQQQLDRVSKLPGQSFNVSFAHYS  60

Query  265  GYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGK  444
            GY TVN+ESGRALFYWFFEA VDPSSKP+VLWLNGGPGCSS+A+GLAEE+GPFH+EKDGK
Sbjct  61   GYATVNKESGRALFYWFFEAEVDPSSKPIVLWLNGGPGCSSVAFGLAEEIGPFHIEKDGK  120

Query  445  TLYWNPYSWN  474
            ++Y NPYSWN
Sbjct  121  SIYLNPYSWN  130



>gb|AAF88086.1|AC025417_14 T12C24.26 [Arabidopsis thaliana]
Length=453

 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 12/140 (9%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAM-RLYNRPCFLAFV  1046
             FIL ++DLSPNI        E F+F R++ LI+F++ IL   +P  M RL +RPCFLAF 
Sbjct  297   FILRIEDLSPNI--------EAFEFSRNYLLIIFNLYILLTSIPSLMFRLKHRPCFLAFA  348

Query  1045  YMAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIW  866
             Y+A  S+LKSYPSV    LYL L ALF+NEL++M +SFF+FCGY+G SLLSPVMHN WIW
Sbjct  349   YLAFTSILKSYPSV---TLYLSLWALFVNELTDMEYSFFIFCGYIGFSLLSPVMHNFWIW  405

Query  865   RGTGNANFYFATAMGYACFQ  806
             RGTGNANFYF  AMGYACFQ
Sbjct  406   RGTGNANFYFGNAMGYACFQ  425



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   172 bits (436),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 96/127 (76%), Gaps = 4/127 (3%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLAT----SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYV  273
            M+  +W  +L  ++ +A     S          +QQ LD VL LPG  FNVSFA Y+GYV
Sbjct  1    MTTLNWVFNLSLIICVAKLHFISCRASFSPDPPNQQLLDRVLKLPGQNFNVSFAHYAGYV  60

Query  274  TVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLY  453
            TVN+ESGRALFYWFFEA  DPSSKPLVLWLNGGPGCSSIAYGLAEE+GPFHVEKDGKTLY
Sbjct  61   TVNKESGRALFYWFFEADEDPSSKPLVLWLNGGPGCSSIAYGLAEEIGPFHVEKDGKTLY  120

Query  454  WNPYSWN  474
             NPYSWN
Sbjct  121  LNPYSWN  127



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            +L+F  LLA +  G    SS  +Q+ D V  LPG GFNVSFA YSGYVTV+++SGRALFY
Sbjct  12   ALIFFTLLANAHLGNCALSS--RQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALFY  69

Query  310  WFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            WFFEAV DP SKPL+LWLNGGPGCSSI YGLAEE+GPFH++ DGKTLY NPYSWN
Sbjct  70   WFFEAVEDPDSKPLLLWLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNPYSWN  124



>ref|XP_009627450.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Nicotiana tomentosiformis]
Length=339

 Score =   166 bits (421),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 99/139 (71%), Gaps = 33/139 (24%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNI                                 A+RL +RPCFLAFVY
Sbjct  209   FILTVKDLSPNI---------------------------------AIRLKHRPCFLAFVY  235

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
             MAICSMLK YPSVGDSALYL LLALF NEL+EM FSFFLFCGYVGVSLLSPVMHNLWIWR
Sbjct  236   MAICSMLKPYPSVGDSALYLALLALFCNELAEMQFSFFLFCGYVGVSLLSPVMHNLWIWR  295

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYFAT M YACFQ
Sbjct  296   GTGNANFYFATGMAYACFQ  314



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAQYSGYVT  276
            M+  +W   +L   LL    +      S D   QQ+LD VL LPG  FNVSFA Y+G+VT
Sbjct  1    MATLNWVLVILISTLLIDLTNCSSCGFSADPYAQQQLDRVLHLPGQNFNVSFAHYAGFVT  60

Query  277  VNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYW  456
            VN+E+GR LFYWFFEA  DP+SKPLVLWLNGGPGCSSIAYG+AEE+GPFHVEKDGK LY 
Sbjct  61   VNEEAGRTLFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEIGPFHVEKDGKHLYL  120

Query  457  NPYSWN  474
            NPYSWN
Sbjct  121  NPYSWN  126



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   167 bits (422),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = +1

Query  136  LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWF  315
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFA Y+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  316  FEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            FEAV DP+SKPLVLWLNGGPGCSSIAYGLAEELGPFHV  +GK+LY NPYSWN
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWN  126



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   167 bits (423),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  145  LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEA  324
            L +  S+     +  V QQ LD VL+LPG  FN+SFA YSGYVTVNQESGR LFYWF EA
Sbjct  25   LYVGASVFESTLTDPVAQQGLDRVLELPGQTFNISFAHYSGYVTVNQESGRNLFYWFMEA  84

Query  325  VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            V DP SKPL+LWLNGGPGCSSIAYG AEE+GPFH+++DGKTLY NPYSWN
Sbjct  85   VEDPDSKPLILWLNGGPGCSSIAYGEAEEIGPFHIQRDGKTLYLNPYSWN  134



>ref|XP_006453576.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66816.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=352

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 91/126 (72%), Gaps = 3/126 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSI---DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVT  276
            M+    G S L  +L    I        +  V QQKLD V  LPG  FNV+FA YSGYVT
Sbjct  1    MAYNPKGASFLVQILFICIIFYLGSAFSTDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVT  60

Query  277  VNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYW  456
            VN+ESGRALFYWF EAV DP SKPLVLWLNGGPGCSSIAYG AEE+GPFH++ DGKTLY 
Sbjct  61   VNEESGRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYL  120

Query  457  NPYSWN  474
            NPYSWN
Sbjct  121  NPYSWN  126



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 94/117 (80%), Gaps = 3/117 (3%)
 Frame = +1

Query  133  LLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRAL  303
            +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFA Y+GYVTVN+ +GRAL
Sbjct  8    VFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNEYTGRAL  67

Query  304  FYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            FYWF EA  DPSSKPLVLWLNGGPGCSSIAYG +EE+GPFH+++DGKTLY NPYSWN
Sbjct  68   FYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSWN  124



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = +1

Query  136  LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWF  315
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFA Y+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  316  FEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            FEAV DP+SKPLVLWLNGGPGCSSIAYGLAEELGPFHV  +GK+LY NPYSWN
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWN  126



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 94/117 (80%), Gaps = 3/117 (3%)
 Frame = +1

Query  133  LLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRAL  303
            +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFA Y+GYVTVN+ +GRAL
Sbjct  48   VFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNEYTGRAL  107

Query  304  FYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            FYWF EA  DPSSKPLVLWLNGGPGCSSIAYG +EE+GPFH+++DGKTLY NPYSWN
Sbjct  108  FYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSWN  164



>gb|AAG51607.1|AC010795_11 unknown protein; 55290-58984 [Arabidopsis thaliana]
Length=551

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 94/139 (68%), Gaps = 37/139 (27%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FIL+++DLSPNIGV WYFFAEVFDFFR+FFLIV HV                        
Sbjct  420   FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVLHV------------------------  455

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
                          GDSALYL L ALF+NEL +M FSFFLFCGY+G+SLLSPVMHNLWIWR
Sbjct  456   -------------GDSALYLSLWALFVNELLDMKFSFFLFCGYLGISLLSPVMHNLWIWR  502

Query  862   GTGNANFYFATAMGYACFQ  806
             GTGNANFYF  A+GYACFQ
Sbjct  503   GTGNANFYFGNAIGYACFQ  521



>gb|KDO62275.1| hypothetical protein CISIN_1g0418332mg, partial [Citrus sinensis]
Length=320

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  190  VDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNG  369
            V QQKLD V  LPG  FNV+FA YSGYVTVN+ESGRALFYWF EAV DP SKPLVLWLNG
Sbjct  67   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLWLNG  126

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSSIAYG AEE+GPFH++ DGKTLY NPYSWN
Sbjct  127  GPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWN  161



>gb|KJB76660.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=407

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 91/130 (70%), Gaps = 7/130 (5%)
 Frame = +1

Query  106  MSAQSWGCSLL-------FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYS  264
            M+   WG  L+       F L L + +       S+ QQKLD V +LPG  F V FA Y+
Sbjct  1    MADTRWGFGLMTFFTFISFYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYA  60

Query  265  GYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGK  444
            GYVTVN+ SGRALFYWFFEA  DP SKPL+LWLNGGPGCSS+AYG AEE+GPFH+  DGK
Sbjct  61   GYVTVNEHSGRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGK  120

Query  445  TLYWNPYSWN  474
            T+Y NPYSWN
Sbjct  121  TVYLNPYSWN  130



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   164 bits (415),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  178  GSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVL  357
            G+S+ ++Q+ D VL LPG  FNVSFA YSGYVTV+ + GRALFYWFFEAV DP+SKPLVL
Sbjct  28   GASAFERQEKDRVLRLPGQSFNVSFAHYSGYVTVDDDPGRALFYWFFEAVEDPASKPLVL  87

Query  358  WLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            WLNGGPGCSSIAYGLAEELGPFH+  DGK+LY NPY+WN
Sbjct  88   WLNGGPGCSSIAYGLAEELGPFHINADGKSLYLNPYTWN  126



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   164 bits (416),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            QQ+LD VL+LPG  FNVSFA Y+GYVTVN+ SGRALFYWFFEAV DPSSKPLVLWLNGGP
Sbjct  48   QQQLDRVLELPGQTFNVSFAHYAGYVTVNEASGRALFYWFFEAVEDPSSKPLVLWLNGGP  107

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GCSSIAYG AEE+GPFH++ DGKTLY N YSWN
Sbjct  108  GCSSIAYGEAEEIGPFHIKADGKTLYLNQYSWN  140



>gb|AFK34623.1| unknown [Lotus japonicus]
Length=174

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +1

Query  112  AQSWGCSLLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVN  282
            AQS    +L + ++AT    I+    S    QQ  D V  LPG  FN SFA YSGY+TVN
Sbjct  2    AQSERSQILAIAIVATLFLCINFATSSDPFVQQHHDKVGRLPGQNFNTSFAHYSGYITVN  61

Query  283  QESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNP  462
             ++GRALFYWF EA  DP SKPLVLWLNGGPGCSSIAYG AEE+GPFH++ DGKTLY NP
Sbjct  62   DKAGRALFYWFMEADQDPQSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNP  121

Query  463  YSWN  474
            Y+WN
Sbjct  122  YAWN  125



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 94/120 (78%), Gaps = 4/120 (3%)
 Frame = +1

Query  136  LFVL-LLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRAL  303
            +FVL +L T I     +SS D   QQ+LD V  LPG  FN+SFA YSGYVTVN+ SGRAL
Sbjct  7    VFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNENSGRAL  66

Query  304  FYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWNLGI  483
            FYWF EA  DPSSKPLVLWLNGGPGCSSIAYG +EE+GPFH+++DGKTLY NPYSWN  I
Sbjct  67   FYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSWNQDI  126



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLW  360
            +  V QQKLD V  LPG  FNV+FA YSGYVTVN+ESGRALFYWF EAV DP SKPLVLW
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLW  88

Query  361  LNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LNGGPGCSSIAYG AEE+GPFH++ DGKTLY NPYSWN
Sbjct  89   LNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWN  126



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLW  360
            +  V QQKLD V  LPG  FNV+FA YSGYVTVN+ESGRALFYWF EAV DP SKPLVLW
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLW  88

Query  361  LNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LNGGPGCSSIAYG AEE+GPFH++ DGKTLY NPYSWN
Sbjct  89   LNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWN  126



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLW  360
            +  V QQKLD V  LPG  FNV+FA YSGYVTVN+ESGRALFYWF EAV DP SKPLVLW
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLW  88

Query  361  LNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LNGGPGCSSIAYG AEE+GPFH++ DGKTLY NPYSWN
Sbjct  89   LNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWN  126



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 93/117 (79%), Gaps = 4/117 (3%)
 Frame = +1

Query  136  LFVL-LLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRAL  303
            +FVL +L T I     +SS D   QQ+LD V  LPG  FN+SFA YSGYVTVN+ SGRAL
Sbjct  7    VFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNENSGRAL  66

Query  304  FYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            FYWF EA  DPSSKPLVLWLNGGPGCSSIAYG +EE+GPFH+++DGKTLY NPYSWN
Sbjct  67   FYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSWN  123



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  127  CSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALF  306
            C ++ + L   S+     ++   QQKLD V +LPG  FN+SFA +SGYV VN+E+GRALF
Sbjct  12   CLIILLNLHLGSVFSAPPANPFAQQKLDRVAELPGQSFNLSFAHFSGYVPVNEETGRALF  71

Query  307  YWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            YWF EA  DP SKP+VLWLNGGPGCSSIAYG+AEE+GPFH+E DGKTLY NPYSWN
Sbjct  72   YWFVEAAEDPHSKPIVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSWN  127



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 91/130 (70%), Gaps = 7/130 (5%)
 Frame = +1

Query  106  MSAQSWGCSLL-------FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYS  264
            M+   WG  L+       F L L + +       S+ QQKLD V +LPG  F V FA Y+
Sbjct  1    MADTRWGFGLMTFFTFISFYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYA  60

Query  265  GYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGK  444
            GYVTVN+ SGRALFYWFFEA  DP SKPL+LWLNGGPGCSS+AYG AEE+GPFH+  DGK
Sbjct  61   GYVTVNEHSGRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGK  120

Query  445  TLYWNPYSWN  474
            T+Y NPYSWN
Sbjct  121  TVYLNPYSWN  130



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 88/109 (81%), Gaps = 5/109 (5%)
 Frame = +1

Query  148  LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAV  327
            ++ATS++      SV QQKLD V  LPG  FNVSFA Y+GYVTVN+ SGRALFYWFFEA 
Sbjct  27   VIATSLE-----DSVAQQKLDKVPKLPGQNFNVSFAHYAGYVTVNEGSGRALFYWFFEAA  81

Query  328  VDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
             DP SKPL+LWLNGGPGCSS+AYG AEE+GPFH+  DGKTLY NPYSWN
Sbjct  82   EDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTLYLNPYSWN  130



>ref|XP_012071557.1| PREDICTED: serine carboxypeptidase II-2-like [Jatropha curcas]
 gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            QQ+LD V +LPG  FNVSFA YSGYVTVN+ESGRALFYWF EAV DP+SKPLVLWLNGGP
Sbjct  40   QQELDRVWELPGQNFNVSFAHYSGYVTVNEESGRALFYWFIEAVEDPASKPLVLWLNGGP  99

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GCSSI +G AEE+GPFH+  DGKTLY NPYSWN
Sbjct  100  GCSSIGFGEAEEIGPFHIHADGKTLYLNPYSWN  132



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   162 bits (409),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 90/130 (69%), Gaps = 7/130 (5%)
 Frame = +1

Query  106  MSAQSWGCSLL-------FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYS  264
            M    WG  L+       F L L + +       S+ QQKLD V +LPG  F V FA Y+
Sbjct  1    MPDPRWGFGLMTFFTFISFYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYA  60

Query  265  GYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGK  444
            GYVTVN+ SGRALFYWFFEA  DP SKPL+LWLNGGPGCSS+AYG AEE+GPFH+  DGK
Sbjct  61   GYVTVNKHSGRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGK  120

Query  445  TLYWNPYSWN  474
            T+Y NPYSWN
Sbjct  121  TVYLNPYSWN  130



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   161 bits (408),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLAT-SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVN  282
            M    W   L+F+L L   S+     +  + QQ+LD V  LPG  FNVSFA Y+GYV VN
Sbjct  1    MFKPRWAFVLIFLLNLHLGSVFATVPTDPLVQQQLDRVHGLPGQTFNVSFAHYAGYVNVN  60

Query  283  QESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNP  462
            +++GRALFYWF EA  DP+SKPLVLWLNGGPGCSSIAYG+AEE+GPFH++ DGKTLY NP
Sbjct  61   EDAGRALFYWFVEAAEDPTSKPLVLWLNGGPGCSSIAYGMAEEVGPFHIQADGKTLYLNP  120

Query  463  YSWN  474
            YSWN
Sbjct  121  YSWN  124



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 92/127 (72%), Gaps = 4/127 (3%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLAT----SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYV  273
            M+   W  +L  +++L      S+     +  + QQ LD V  LPG  FN+SFA +SGYV
Sbjct  1    MAKPRWDSALKVLIILLNLHLGSVFSAPPADPIAQQNLDRVAXLPGQSFNLSFAHFSGYV  60

Query  274  TVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLY  453
             VN++SGRALFYWF EA  DP SKP+VLWLNGGPGCSSIAYG+AEE+GPFH+E DGKTLY
Sbjct  61   PVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLY  120

Query  454  WNPYSWN  474
             NPYSWN
Sbjct  121  LNPYSWN  127



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLAT----SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYV  273
            M   SW   L + ++L      S+     + ++ QQKLD VL+LPG  FN+SFA Y+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  274  TVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLY  453
            TVN++SGRALFYW  EA  DP SKP+VLWLNGGPGCSSIAYG AEE+GPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  454  WNPYSWN  474
             NPYSWN
Sbjct  121  LNPYSWN  127



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLAT----SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYV  273
            M   SW   L + ++L      S+     + ++ QQKLD VL+LPG  FN+SFA Y+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  274  TVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLY  453
            TVN++SGRALFYW  EA  DP SKP+VLWLNGGPGCSSIAYG AEE+GPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  454  WNPYSWN  474
             NPYSWN
Sbjct  121  LNPYSWN  127



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +1

Query  118  SWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGR  297
            S   +L+  + L   +        V QQ LD VL LPG  F+V+FA YSGYVTVN++ GR
Sbjct  14   SIATTLIIFVNLYLGVFASSLRDPVAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGR  73

Query  298  ALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            ALFYWF EAV DP SKPL+LWLNGGPGCSSIAYG+AEE+GPFH++ DGKTLY NPYSWN
Sbjct  74   ALFYWFVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWN  132



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +1

Query  118  SWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGR  297
            S   +L+  + L   +        V QQ LD VL LPG  F+V+FA YSGYVTVN++ GR
Sbjct  14   SIATTLIIFVNLYLGVFASSLRDPVAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGR  73

Query  298  ALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            ALFYWF EAV DP SKPL+LWLNGGPGCSSIAYG+AEE+GPFH++ DGKTLY NPYSWN
Sbjct  74   ALFYWFVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWN  132



>gb|KCW72094.1| hypothetical protein EUGRSUZ_E00536 [Eucalyptus grandis]
Length=419

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFR FFLIVFHVNILFM+LPLA+RL +RP FLAFVY
Sbjct  327   FILTVKDLSPNIGVLWYFFAEVFDFFRDFFLIVFHVNILFMMLPLAIRLKHRPGFLAFVY  386

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELS  950
             +AI SM KSYPS+GDSALYLG+LALF+NEL+
Sbjct  387   LAISSMFKSYPSIGDSALYLGVLALFVNELA  417



>ref|XP_006387151.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
 gb|ERP46065.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
Length=324

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +1

Query  118  SWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGR  297
            S   +L+  + L   +        V QQ LD V  LPG  F+V+FA YSGYVTVN++ GR
Sbjct  14   SIATTLIIFVNLYLGVFASSLRDPVAQQHLDRVQKLPGQNFDVNFAHYSGYVTVNEKYGR  73

Query  298  ALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            ALFYW  EAV DP SKPL+LWLNGGPGCSSIAYG+AEE+GPFH++ DGKTLY NPYSWN
Sbjct  74   ALFYWLVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWN  132



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 91/114 (80%), Gaps = 4/114 (4%)
 Frame = +1

Query  133  LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYW  312
              F+L+LA+S++    +S  +QQ  + VL LPG  F+VSFA YSGYVTVN+E+GRA FYW
Sbjct  19   FFFLLVLASSLE----ASVFEQQARERVLRLPGQSFDVSFAHYSGYVTVNEEAGRAFFYW  74

Query  313  FFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            FFEA  +P+SKPLVLWLNGGPGCSSI  GLAEE+GPFHV  DGK+LY NPYSWN
Sbjct  75   FFEATEEPASKPLVLWLNGGPGCSSIGLGLAEEVGPFHVNADGKSLYPNPYSWN  128



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   158 bits (400),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +1

Query  193  DQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGG  372
            +QQ+LD V  LPG  F+V+FA Y+GYVTVN+ESGRA FYWFFEA  DPSSKPL+LWLNGG
Sbjct  6    NQQELDRVSKLPGQNFDVNFASYAGYVTVNEESGRAYFYWFFEADEDPSSKPLLLWLNGG  65

Query  373  PGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            PGCSSIAYGLAEE+GPFH+EKDGKTLY N +SWN
Sbjct  66   PGCSSIAYGLAEEVGPFHIEKDGKTLYLNQFSWN  99



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  175  KGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLV  354
             G S   +Q+ D V  LPG  FNVSFA Y+GYVTVN++SGRALFYWFFEAV DP SKPLV
Sbjct  25   NGGSPFVRQEGDRVQRLPGQSFNVSFAHYAGYVTVNEDSGRALFYWFFEAVEDPVSKPLV  84

Query  355  LWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LWLNGGPGCSSIAYGLAEE+GPFHV  DG++LY NPYSWN
Sbjct  85   LWLNGGPGCSSIAYGLAEEVGPFHVNADGQSLYLNPYSWN  124



>ref|XP_006845388.1| PREDICTED: serine carboxypeptidase II-2 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 95/138 (69%), Gaps = 13/138 (9%)
 Frame = +1

Query  61   FKKGGFLCLTKIPLEMSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGF  240
             KK  F  L  I L +  Q  G  +          D  +G+S V+    D VL LPG  F
Sbjct  1    MKKKAFCLLFLIHLHIFLQVKGTIVE---------DEDRGASQVN----DRVLKLPGQAF  47

Query  241  NVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGP  420
            +VSFA YSGYVTVN+E+GRALFYWFFEAV DPSSKPLV+WLNGGPGCSSIAYG AEE+GP
Sbjct  48   DVSFAHYSGYVTVNKEAGRALFYWFFEAVDDPSSKPLVVWLNGGPGCSSIAYGEAEEIGP  107

Query  421  FHVEKDGKTLYWNPYSWN  474
            FH+  DGKTLY NP SWN
Sbjct  108  FHIRPDGKTLYLNPDSWN  125



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            +L+F+ LLA   +   G   + +Q+ D V  LPG  FNV+F  YSG+VTVN++ GRALFY
Sbjct  17   ALIFLTLLA---NAHLGICVLSRQQQDKVSKLPGQDFNVNFEHYSGFVTVNEKLGRALFY  73

Query  310  WFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            WFFEAV DP SKPLVLWLNGGPGCSSIA+GLAEE+GPFH++ DGKTLY NPYSWN
Sbjct  74   WFFEAVEDPDSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIKPDGKTLYLNPYSWN  128



>ref|XP_011018072.1| PREDICTED: serine carboxypeptidase-like 29 isoform X2 [Populus 
euphratica]
Length=410

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  118  SWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGR  297
            S   +L+  + L   +        V QQ LD VL LPG  F+V+FA YSGYVTVN++ GR
Sbjct  14   SIATTLIIFVNLYLGVFASSLRDPVAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGR  73

Query  298  ALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            ALFYWF EAV DP SKPL+L LNGGPGCSSIAYG+AEE+GPFH++ DGKTLY NPYSWN
Sbjct  74   ALFYWFVEAVEDPQSKPLLLRLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWN  132



>gb|KDP38716.1| hypothetical protein JCGZ_04069 [Jatropha curcas]
Length=266

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLW  360
            S  + QQ+LD VL LPG  F+VSFA YSGYVTVN+ESGRA FYWF EAV DP SKPLVLW
Sbjct  39   SDPIAQQELDRVLGLPGQTFDVSFAHYSGYVTVNEESGRAFFYWFMEAVEDPESKPLVLW  98

Query  361  LNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LNG PGCSSI YG AEE+G F+++ DGKTLY NPYSWN
Sbjct  99   LNGRPGCSSIGYGEAEEVGLFYIQADGKTLYLNPYSWN  136



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  118  SWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGR  297
            S   +L+  + L   +        V QQ LD VL LPG  F+V+FA YSGYVTVN++ GR
Sbjct  14   SIATTLIIFVNLYLGVFASSLRDPVAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGR  73

Query  298  ALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            ALFYWF EAV DP SKPL+L LNGGPGCSSIAYG+AEE+GPFH++ DGKTLY NPYSWN
Sbjct  74   ALFYWFVEAVEDPQSKPLLLRLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWN  132



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   156 bits (394),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +1

Query  145  LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEA  324
            L L T       S  + QQK+D V  LPG  F+V+F  YSGY+TVN+E GRALFYWF EA
Sbjct  22   LQLGTCSSSSSSSDPITQQKIDRVNYLPGQNFDVAFTHYSGYITVNEEFGRALFYWFIEA  81

Query  325  VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            V DPSSKPL+LWLNGGPGCSSIA+G AEELGPFH++KDGKTLY NP SWN
Sbjct  82   VEDPSSKPLLLWLNGGPGCSSIAFGEAEELGPFHIQKDGKTLYLNPNSWN  131



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   154 bits (388),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +1

Query  190  VDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNG  369
            + QQ+LD + +LPG  F V F  YSGY+TVN+ESGRALFYWFFEA  D +SKPLVLWLNG
Sbjct  104  LRQQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNG  163

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSSIAYG AEE+GPFH+  DGK +Y NPYSWN
Sbjct  164  GPGCSSIAYGEAEEIGPFHINADGKPVYLNPYSWN  198



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis sativus]
Length=468

 Score =   152 bits (385),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            QQ+LD + +LPG  F V F  YSGY+TVN+ESGRALFYWFFEA  D +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GCSSIAYG AEE+GPFH+  DGK +Y NPYSWN
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKPVYLNPYSWN  124



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            QQ+LD VL+LPG  FN+SF  YSGY TVN+ESGR+LFYWF EA  DP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWNL  477
            GCSSIAYG+AEE+GPFH+  D  +LY NPYSWNL
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNL  128



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            QQ+LD VL+LPG  FN+SF  YSGY TVN+ESGR+LFYWF EA  DP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWNL  477
            GCSSIAYG+AEE+GPFH+  D  +LY NPYSWNL
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNL  128



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            QQ+LD + +LPG  F V F  YSGY+TVN+ESGRALFYWFFEA  D +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GCSSIA+G AEE+GPFH+  DGK++Y NPYSWN
Sbjct  92   GCSSIAFGEAEEIGPFHINADGKSVYLNPYSWN  124



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = +1

Query  112  AQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQES  291
            A++ G  L  + +LA +       + + Q++ D V  LPG  FNVSFA YSGYVT N++ 
Sbjct  2    AKTRGSCLFAITILAIA-HFCNCEAVLSQKEQDKVSTLPGQDFNVSFAHYSGYVTTNEKL  60

Query  292  GRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSW  471
            GRALFYWFFEAV D +SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N YSW
Sbjct  61   GRALFYWFFEAVEDANSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSW  120

Query  472  N  474
            N
Sbjct  121  N  121



>gb|AEX12786.1| hypothetical protein 2_8315_02, partial [Pinus radiata]
Length=128

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  193  DQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGG  372
            ++Q  D +  LPG   NV+F QYSGY+TV+  +GRALFYW  EA  +PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  373  PGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            PGCSS+AYG AEELGPFH+  DGK+LY NPYSWN
Sbjct  77   PGCSSVAYGEAEELGPFHIHADGKSLYLNPYSWN  110



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = +1

Query  127  CSLLFVL-LLATS-IDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGR  297
            C++L VL LLA S     +GSSS   +Q+ D V  +PG GFN SFA Y+GYVTV++E G 
Sbjct  7    CAVLAVLFLLAVSGAAAAEGSSSWRGEQERDRVPRVPGQGFNASFAHYAGYVTVSEERGA  66

Query  298  ALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            ALFYWFFEA  +P+SKPLVLWLNGGPGCSSIA+GL EE+GPFH+  DGK ++ NPYSWN
Sbjct  67   ALFYWFFEAAHEPASKPLVLWLNGGPGCSSIAFGLGEEVGPFHINADGKGVHMNPYSWN  125



>gb|AEX12770.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12771.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12775.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12776.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12779.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12782.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12783.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12785.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
Length=128

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  193  DQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGG  372
            ++Q  D +  LPG   NV+F QYSGY+TV+  +GRALFYW  EA  +PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  373  PGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            PGCSS+AYG AEELGPFH+  DGK+LY NPYSWN
Sbjct  77   PGCSSVAYGEAEELGPFHIHADGKSLYLNPYSWN  110



>gb|AEX12772.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12773.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12774.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12777.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12778.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12780.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12781.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12784.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
Length=128

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  193  DQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGG  372
            ++Q  D +  LPG   NV+F QYSGY+TV+  +GRALFYW  EA  +PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  373  PGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            PGCSS+AYG AEELGPFH+  DGK+LY NPYSWN
Sbjct  77   PGCSSVAYGEAEELGPFHINADGKSLYLNPYSWN  110



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   150 bits (379),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +1

Query  100  LEMSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTV  279
            +E     W   L  V LL  S      +S   +Q+ D V  LPG GFN+SFA Y+GY+TV
Sbjct  1    MEWRMALWSQILCIVTLLLCS---DCAASFAKEQQKDRVGRLPGQGFNISFAHYAGYITV  57

Query  280  NQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWN  459
            N+++GR LFYWF EA+ DP SKPLVLWLNGGPGCSSIA+G +EE+GPFH+  D KTL++N
Sbjct  58   NEKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFN  117

Query  460  PYSWN  474
            PYSWN
Sbjct  118  PYSWN  122



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   150 bits (380),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +1

Query  100  LEMSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTV  279
            +E     W   L  V LL  S      +S   +Q+ D V  LPG GFN+SFA Y+GY+TV
Sbjct  15   MEWRMALWSQILCIVTLLLCS---DCAASFAKEQQKDRVGRLPGQGFNISFAHYAGYITV  71

Query  280  NQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWN  459
            N+++GR LFYWF EA+ DP SKPLVLWLNGGPGCSSIA+G +EE+GPFH+  D KTL++N
Sbjct  72   NEKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFN  131

Query  460  PYSWN  474
            PYSWN
Sbjct  132  PYSWN  136



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 2/115 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            +L+ + LLAT+    +   S  +Q  D V  LPG  FNVSFA YSG++T N++ GRALFY
Sbjct  12   ALIAIALLATTAHLCEAGLSRKEQ--DKVSKLPGQNFNVSFAHYSGFITTNEKLGRALFY  69

Query  310  WFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            WFFEAV D  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN
Sbjct  70   WFFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWN  124



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   148 bits (374),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 86/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  133  LLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRAL  303
            LL V L +T+    + S+  D   +Q  D +  LPG   NV+FAQYSGY+TV+  +GRAL
Sbjct  18   LLLVALQSTATSTWEESNERDWRNEQAKDRITQLPGQPSNVNFAQYSGYITVDNNAGRAL  77

Query  304  FYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            FYW  EA  +PSSKPLVLWLNGGPGCSS+AYG AEELGPFH+  DGK+LY NPYSWN
Sbjct  78   FYWLIEATENPSSKPLVLWLNGGPGCSSVAYGEAEELGPFHINADGKSLYLNPYSWN  134



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  166  DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSK  345
            DG   ++   +Q+ D V  +PG  F+V FAQY+GYVTV++E G ALFYWFFEA  DP+SK
Sbjct  33   DGEAAATWRAEQEWDRVARVPGQDFDVGFAQYAGYVTVSEERGAALFYWFFEAAEDPASK  92

Query  346  PLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            PLVLWLNGGPGCSSIAYG+AEE+GPFHV  DG+ ++ NPYSWN
Sbjct  93   PLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWN  135



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 85/115 (74%), Gaps = 3/115 (3%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            +L+ +  LAT+     G S   Q++ D V  LPG  FNVSFA YSG+V  N++ GRALFY
Sbjct  13   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALFY  69

Query  310  WFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W FEAV D  SKPLVLWLNGGPGCSS+AYG AEE+GPFH++ DGKTLY N YSWN
Sbjct  70   WLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQYSWN  124



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 85/115 (74%), Gaps = 3/115 (3%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            +L+ +  LAT+     G S   Q++ D V  LPG  FNVSFA YSG+V  N++ GRALFY
Sbjct  13   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALFY  69

Query  310  WFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W FEAV D  SKPLVLWLNGGPGCSS+AYG AEE+GPFH++ DGKTLY N YSWN
Sbjct  70   WLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQYSWN  124



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            +L+ +  LAT+     G S   Q++ D V  LPG  FNVSFA YSG+VT N++ GRALFY
Sbjct  14   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFY  70

Query  310  WFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W FEAV D  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN
Sbjct  71   WLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWN  125



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            +L+ +  LAT+     G S   Q++ D V  LPG  FNVSFA YSG+VT N++ GRALFY
Sbjct  13   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVTTNEKLGRALFY  69

Query  310  WFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W FEAV D  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN
Sbjct  70   WLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWN  124



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQ  285
            M+  + G   + V+ L          + + Q++ D V  LPG  FNV FA YSG+VT N+
Sbjct  1    MAKTTRGSCFVVVVALLAITHLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNE  60

Query  286  ESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
            + GRALFYWFFEA  D +SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N Y
Sbjct  61   KLGRALFYWFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQY  120

Query  466  SWN  474
            SWN
Sbjct  121  SWN  123



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQ  285
            M+  + G   + V LLA +       + + Q++ D V  LPG  FNV FA YSG+VT N+
Sbjct  1    MAKTTRGSCFVVVALLAIT-HLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNE  59

Query  286  ESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
            + GRALFYWFFEA  D +SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N Y
Sbjct  60   KLGRALFYWFFEAADDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQY  119

Query  466  SWN  474
            SWN
Sbjct  120  SWN  122



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = +1

Query  112  AQSWGCSLLFVLLLATSIDGGKGSSS--VDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQ  285
            AQS    L F  LL  S      S+   + QQ  D V  LPG  FNVSFA Y+GY+TV +
Sbjct  2    AQSGSGFLCFATLLLCSAFATSFSTDPPLLQQHKDRVGRLPGQNFNVSFAHYAGYITVEE  61

Query  286  ESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
             +GR LFYWF EA+ DP SKPLVLWLNGGPGCSSIA+G +EE+GPFH+  DGKTL+ NPY
Sbjct  62   NAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEIGPFHINPDGKTLHPNPY  121

Query  466  SWN  474
            SWN
Sbjct  122  SWN  124



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +1

Query  190  VDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNG  369
            + Q++ D V  LPG  FNVSFA YSG+VT N++ GRALFYW FEAV D  SKPLVLWLNG
Sbjct  30   LSQKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFYWLFEAVEDAKSKPLVLWLNG  89

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN
Sbjct  90   GPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWN  124



>gb|KJB78940.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
 gb|KJB78941.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=375

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = +1

Query  115  QSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESG  294
            QS     LFVLL   +      SSS   Q LD + +LPG   NV F QYSGYVTVN+E+G
Sbjct  3    QSRFIDFLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAG  58

Query  295  RALFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYS  468
            RALFYWF E+ ++  P ++PL+LWLNGGPGCSS+AYG AEE+GPF +  DGKTLY NPY+
Sbjct  59   RALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYA  118

Query  469  WN  474
            WN
Sbjct  119  WN  120



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   145 bits (365),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 88/122 (72%), Gaps = 6/122 (5%)
 Frame = +1

Query  115  QSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESG  294
            QS     LFVLL   +      SSS   Q LD + +LPG   NV F QYSGYVTVN+E+G
Sbjct  3    QSRFIDFLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAG  58

Query  295  RALFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYS  468
            RALFYWF E+ ++  P ++PL+LWLNGGPGCSS+AYG AEE+GPF +  DGKTLY+NPY+
Sbjct  59   RALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYA  118

Query  469  WN  474
            WN
Sbjct  119  WN  120



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   144 bits (364),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            S L+++LL +       +S ++ QK D +  LPG   NV FAQYSGYVTVN++SGR+LFY
Sbjct  6    SRLYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFY  65

Query  310  WFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W  EA V   P S+PLVLWLNGGPGCSSIAYG +EE+GPFH+  DGK+LY NPY+WN
Sbjct  66   WLVEAPVKRGPKSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWN  122



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   145 bits (365),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            +L+ +  LAT+     G S   Q++ D V  LPG  F+VSFA YSG+VT N++ GRALFY
Sbjct  32   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFDVSFAHYSGFVTTNEKLGRALFY  88

Query  310  WFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W FEAV D  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN
Sbjct  89   WLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWN  143



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   144 bits (364),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQ  285
            M+   W C  + +L++A   +  +   S  Q++ D V  LPG  F+V FA YSG+VT N+
Sbjct  1    MAKTRWFCFAIALLVIARFCNCEEAVLS--QKEQDRVSRLPGQDFDVDFAHYSGFVTTNE  58

Query  286  ESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
            + GRALFYWFFEA  D +SKPLVLWLNGGPGCSS+ +G AEE+GPFH++ DGKTLY N Y
Sbjct  59   KLGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQY  118

Query  466  SWN  474
            SWN
Sbjct  119  SWN  121



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   144 bits (364),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = +1

Query  112  AQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQES  291
            A++  C +  ++++A   +     S  DQ   D V +LPG  FNV+FA YSG+VT N++ 
Sbjct  16   AKTRSCFVYAIIVIAHLCNCEAVLSEKDQ---DKVWNLPGQNFNVNFAHYSGFVTTNEKM  72

Query  292  GRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSW  471
            GRALFYW FEA  DP+SKPLVLWLNGGPGCSS+ +G AEE+GPFH++ DGKTLY N +SW
Sbjct  73   GRALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSW  132

Query  472  N  474
            N
Sbjct  133  N  133



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   144 bits (364),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQ  285
            M+   W C  + +L++A   +  +   S  Q++ D V  LPG  F+V FA YSG+VT N+
Sbjct  1    MAKTRWFCFAIALLVIARFCNCEEAVLS--QKEQDRVSRLPGQDFDVDFAHYSGFVTTNE  58

Query  286  ESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
            + GRALFYWFFEA  D +SKPLVLWLNGGPGCSS+ +G AEE+GPFH++ DGKTLY N Y
Sbjct  59   KLGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQY  118

Query  466  SWN  474
            SWN
Sbjct  119  SWN  121



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   144 bits (362),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +1

Query  193  DQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGG  372
            ++Q  D V  +PG  FN SFAQY+GYVTV+++ G ALFYWFFEA  DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  373  PGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            PGCSSIA+GL EE+GPFHV  DGK ++ NPYSWN
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWN  125



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   144 bits (363),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = +1

Query  124  GCSLLFVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRA  300
            G S  F L+L  SI G    +S ++ QK D +  LPG   NV FAQYSGYVTVN++S RA
Sbjct  3    GYSSRFYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSERA  62

Query  301  LFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LFYW  EA V   P S+PLVLWLNGGPGCSSIAYG +EE+GPFH+  DG++LY NPY+WN
Sbjct  63   LFYWLVEAPVSRGPRSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGRSLYLNPYAWN  122



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   144 bits (364),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +1

Query  193  DQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGG  372
            ++Q  D V  +PG  FN SFAQY+GYVTV+++ G ALFYWFFEA  DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  373  PGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            PGCSSIA+GL EE+GPFHV  DGK ++ NPYSWN
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWN  125



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   144 bits (363),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQ  285
            M+  + G   + V LLA +      ++ + Q++ D V  LPG  FNV F  YSG+VT N+
Sbjct  1    MAKTTRGSCFVVVALLAIT-HLCICAALLSQKEQDKVSKLPGQNFNVDFTHYSGFVTTNE  59

Query  286  ESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
            + GRALFYWFFEA  D +SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N Y
Sbjct  60   KLGRALFYWFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQY  119

Query  466  SWN  474
            SWN
Sbjct  120  SWN  122



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   144 bits (364),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 78/112 (70%), Gaps = 19/112 (17%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNG--  369
            QQ+LD V  LPG  F VSF  YSGYV VN+ESGRALFYWFFEA  DP+SKP+VLWLNG  
Sbjct  38   QQRLDRVEKLPGQNFIVSFEHYSGYVRVNEESGRALFYWFFEAAEDPASKPIVLWLNGGL  97

Query  370  -----------------GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
                             GPGCSSIAYG AEE+GPFH++ D KTLY NPYSWN
Sbjct  98   PALLVFHLLCLVTMKSLGPGCSSIAYGEAEEIGPFHIKPDAKTLYLNPYSWN  149



>gb|KJB78942.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=422

 Score =   143 bits (361),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = +1

Query  115  QSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESG  294
            QS     LFVLL   +      SSS   Q LD + +LPG   NV F QYSGYVTVN+E+G
Sbjct  3    QSRFIDFLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAG  58

Query  295  RALFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYS  468
            RALFYWF E+ ++  P ++PL+LWLNGGPGCSS+AYG AEE+GPF +  DGKTLY NPY+
Sbjct  59   RALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYA  118

Query  469  WN  474
            WN
Sbjct  119  WN  120



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQ  285
            + AQ   C +  +L +A   +       + Q++ D V  LPG  FNV+FA YSG+VT N+
Sbjct  38   VQAQRRSCFVYAILAIAHLCNC---EPILSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNE  94

Query  286  ESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
            + GRALFYW FEA  DP+SKPLVLWLNGGPGCSS+ +G AEE+GPFH++ DGKTLY N +
Sbjct  95   KMGRALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQH  154

Query  466  SWN  474
            SWN
Sbjct  155  SWN  157



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 86/125 (69%), Gaps = 2/125 (2%)
 Frame = +1

Query  106  MSAQSWGC--SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTV  279
            M+   W C  + LF + +          S + +++ + V  LPG  FNV+FA YSG+VT 
Sbjct  1    MAKTRWSCFVNALFAIAVLAIAHFSNCESVLSEKEQNKVSKLPGQNFNVNFAHYSGFVTT  60

Query  280  NQESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWN  459
            N++ GRALFYW  EA  DP+SKPLVLWLNGGPGCSS+ +G AEE+GPFH++ DGKTLY N
Sbjct  61   NEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLN  120

Query  460  PYSWN  474
             YSWN
Sbjct  121  QYSWN  125



>gb|KJB78939.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=432

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = +1

Query  115  QSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESG  294
            QS     LFVLL   +      SSS   Q LD + +LPG   NV F QYSGYVTVN+E+G
Sbjct  3    QSRFIDFLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAG  58

Query  295  RALFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYS  468
            RALFYWF E+ ++  P ++PL+LWLNGGPGCSS+AYG AEE+GPF +  DGKTLY NPY+
Sbjct  59   RALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYA  118

Query  469  WN  474
            WN
Sbjct  119  WN  120



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = +1

Query  115  QSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESG  294
            QS     LFVLL   +      SSS   Q LD + +LPG   NV F QYSGYVTVN+E+G
Sbjct  3    QSRFIDFLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAG  58

Query  295  RALFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYS  468
            RALFYWF E+ ++  P ++PL+LWLNGGPGCSS+AYG AEE+GPF +  DGKTLY NPY+
Sbjct  59   RALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYA  118

Query  469  WN  474
            WN
Sbjct  119  WN  120



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQ  285
            M+   W C  L + LLA +       + + Q++ D V  LPG  F+V FA YSG+VT N+
Sbjct  1    MAKTRWSC--LAIALLAIARFCNCEEAVLCQKEQDRVSRLPGQDFDVDFAHYSGFVTTNE  58

Query  286  ESGRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
            + GRALFYW FEA  D +SKPLVLWLNGGPGCSS+ +G AEE+GPFH++ DGKTLY N Y
Sbjct  59   KLGRALFYWLFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQY  118

Query  466  SWN  474
            SWN
Sbjct  119  SWN  121



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            +Q+ D V  +PG  F+V FAQY+GYV V++E G +LFYWFFEA  DP+SKPLVLWLNGGP
Sbjct  43   EQERDRVARVPGQDFDVGFAQYAGYVAVSEERGASLFYWFFEAADDPASKPLVLWLNGGP  102

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GCSSIAYG+AEE+GPFHV  DG+ ++ NPYSWN
Sbjct  103  GCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWN  135



>ref|XP_006850617.1| PREDICTED: serine carboxypeptidase-like 27 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  127  CSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNV-SFAQYSGYVTVNQESGRAL  303
            C L+F+       +   G SS D Q+ D +++LPG   NV  F+QYSGYVTV+Q +GRAL
Sbjct  8    CGLMFLGFCLLIWEAEAGISSSDDQERDRIIELPGEPANVVDFSQYSGYVTVDQNAGRAL  67

Query  304  FYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            FYW  E+   PS +PLVLWLNGGPGCSS+AYG AEELGPFH+  DGK+L+ NPY+WN
Sbjct  68   FYWLTESPTRPSLRPLVLWLNGGPGCSSVAYGAAEELGPFHINPDGKSLFLNPYAWN  124



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +1

Query  127  CSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALF  306
            CS   +++ +        +  + +QKLD VL LPG  FN+SFA YSGY+TVN  +G+A F
Sbjct  29   CSKHHLIISSCLASSDIPADKIIEQKLDQVLKLPGQNFNLSFAHYSGYITVNASAGKAFF  88

Query  307  YWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            YWF E+  DPSSKPL LWLNGGP CSSIA+G AEE+GPF    DGK++Y NPY+WN
Sbjct  89   YWFVESAEDPSSKPLALWLNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNPYAWN  144



>gb|EMS63096.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Triticum urartu]
Length=357

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 87/143 (61%), Gaps = 45/143 (31%)
 Frame = -1

Query  1222  FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFHVNILFMILPLAMRLYNRPCFLAFVY  1043
             FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVF++NI+FM+LPLA+RL +RPCFLAFVY
Sbjct  225   FILTVKDLSPNIGVLWYFFAEVFDFFRSFFLIVFNMNIIFMVLPLAIRLKHRPCFLAFVY  284

Query  1042  MAICSMLKSYPSVGDSALYLGLLALFINELSEMPFSFFLFCGYVGVSLLSPVMHNLWIWR  863
              AI +MLKSYPS                                               +
Sbjct  285   TAIVAMLKSYPSCS---------------------------------------------Q  299

Query  862   GTGNANFYFATAMGYACFQGEVV  794
             GTGNANFYFAT + Y C Q  +V
Sbjct  300   GTGNANFYFATGLAYTCLQTVLV  322



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   142 bits (358),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +1

Query  190  VDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNG  369
            + +++ D V  LPG  FNV+FAQYSG+VT N++ GRALFYW  EA  DP+SKPLVLWLNG
Sbjct  31   LSEKEQDKVSKLPGQNFNVNFAQYSGFVTTNEKLGRALFYWLIEAAEDPASKPLVLWLNG  90

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSS+ +G AEE+GPFH++ DGKTLY N YSWN
Sbjct  91   GPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYSWN  125



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   142 bits (357),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            +Q+ D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GCSSIA+G+ EE+GPFHV  DGK ++ NPYSWN
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWN  120



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   142 bits (357),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 2/100 (2%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVD--PSSKPLV  354
            SS +  Q+ D ++ LPG   NV F+QYSGYVTVNQ++GRALFYW  EA  +  P S+PLV
Sbjct  23   SSPLQDQERDRIIQLPGQPNNVGFSQYSGYVTVNQQAGRALFYWLVEAPANRRPESRPLV  82

Query  355  LWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LWLNGGPGCSS+AYG AEE+GPFH+  DGKTL+ NPY+WN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRSDGKTLFLNPYAWN  122



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   142 bits (357),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGGP  375
            +Q+ D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  376  GCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GCSSIA+G+ EE+GPFHV  DGK ++ NPYSWN
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWN  120



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   141 bits (356),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            SL +V+ L+    G   S S  +Q+ D +  LPG   NV F+QYSGYVTVNQ++GRALFY
Sbjct  4    SLCYVIFLSFLFVGSCYSFSNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFY  63

Query  310  WFFEAV--VDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W  E+    +P  +PLVLWLNGGPGCSS+AYG AEE+GPFH+  DGKTLY NPYSWN
Sbjct  64   WLIESPSNRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWN  120



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   141 bits (356),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +1

Query  190  VDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNG  369
            + Q++ D V  LPG  FNV+FA YSG+VT N++ GRALFYW FEA  DP+ KPLVLWLNG
Sbjct  26   LSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDPAYKPLVLWLNG  85

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSS+ +G AEE+GPFH++ DGKTLY N +SWN
Sbjct  86   GPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWN  120



>ref|XP_002315293.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
 gb|EEF01464.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
Length=469

 Score =   141 bits (356),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 91/130 (70%), Gaps = 5/130 (4%)
 Frame = +1

Query  100  LEMSAQSWGCSLLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGY  270
            + M  ++   SLL+VL LAT   S         +++Q+ D ++ L G   NVSF+Q+SGY
Sbjct  1    MAMHIRTSSRSLLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGY  60

Query  271  VTVNQESGRALFYWFFEA--VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGK  444
            +TV+  +GRALFYW  EA  +V P SKPLVLWLNGGPGCSS+AYG +EE+GPF V  DGK
Sbjct  61   ITVDPLAGRALFYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGK  120

Query  445  TLYWNPYSWN  474
            TL+ NPY+WN
Sbjct  121  TLHLNPYAWN  130



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   141 bits (356),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  184  SSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWL  363
            S + +++ D V  LPG  FNV+FA YSG+VT N++ GRALFYW  EA  DP+SKPLVLWL
Sbjct  29   SVLSEKEQDKVSKLPGQNFNVNFAHYSGFVTTNEKLGRALFYWLIEAAEDPASKPLVLWL  88

Query  364  NGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            NGGPGCSS+ +G AEE+GPFH++ DGKTLY N YSWN
Sbjct  89   NGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYSWN  125



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   141 bits (356),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            S L+++LL +       +S ++ QK D +  LPG   NV FAQYSGYVTVN++SGR+LFY
Sbjct  5    SRLYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFY  64

Query  310  WFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W  EA V   P S+ LVLWLNGGPGCSSIAYG +EE+GPFH+  DGK+LY NPY+WN
Sbjct  65   WLVEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWN  121



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            S L+++LL +       +S ++ QK D +  LPG   NV FAQYSGYVTVN++SGR+LFY
Sbjct  6    SRLYLVLLLSICGVVSLASPIEDQKKDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFY  65

Query  310  WFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W  EA V   P S+ LVLWLNGGPGCSSIAYG +EE+GPFH+  DGK+LY NPY+WN
Sbjct  66   WLVEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWN  122



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  190  VDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNG  369
            + Q+  D V  LPG  FNV FA YSG+VT N++ GRALFYW FEA  D  SKPLVLWLNG
Sbjct  31   LSQKAQDKVSILPGQNFNVDFAHYSGFVTTNEKLGRALFYWLFEATEDAESKPLVLWLNG  90

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN
Sbjct  91   GPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWN  125



>ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis]
Length=385

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 5/121 (4%)
 Frame = +1

Query  127  CSLLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGR  297
            CS L  L  AT   S    +  S+ ++Q+ D ++ LPG   NV F+QYSGYVTV+  +GR
Sbjct  10   CSFLLALSFATLLLSTISARLISNKEEQERDRIIKLPGQPPNVYFSQYSGYVTVDPLAGR  69

Query  298  ALFYWFFEA--VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSW  471
            ALFYW  EA  +  P SKPLVLWLNGGPGCSS+AYG +EE+GPF V  DGKTLY NPY+W
Sbjct  70   ALFYWLIEAPKMARPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLYLNPYTW  129

Query  472  N  474
            N
Sbjct  130  N  130



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            SL +V+ L+    G   S    +Q+ D +  LPG   NV F+QYSGYVTVNQ++GRALFY
Sbjct  4    SLCYVMFLSFLFVGSCYSFYNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFY  63

Query  310  WFFEA--VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W  E+    +P  +PLVLWLNGGPGCSS+AYG AEE+GPFH+  DGKTLY NPYSWN
Sbjct  64   WLIESPSTRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWN  120



>gb|KDO48446.1| hypothetical protein CISIN_1g016137mg [Citrus sinensis]
Length=394

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            SLL VL LA  +     S+   +Q+ D ++ LPG   NV+F+QYSGY+TV++++GRALFY
Sbjct  11   SLLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFY  70

Query  310  WFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W  EA VD  P+SKPLVLWLNGGPGCSS+AYG +EE+GPF V +DGK L  NPY+WN
Sbjct  71   WLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWN  127



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLL-LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAQYSGYVTV  279
            M+   W   L  V++ LA        +    QQ  D +   LPG  FN+SF  YSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  280  NQESGRALFYWFFEA-VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYW  456
            N++ GR LFYWF +A  VDP+SKPL+LW NGGPGCSSIAYG AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  457  NPYSWN  474
            NPYSWN
Sbjct  121  NPYSWN  126



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLL-LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAQYSGYVTV  279
            M+   W   L  V++ LA        +    QQ  D +   LPG  FN+SF  YSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  280  NQESGRALFYWFFEA-VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYW  456
            N++ GR LFYWF +A  VDP+SKPL+LW NGGPGCSSIAYG AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  457  NPYSWN  474
            NPYSWN
Sbjct  121  NPYSWN  126



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  193  DQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLWLNGG  372
            ++Q  D V  +PG  F+ S+A Y+GYVTV++  G ALFYWFFEA  DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFDTSYAHYAGYVTVSEPRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  373  PGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            PGCSSIAYGL EE+GPFHV  DGK ++ NPYSWN
Sbjct  92   PGCSSIAYGLGEEVGPFHVNADGKGVHVNPYSWN  125



>ref|XP_006436272.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
 ref|XP_006485877.1| PREDICTED: serine carboxypeptidase-like 28-like [Citrus sinensis]
 gb|ESR49512.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
Length=468

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            SLL VL LA  +     S+   +Q+ D ++ LPG   NV+F+QYSGY+TV++++GRALFY
Sbjct  11   SLLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFY  70

Query  310  WFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W  EA VD  P+SKPLVLWLNGGPGCSS+AYG +EE+GPF V +DGK L  NPY+WN
Sbjct  71   WLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWN  127



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            S  ++ LL + +    GS + +Q++ D +  LPG   NV FAQYSGYVTV++++GRALFY
Sbjct  4    SFFYLCLLLSLVAISYGSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFY  62

Query  310  WFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            W  E      P+S+PLVLWLNGGPGCSS+AYG AEE+GPFH++ DG+TLY NPY+WN
Sbjct  63   WLTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWN  119



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 3/118 (3%)
 Frame = +1

Query  127  CSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALF  306
            CS   V LL  SI  G   +S ++Q+ D +  LPG   NV FA YSGYVTVN+E+GRALF
Sbjct  3    CSQFSVFLL-LSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALF  61

Query  307  YWFFE--AVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            YW  E  A ++PSS+PLVLWLNGGPGCSSI YG AEE+GPF +  DG +LY NPY+WN
Sbjct  62   YWLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWN  119



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 3/118 (3%)
 Frame = +1

Query  127  CSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALF  306
            CS   V LL  SI  G   +S ++Q+ D +  LPG   NV FA YSGYVTVN+E+GRALF
Sbjct  3    CSQFSVFLL-LSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALF  61

Query  307  YWFFE--AVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            YW  E  A ++PSS+PLVLWLNGGPGCSSI YG AEE+GPF +  DG +LY NPY+WN
Sbjct  62   YWLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWN  119



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   139 bits (350),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +1

Query  184  SSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVD--PSSKPLVL  357
            S ++ Q+ D +  LPG   NV F QYSGYVTVNQ++GRALFYW  EA     P S+PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPESRPLVL  82

Query  358  WLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            WLNGGPGCSS+AYG AEE+GPF +  DGKTLY+NPY+WN
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWN  121



>ref|XP_011040962.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=468

 Score =   139 bits (350),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 90/130 (69%), Gaps = 5/130 (4%)
 Frame = +1

Query  100  LEMSAQSWGCSLLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGY  270
            + M  ++   SLL+VL LAT   S         +++Q+ D ++ L G   NVSF+Q+SGY
Sbjct  1    MAMHIRTSSRSLLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLHGQPPNVSFSQFSGY  60

Query  271  VTVNQESGRALFYWFFEA--VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGK  444
            +TV+  +GRALFYW  E   +V P SKPL+LWLNGGPGCSS+AYG +EE+GPF V  DGK
Sbjct  61   ITVDPLAGRALFYWLIEVPKIVKPKSKPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGK  120

Query  445  TLYWNPYSWN  474
            TL+ NPY+WN
Sbjct  121  TLHLNPYAWN  130



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   139 bits (350),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 2/100 (2%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVD--PSSKPLV  354
            +S ++ QK D + +LPG   NVSF+QYSGYVTVN++ GRALFYW  E+ V+  P ++PLV
Sbjct  21   ASYLEDQKRDRIRELPGQPRNVSFSQYSGYVTVNEQRGRALFYWLTESPVNRVPKARPLV  80

Query  355  LWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LWLNGGPGCSS+AYG AEE+GPF +  DGK+LY NPY+WN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKSLYLNPYAWN  120



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = +1

Query  130  SLLFVLLLATSIDGGKGSSSVDQ-QKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALF  306
            +L FV++L   +  G   S ++Q Q+ D +  LPG   NV F QYSGYVTVN+++GRALF
Sbjct  7    TLFFVVVLPLFLLFGTCYSRINQDQERDRIKSLPGQPANVDFDQYSGYVTVNKKAGRALF  66

Query  307  YWFFE--AVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            YWF E  A   P S+PL+LWLNGGPGCSS+AYG  EE+GPF V+ DGKTL++NPYSWN
Sbjct  67   YWFIESPASRAPESRPLLLWLNGGPGCSSVAYGATEEIGPFRVKPDGKTLFFNPYSWN  124



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 4/121 (3%)
 Frame = +1

Query  124  GCSLLFVLLLATSIDG--GKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGR  297
            G SLL VL     + G     +S +  Q+ D + +LPG   NV FAQYSGYVTV+Q++GR
Sbjct  2    GSSLLRVLGFVFLLLGYCSSSTSPLQDQERDKITELPGQPTNVGFAQYSGYVTVDQQAGR  61

Query  298  ALFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSW  471
            ALFYW  EA     P S+PLVLWLNGGPGCSS+AYG AEE+GPF +  DGKTL++NPY+W
Sbjct  62   ALFYWLTEAPASRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIHPDGKTLFFNPYAW  121

Query  472  N  474
            N
Sbjct  122  N  122



>gb|KJB76564.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=333

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 83/122 (68%), Gaps = 10/122 (8%)
 Frame = +1

Query  115  QSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESG  294
            +S      F+LL+ ++  G         Q LD + +LPG   NV F QYSGYVTVNQ++G
Sbjct  3    ESRSIGFFFLLLIFSTCFG--------DQTLDKITELPGQPKNVGFNQYSGYVTVNQQAG  54

Query  295  RALFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYS  468
            RALFYW  E+ V   P S+PLVLWLNGGPGCSSIAYG AEE+GPF +  DGKTLY N Y+
Sbjct  55   RALFYWLIESPVSRKPESRPLVLWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYA  114

Query  469  WN  474
            WN
Sbjct  115  WN  116



>ref|XP_011031766.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=466

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 87/128 (68%), Gaps = 5/128 (4%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVT  276
            M  +S  C L  VL  AT   S         +++Q+ D ++ LPG   NVSF+Q+SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFATLLLSTPAVTNHDHLEEQRRDRIIKLPGQPPNVSFSQFSGYIT  60

Query  277  VNQESGRALFYWFFEA--VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTL  450
            V+   GRALFYW  EA  +V P SKPLVLWLNGGPGCSS+AYG +EE+GPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLNEAPKIVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  451  YWNPYSWN  474
            + NPY+WN
Sbjct  121  HLNPYAWN  128



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +1

Query  184  SSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVD--PSSKPLVL  357
            S ++ Q+ D +  LPG   NV F QYSGYVTVNQ++GRALFYW  EA     P ++PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPEARPLVL  82

Query  358  WLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            WLNGGPGCSS+AYG AEE+GPF +  DGKTLY+NPY+WN
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWN  121



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   138 bits (348),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  112  AQSWGCSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQES  291
             QS  C++  +L L + +  G   S++DQ++ D +  LPG   NV F QYSGY+TVNQ+S
Sbjct  5    VQSILCAIC-ILWLNSFVGIGYSLSNLDQER-DRITYLPGQPQNVGFNQYSGYITVNQQS  62

Query  292  GRALFYWFFEAVV--DPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPY  465
            GRALFYW  EA     P S+PLVLWLNGGPGCSS+AYG AEE+GPF +  DGKTLY NPY
Sbjct  63   GRALFYWLTEAPAYRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYLNPY  122

Query  466  SWN  474
            SWN
Sbjct  123  SWN  125



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   138 bits (348),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 90/129 (70%), Gaps = 8/129 (6%)
 Frame = +1

Query  106  MSAQSWGCSLLFVLLLAT----SIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAQYSGY  270
            M+   W  S +F + LAT    + +    +    QQ+ D +   LPG  FN+SF  YSGY
Sbjct  1    MANSEW--SQIFAITLATIFLCNNNFTFATDPFVQQEHDRIDRPLPGQNFNISFEHYSGY  58

Query  271  VTVNQESGRALFYWFFEA-VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKT  447
            +TVN+++GR LFYWF +A  VDP+SKPL+LWLNGGPGCSSIAYG AEE+GPFH+  DGK 
Sbjct  59   ITVNEDAGRNLFYWFIQADHVDPTSKPLLLWLNGGPGCSSIAYGEAEEIGPFHINSDGKN  118

Query  448  LYWNPYSWN  474
            L++NPY WN
Sbjct  119  LHFNPYYWN  127



>gb|KJB76565.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=342

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVV--DPSSKPLV  354
            S+    Q LD + +LPG   NV F QYSGYVTVNQ++GRALFYW  E+ V   P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  355  LWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LWLNGGPGCSSIAYG AEE+GPF +  DGKTLY N Y+WN
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWN  116



>ref|XP_012086498.1| PREDICTED: serine carboxypeptidase-like 27 [Jatropha curcas]
 gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 2/100 (2%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFE--AVVDPSSKPLV  354
            SS+++ Q+ D +  LPG   NV F QYSGYVTVNQ++GRALFYW  E  A   P S+PLV
Sbjct  21   SSTLEDQERDKITYLPGQPTNVEFNQYSGYVTVNQQAGRALFYWLIESPASRGPESRPLV  80

Query  355  LWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LWLNGGPGCSS+AYG AEE+GPF ++ DGKTL++NPY+WN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIKPDGKTLFFNPYAWN  120



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 85/118 (72%), Gaps = 5/118 (4%)
 Frame = +1

Query  127  CSLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALF  306
            C +LF+ +    I     +SS+ +QK D +  LPG    V F QYSGYVTVN+ESGRALF
Sbjct  7    CVVLFLTIFCVGI---SLASSIKEQKRDKIKWLPGQPKIVGFEQYSGYVTVNEESGRALF  63

Query  307  YWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            YW  EA +   P+SKPLVLWLNGGPGCSSIAYG +EE+GPF +  DGK+LY NPY+WN
Sbjct  64   YWLTEAPLSHGPNSKPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLYLNPYAWN  121



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLW  360
            S+++  Q  D +  LPG   N +FAQYSGYVTV++ +GR LFYW  E+  +P +KPLVLW
Sbjct  20   SAAIANQNNDRITWLPGQPENTNFAQYSGYVTVDKSAGRTLFYWLTESPSNPETKPLVLW  79

Query  361  LNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LNGGPGCSSIAYG AEE+GPFH++ DGKTL+ NPYSWN
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNPYSWN  117



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFE--AVVDPSSKPLV  354
            +SS+  Q  D +  LPG   NV F QYSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  355  LWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LWLNGGPGCSS+AYG AEE+GPFH+  DGKTLY NPY+WN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWN  122



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = +1

Query  124  GCSLLFVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRA  300
            G S+ +++L  +    G   +SS++ QK D +  LPG   NV F QYSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  301  LFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LFYW  EA ++  P+S+PLVLWLNGGPGCSSIAYG +EE+GPF +  DGK+L+ N Y+WN
Sbjct  62   LFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAWN  121



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = +1

Query  124  GCSLLFVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRA  300
            G S+ +++L  +    G   +SS++ QK D +  LPG   NV F QYSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  301  LFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LFYW  EA ++  P+S+PLVLWLNGGPGCSSIAYG +EE+GPF +  DGK+L+ N Y+WN
Sbjct  62   LFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAWN  121



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = +1

Query  124  GCSLLFVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRA  300
            G S+ +++L  +    G   +SS++ QK D +  LPG   NV F QYSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  301  LFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LFYW  EA ++  P+S+PLVLWLNGGPGCSSIAYG +EE+GPF +  DGK+L+ N Y+WN
Sbjct  62   LFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAWN  121



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLW  360
            SS  D Q+ D +  LPG   +VSF+ YSGYVTVN+ +GRALFYW  E+   P SKPLVLW
Sbjct  18   SSCRDAQEKDRISRLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSQHPESKPLVLW  77

Query  361  LNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LNGGPGCSS+AYG AEE+GPF +  DGKTLY NPY+WN
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWN  115



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = +1

Query  124  GCSLLFVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRA  300
            G S+ +++L  +    G   +SS++ QK D +  LPG   NV F QYSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  301  LFYWFFEAVVD--PSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LFYW  EA ++  P+S+PLVLWLNGGPGCSSIAYG +EE+GPF +  DGK+L+ N Y+WN
Sbjct  62   LFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAWN  121



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +1

Query  196  QQKLDAV-LDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEA-VVDPSSKPLVLWLNG  369
            QQ+ D +   LPG  FN++F  YSGY+TVN++ GR LFYWF EA  +DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSSIAYG AEE+GPFH+  DG TL+ NPYSWN
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWN  128



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +1

Query  196  QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVV--DPSSKPLVLWLNG  369
            +Q  D +  LPG   NV F QYSGYVTVN+++GRALFYW  E+ V  +P  +PL+LWLNG
Sbjct  26   EQLRDKITYLPGQPANVQFNQYSGYVTVNEQAGRALFYWLIESPVSRNPEKRPLILWLNG  85

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSS+AYG AEE+GPFH++ DGKTLY NPYSWN
Sbjct  86   GPGCSSVAYGAAEEIGPFHIDSDGKTLYLNPYSWN  120



>dbj|BAK05698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = +1

Query  124  GCSL-LFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAQYSGYVTVNQES  291
            GC L L  LLL  ++ GG G+   +   QQ  D V  LPG    V FAQY+GYVTV++  
Sbjct  18   GCFLGLAFLLLCGAVRGGGGAPDAEAARQQAADRVGRLPGQP-AVKFAQYAGYVTVDEAH  76

Query  292  GRALFYWFFEAVVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSW  471
            GRALFYWFFEA    + KPLVLWLNGGPGCSSI YG AEELGPF V+K    L WNPYSW
Sbjct  77   GRALFYWFFEATAGAAKKPLVLWLNGGPGCSSIGYGEAEELGPFLVQKGKPELKWNPYSW  136

Query  472  N  474
            N
Sbjct  137  N  137



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +1

Query  181  SSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVDPSSKPLVLW  360
            SS  D Q+ D +  LPG   +VSF+ YSGYVTVN+ +GRALFYW  E+   P SKPLVLW
Sbjct  18   SSCRDSQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  361  LNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            LNGGPGCSS+AYG AEE+GPF +  DGKTLY NPY+WN
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWN  115



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   137 bits (346),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +1

Query  196  QQKLDAV-LDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEA-VVDPSSKPLVLWLNG  369
            QQ+ D +   LPG  FN++F  YSGY+TVN++ GR LFYWF EA  +DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSSIAYG AEE+GPFH+  DG TL+ NPYSWN
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWN  128



>ref|XP_002312023.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
 gb|EEE89390.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
Length=466

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = +1

Query  106  MSAQSWGCSLLFVL---LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVT  276
            M  +S  C L  VL   +L  S         +++Q+ D ++ LPG   NVSF+Q+SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFAILLLSTPAVTTHDHLEEQRRDRIMKLPGQPPNVSFSQFSGYIT  60

Query  277  VNQESGRALFYWFFEA--VVDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTL  450
            V+   GRALFYW  EA   V P SKPLVLWLNGGPGCSS+AYG +EE+GPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLIEAPKTVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  451  YWNPYSWN  474
            + NPY+WN
Sbjct  121  HLNPYAWN  128



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = +1

Query  133  LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYW  312
            L FV+ L+    G    S   +Q  D +  LPG   NV F QYSGYVTVN+++GRALFYW
Sbjct  5    LPFVICLSLLFLGSCYCSINVEQLRDKITYLPGQPANVEFNQYSGYVTVNEQAGRALFYW  64

Query  313  FFEAVV--DPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
              E+ +  +P  +PL+LWLNGGPGCSS+AYG AEE+GPFH+  DGKTLY NPYSWN
Sbjct  65   LIESPMSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHINSDGKTLYLNPYSWN  120



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = +1

Query  133  LLFVLLLATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAQYSGYVTVNQESGRALFY  309
            L+   L   SI     +    QQ  D +   LPG  FN++F  YSGY+TVN+++GR LFY
Sbjct  25   LILATLFLCSISFAIATDPFVQQGKDRIGRALPGQNFNINFEHYSGYITVNEDTGRNLFY  84

Query  310  WFFEAV-VDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            WF EA   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DG TLY NPYSWN
Sbjct  85   WFIEAEHQDPTSKPLLLWFNGGPGCSSIAFGEAEEIGPFHINPDGNTLYLNPYSWN  140



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +1

Query  178  GSSSVDQQKLDAVLDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEAVVD--PSSKPL  351
            GS + +Q++ D +  LPG   NV FAQYSGYVTV++++GRALFYW  E      P+S+PL
Sbjct  22   GSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYWLTETPTSRVPNSRPL  80

Query  352  VLWLNGGPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            VLWLNGGPGCSS+AYG AEE+GPFH++ DG+TLY NPY+WN
Sbjct  81   VLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWN  121



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +1

Query  196  QQKLDAV-LDLPGLGFNVSFAQYSGYVTVNQESGRALFYWFFEA-VVDPSSKPLVLWLNG  369
            QQ+ D +   LPG  FN+SF  YSGY+TVN+++GR LFYWF +A  VDP+S PL+LWLNG
Sbjct  33   QQEQDRIDRPLPGQNFNISFEHYSGYITVNEDAGRNLFYWFIQADHVDPTSMPLLLWLNG  92

Query  370  GPGCSSIAYGLAEELGPFHVEKDGKTLYWNPYSWN  474
            GPGCSSIA+G AEE+GPFH+  D KTLY NPYSWN
Sbjct  93   GPGCSSIAFGEAEEIGPFHINSDSKTLYLNPYSWN  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3434935870995