BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4895

Length=873
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010323258.1|  PREDICTED: uncharacterized protein LOC101249097    132   1e-30   Solanum lycopersicum
ref|XP_009769069.1|  PREDICTED: uncharacterized protein LOC104219993    129   2e-29   Nicotiana sylvestris
ref|XP_006359539.1|  PREDICTED: uncharacterized protein LOC102594159    127   3e-29   Solanum tuberosum [potatoes]
ref|XP_009595430.1|  PREDICTED: uncharacterized protein LOC104091732    121   5e-27   Nicotiana tomentosiformis
ref|XP_011084036.1|  PREDICTED: uncharacterized protein LOC105166393  90.9    8e-17   Sesamum indicum [beniseed]
emb|CDP10517.1|  unnamed protein product                              87.0    2e-15   Coffea canephora [robusta coffee]
ref|XP_002523543.1|  zinc finger protein, putative                    83.2    2e-14   Ricinus communis
ref|XP_012071430.1|  PREDICTED: uncharacterized protein LOC105633456  78.6    8e-13   Jatropha curcas
ref|XP_007013704.1|  Zinc finger protein, putative isoform 1          77.4    2e-12   
ref|XP_010265699.1|  PREDICTED: uncharacterized protein LOC104603377  75.1    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_008443896.1|  PREDICTED: uncharacterized protein LOC103487...  73.2    5e-11   Cucumis melo [Oriental melon]
ref|XP_008443898.1|  PREDICTED: uncharacterized protein LOC103487...  72.8    5e-11   Cucumis melo [Oriental melon]
gb|KCW82688.1|  hypothetical protein EUGRSUZ_C04065                   71.2    2e-10   Eucalyptus grandis [rose gum]
ref|XP_011655819.1|  PREDICTED: uncharacterized protein LOC101215...  71.2    2e-10   Cucumis sativus [cucumbers]
gb|KDO59352.1|  hypothetical protein CISIN_1g043289mg                 71.2    2e-10   Citrus sinensis [apfelsine]
ref|XP_006453696.1|  hypothetical protein CICLE_v10007567mg           70.5    3e-10   Citrus clementina [clementine]
ref|XP_004146703.1|  PREDICTED: uncharacterized protein LOC101215...  66.6    6e-09   Cucumis sativus [cucumbers]
ref|XP_010542083.1|  PREDICTED: uncharacterized protein LOC104815398  65.5    1e-08   Tarenaya hassleriana [spider flower]
gb|KJB64581.1|  hypothetical protein B456_010G054900                  64.7    3e-08   Gossypium raimondii
ref|XP_011017950.1|  PREDICTED: uncharacterized protein LOC105121122  63.9    5e-08   Populus euphratica
ref|XP_011033482.1|  PREDICTED: uncharacterized protein LOC105131955  63.9    5e-08   Populus euphratica
ref|XP_008242893.1|  PREDICTED: uncharacterized protein LOC103341193  61.6    3e-07   Prunus mume [ume]
gb|KGN65218.1|  hypothetical protein Csa_1G266150                     60.8    6e-07   Cucumis sativus [cucumbers]
ref|XP_007203786.1|  hypothetical protein PRUPE_ppa001771mg           60.5    8e-07   Prunus persica
ref|XP_010244790.1|  PREDICTED: uncharacterized protein LOC104588524  59.7    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006381900.1|  hypothetical protein POPTR_0006s20380g           58.9    2e-06   
ref|XP_010687767.1|  PREDICTED: uncharacterized protein LOC104901840  59.3    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002325162.2|  D111/G-patch domain-containing family protein    58.2    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009338424.1|  PREDICTED: uncharacterized protein LOC103930775  55.1    4e-05   
ref|XP_004287228.1|  PREDICTED: uncharacterized protein LOC101294206  55.1    5e-05   Fragaria vesca subsp. vesca
ref|XP_007013705.1|  Zinc finger protein, putative isoform 2          53.9    9e-05   
ref|XP_010109666.1|  Zinc finger CCCH-type with G patch domain-co...  52.8    2e-04   



>ref|XP_010323258.1| PREDICTED: uncharacterized protein LOC101249097 [Solanum lycopersicum]
Length=789

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 121/193 (63%), Gaps = 11/193 (6%)
 Frame = +1

Query  298  AYSGRALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrs  477
            +YSGR LFVEGG+LS+W  F+S P R             +        A  SSS + S S
Sbjct  21   SYSGRGLFVEGGVLSDWGDFNSPPSRRNLKGEYGNGNGNS----RNRNAAVSSSMNASSS  76

Query  478  rsesKQTRGNAIAYMYPS-DGVQDGLASES--SGEVKDVKSVGMHPIVLLGSKESKIVAY  648
            ++E K++RG+ I Y+YPS D V   + S++  SG VKDVK    HPI+L+ +KE++I+A+
Sbjct  77   KTELKKSRGSEIRYVYPSADSV---IRSDAVCSGGVKDVKLDSEHPILLVDTKETQIIAF  133

Query  649  IDEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNE  828
            +DEG NKEPQN   +YD +T  +L    + +  E++   DYS GFS+DE++HRGLGFY E
Sbjct  134  VDEGPNKEPQNQGCIYDCTTPLSLDVGQNKDSNEVDYAGDYSAGFSLDESSHRGLGFYEE  193

Query  829  AEAMH-GIGSSSK  864
            AE  H G+G S K
Sbjct  194  AEITHGGVGLSPK  206



>ref|XP_009769069.1| PREDICTED: uncharacterized protein LOC104219993 [Nicotiana sylvestris]
Length=787

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 129/191 (68%), Gaps = 10/191 (5%)
 Frame = +1

Query  298  AYSGRALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrs  477
            +YSGR LFVEGG+LS+W  ++S P R +NL+ GNG+ SR      +N    SSS + S S
Sbjct  21   SYSGRGLFVEGGVLSDWAVYNSPPSRGRNLKSGNGSNSR-----DRNNTAVSSSKNASSS  75

Query  478  rsesKQTRGNAIAYMYPS-DGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYID  654
            +SESK++RGN I Y+YPS D V D + SE    VKD K     PI+L+ +KE++IVA+ID
Sbjct  76   KSESKKSRGNEIRYIYPSADSVIDAVHSEG---VKDDKLDREQPILLVDTKETQIVAFID  132

Query  655  EGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
            EG NKEPQN   +YD +T  +L      + +E++   DYS GFS+DE++HRGLGFY++AE
Sbjct  133  EGPNKEPQNEGCIYDCTTPLSLDVGQIKDSREVDYAGDYSAGFSMDESSHRGLGFYDDAE  192

Query  835  AMH-GIGSSSK  864
                G+G SSK
Sbjct  193  TTQEGVGLSSK  203



>ref|XP_006359539.1| PREDICTED: uncharacterized protein LOC102594159 [Solanum tuberosum]
Length=790

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 113/193 (59%), Gaps = 23/193 (12%)
 Frame = +1

Query  298  AYSGRALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrs  477
            +YSGR LFVEGG+LS+W  F+S P R +N             + S+N + N +S + + +
Sbjct  21   SYSGRGLFVEGGVLSDWGDFNSPPSRGRN-------------LKSENGSGNGNSRNRNAA  67

Query  478  rsesKQT----------RGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSK  627
             S SK            RG+ I Y+YPS        +  SG VKD K    HPI+L+ +K
Sbjct  68   VSSSKNASSSKSELKKSRGSEIRYVYPSANSVVRSDAVCSGGVKDDKLDWEHPILLVDTK  127

Query  628  ESKIVAYIDEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHR  807
            E++IVA++DEG NKEPQN   +YD +T  +L    + +  E++   DYS GFS+DE++HR
Sbjct  128  ETQIVAFVDEGQNKEPQNQGCIYDCTTPLSLDVGQNKDSHEVDYAGDYSAGFSLDESSHR  187

Query  808  GLGFYNEAEAMHG  846
            GLGFY EAE  HG
Sbjct  188  GLGFYEEAEITHG  200



>ref|XP_009595430.1| PREDICTED: uncharacterized protein LOC104091732 [Nicotiana tomentosiformis]
Length=786

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 127/191 (66%), Gaps = 8/191 (4%)
 Frame = +1

Query  298  AYSGRALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrs  477
            +YSGR LFVEGG+LS+W  ++S P R +NL+ GNG  SR      +N    SSS + S S
Sbjct  21   SYSGRGLFVEGGVLSDWAVYNSPPSRGRNLKSGNGGNSR-----DRNNTAVSSSKNASSS  75

Query  478  rsesKQTRGNAIAYMYPS-DGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYID  654
            +SESK++RGN I Y+YPS D V    A  S+G V+D K     PI+L+ +KE++IVA+ID
Sbjct  76   KSESKKSRGNEIRYVYPSADSVSCSDAVRSAG-VEDNKLDLEQPILLVDTKETQIVAFID  134

Query  655  EGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
            E  NKEPQN    YD +T  +L    + + +E++   DYS GFS+DE++HRGLGF+++AE
Sbjct  135  EDPNKEPQNEGCTYDCTTPLSLDVEQNKDSREVDYAGDYSAGFSMDESSHRGLGFFDDAE  194

Query  835  AMH-GIGSSSK  864
                G+G SSK
Sbjct  195  TTQEGVGLSSK  205



>ref|XP_011084036.1| PREDICTED: uncharacterized protein LOC105166393 [Sesamum indicum]
Length=762

 Score = 90.9 bits (224),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 104/189 (55%), Gaps = 31/189 (16%)
 Frame = +1

Query  310  RALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrses  489
            RALFVEGG+LS+W  F S P R +    G    SR+ A   K    +S SGS S  RS++
Sbjct  22   RALFVEGGLLSDWSAFSSPPSRGRKHNNGGSRDSRSGA--GKGTNYDSKSGSVSGQRSDT  79

Query  490  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  669
             ++RGNAI Y+YP +      A    GE  +   V   P+VL+ S+++ +VAYIDE    
Sbjct  80   YKSRGNAICYLYPQEN-----APIDEGENCENNLVVSEPVVLVDSEKTPMVAYIDE----  130

Query  670  EPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAMHG-  846
            EP N                   E + +E +YDY+T   +DE++HRGLGFY+E EA    
Sbjct  131  EPCN-------------------ESRNVEYIYDYTTSLMLDESSHRGLGFYDEVEASPDV  171

Query  847  IGSSSKADD  873
            IGSSSK ++
Sbjct  172  IGSSSKMEE  180



>emb|CDP10517.1| unnamed protein product [Coffea canephora]
Length=770

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 111/196 (57%), Gaps = 32/196 (16%)
 Frame = +1

Query  307  GRALFVEGGILSEWQRFDSTPD-REKn----lrggngngsrnPAIGSKNAAPNsssgsgs  471
            G+ALFVEGG+L++W    ++   REKN          +   +   G K     S S SGS
Sbjct  28   GQALFVEGGVLADWSSSFNSSPSREKNLNGGNGVSGSSKRSSNGKGRKGLNSGSGSVSGS  87

Query  472  rsrsesKQTRGNAIAYMYPSDGVQDGLASESSG-EVKDVKSVGMHPIVLLGSKESKIVAY  648
             SRSES +TRG+AI Y+YPS   Q+G  S ++G E ++ K     PIVL+ S+++ IVAY
Sbjct  88   GSRSESSKTRGHAIGYVYPSLDAQEG--SFANGYEERESKLKNSCPIVLVDSEDTPIVAY  145

Query  649  IDEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNE  828
            IDEG +K  Q           C+            E  YDY+ GF++DE++HRGLGF+NE
Sbjct  146  IDEGPSKHIQ-----------CS------------EYNYDYTMGFTLDESSHRGLGFHNE  182

Query  829  A-EAMHGIGSSSKADD  873
            A E   GIG S+ A++
Sbjct  183  AEETTAGIGMSANAEE  198



>ref|XP_002523543.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38882.1| zinc finger protein, putative [Ricinus communis]
Length=775

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 95/191 (50%), Gaps = 46/191 (24%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrses-  489
            +LFVEGG+LS+W    S P                 +   +N+  N  S S S++ S S 
Sbjct  46   SLFVEGGVLSDWNLSSSCP----------------ASFQGRNSNANFKSASKSKAASSSK  89

Query  490  ---KQTRGNAIAYMYPSDGVQDGLASESS--GEVKDVKSVGMHPIVLLGSKESKIVAYID  654
               +++ GNA  Y YP+  +QDGL +E S  G  +D       PIVL+ SKE++IVAY+D
Sbjct  90   SGPRKSNGNAFGYSYPTVEIQDGLHNELSVKGNGRDYDLDVSQPIVLVDSKETQIVAYLD  149

Query  655  EGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
              +  +P N                       ++C YDY + F +D + HRGLGF++E+E
Sbjct  150  NTTPLKPNN-----------------------VDCTYDYDSSFVLDGSVHRGLGFHDESE  186

Query  835  AM-HGIGSSSK  864
                 IGSSSK
Sbjct  187  TNPDAIGSSSK  197



>ref|XP_012071430.1| PREDICTED: uncharacterized protein LOC105633456 [Jatropha curcas]
 gb|KDP38622.1| hypothetical protein JCGZ_03975 [Jatropha curcas]
Length=756

 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 93/187 (50%), Gaps = 40/187 (21%)
 Frame = +1

Query  316  LFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSK-NAAPNsssgsgsrsrsesK  492
            LFVEGG+LS+W    S P             S  P   S  N+   S + + S S+   +
Sbjct  50   LFVEGGVLSDWPLSSSCP-------------SSFPGRNSNTNSKSGSKAKTVSASKIGHR  96

Query  493  QTRGNAIAYMYPSDGVQDGLASESS--GEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSN  666
            ++ GNA  Y YPS  +Q+ L  ESS  G  +D     + PI L+ SK+++IVAY+DE  +
Sbjct  97   KSNGNAFGYNYPSLELQERLLKESSIGGNDQDNDLDALQPITLVDSKDTQIVAYLDETPS  156

Query  667  KEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAMHG  846
             +  N +  YDY+++  LG                       +++HRGLGF++E E   G
Sbjct  157  LKASNADFTYDYNSSFVLG-----------------------DSSHRGLGFFDECETTPG  193

Query  847  -IGSSSK  864
             +G+SSK
Sbjct  194  AVGTSSK  200



>ref|XP_007013704.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY31323.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=765

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 95/187 (51%), Gaps = 44/187 (24%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesK  492
            +LFVEGG+LS+WQ  DS             N  R  A  SKN +              S+
Sbjct  40   SLFVEGGLLSDWQ-LDSRGRNRNENSNLGSNSDRAKASASKNGS--------------SR  84

Query  493  QTRGNAIAYMYPSDGVQDGLAS--ESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSN  666
            ++ G+AI Y YPS  +QD  +   E +G+ K  +S   H +VL  SKE++IVAY+D+ + 
Sbjct  85   KSGGSAIRYEYPSLNLQDPESGVHECNGDKKMDES---HTVVLFDSKETQIVAYMDQTTP  141

Query  667  KEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAM-H  843
             +P ++++ Y+Y + C LG                       +++HRGLGF +E+EA   
Sbjct  142  PKPHHVKYTYEYDSDCVLG-----------------------DSSHRGLGFGDESEANPS  178

Query  844  GIGSSSK  864
            GI SS+K
Sbjct  179  GIESSTK  185



>ref|XP_010265699.1| PREDICTED: uncharacterized protein LOC104603377 [Nelumbo nucifera]
Length=820

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 87/193 (45%), Gaps = 37/193 (19%)
 Frame = +1

Query  310  RALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrses  489
            RA FV+GG LSEWQ   S+P              + P    K+A+ +S       S S  
Sbjct  20   RAFFVDGGFLSEWQNDSSSP---------GSARGKTPRDNGKSASKSSKFDKPEASDSRD  70

Query  490  KQTR--GNAIAYMYPSDGVQDGLASESS--GEVKDVKSVGMHPIVLLGSKESKIVAYIDE  657
               R  GN+  Y YP   V+D +  ES   G VK        PI+LL SKE+++VAY+DE
Sbjct  71   GSRRPSGNSFGYEYPVVDVEDLMRLESGIDGNVKGGDVDESRPIILLDSKETQVVAYVDE  130

Query  658  GSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEA  837
                            T CT     D         Y+Y + F + E+ HRGLGF NE E 
Sbjct  131  ----------------TPCTKSCGGDY-------TYEYGSNFVLGESFHRGLGFVNEPEE  167

Query  838  M-HGIGSSSKADD  873
               GIGSSS  ++
Sbjct  168  TPTGIGSSSAKEE  180



>ref|XP_008443896.1| PREDICTED: uncharacterized protein LOC103487380 isoform X1 [Cucumis 
melo]
Length=800

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 85/178 (48%), Gaps = 39/178 (22%)
 Frame = +1

Query  316  LFVEGGILSEWQRFDSTP---DREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrse  486
            LFV+GG LS+WQ F  +P    RE N R    +GS++  +  K  A +S +         
Sbjct  35   LFVDGGFLSDWQ-FQLSPPISAREGNSRAKGKSGSKSATLDRKKIASSSGT---------  84

Query  487  sKQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSV--GMHPIVLLGSKESKIVAYIDEG  660
             KQ+ G AI Y YPS   Q+ L SES G   D +       P +LL SK ++IVAY+DE 
Sbjct  85   -KQSNGYAIGYEYPSAPNQEDLQSESRGLQNDAECSLDDSQPFILLNSKSNQIVAYVDEN  143

Query  661  SNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
                  N+E  YDY T+  LG                       +++HRGLGF ++ E
Sbjct  144  PQLMADNLEFTYDYGTSFVLG-----------------------DSSHRGLGFQDDDE  178



>ref|XP_008443898.1| PREDICTED: uncharacterized protein LOC103487380 isoform X2 [Cucumis 
melo]
Length=795

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 85/178 (48%), Gaps = 39/178 (22%)
 Frame = +1

Query  316  LFVEGGILSEWQRFDSTP---DREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrse  486
            LFV+GG LS+WQ F  +P    RE N R    +GS++  +  K  A +S +         
Sbjct  35   LFVDGGFLSDWQ-FQLSPPISAREGNSRAKGKSGSKSATLDRKKIASSSGT---------  84

Query  487  sKQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSV--GMHPIVLLGSKESKIVAYIDEG  660
             KQ+ G AI Y YPS   Q+ L SES G   D +       P +LL SK ++IVAY+DE 
Sbjct  85   -KQSNGYAIGYEYPSAPNQEDLQSESRGLQNDAECSLDDSQPFILLNSKSNQIVAYVDEN  143

Query  661  SNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
                  N+E  YDY T+  LG                       +++HRGLGF ++ E
Sbjct  144  PQLMADNLEFTYDYGTSFVLG-----------------------DSSHRGLGFQDDDE  178



>gb|KCW82688.1| hypothetical protein EUGRSUZ_C04065 [Eucalyptus grandis]
Length=588

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 91/194 (47%), Gaps = 53/194 (27%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTP-----DREKnlrggngngsrnPAIGSKNAAPNsssgsgsrs  477
             LFVEGG+LS+WQ    +P       + +     G+  R  A GSK+   N         
Sbjct  62   GLFVEGGLLSDWQPKTPSPAPRRGSNQNSDASKAGSSGRGRASGSKSLPRN---------  112

Query  478  rsesKQTRGNAIAYMYPSDGVQDGLA-----SESSGEVKDVKSVGMHPIVLLGSKESKIV  642
                  +R NA+ Y YPS  +QDGL       +++GE K   S    P +L GSK+S+IV
Sbjct  113  ------SRSNAVGYRYPSRDLQDGLHPVSTFRDTNGENKMDFS---QPFILCGSKDSQIV  163

Query  643  AYIDEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFY  822
            AY+DEG    P +++                         YDY + F + +++HRGLG+ 
Sbjct  164  AYVDEG----PSSVDQA--------------------NISYDYHSDFVLGDSSHRGLGYC  199

Query  823  NEAEAM-HGIGSSS  861
            NE +A   GI +SS
Sbjct  200  NEYDAAPMGIEASS  213



>ref|XP_011655819.1| PREDICTED: uncharacterized protein LOC101215133 isoform X1 [Cucumis 
sativus]
Length=803

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 80/175 (46%), Gaps = 25/175 (14%)
 Frame = +1

Query  316  LFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesKQ  495
            LFV+GG L +WQ       RE N R    +   + A G   +  ++       S S +KQ
Sbjct  35   LFVDGGFLFDWQCSPPISAREGNSRAKGKSEGNSRAKGKSGSKSDTLDRKKIASSSGTKQ  94

Query  496  TRGNAIAYMYPSDGVQDGLASESSGEVKDVK--SVGMHPIVLLGSKESKIVAYIDEGSNK  669
            + G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE    
Sbjct  95   SNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENPPL  154

Query  670  EPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
               N+E  YDY T+  LG                       E++HRGLGF+++ E
Sbjct  155  MADNLEFTYDYGTSFVLG-----------------------ESSHRGLGFHDDDE  186



>gb|KDO59352.1| hypothetical protein CISIN_1g043289mg [Citrus sinensis]
Length=695

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 101/198 (51%), Gaps = 52/198 (26%)
 Frame = +1

Query  304  SGR----ALFVEGGILSEWQRFDS------TPDREKnlrggngngsrnPAIGSKNAAPNs  453
            SGR    +LFVEGG+LS+WQ+         +  R+ NL   +GN + +  + SK+ +   
Sbjct  30   SGRRLRNSLFVEGGLLSDWQQQQPQQLNSCSKARKSNLNSNSGNLNPSKVLASKSGS---  86

Query  454  ssgsgsrsrsesKQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKES  633
                        K++ GNA  Y YPS  +++     + G++   +S    PI LLGSK+S
Sbjct  87   ------------KKSNGNAFGYQYPSVDLKELCFGGNDGDINLDES---QPINLLGSKDS  131

Query  634  KIVAYIDEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGL  813
            +IVAY+D+  + +PQN+ +  DY ++  LG                       +++HRGL
Sbjct  132  RIVAYVDQTPDLKPQNLIYSCDYDSSFVLG-----------------------DSSHRGL  168

Query  814  GFYNEAEAM-HGIGSSSK  864
            GF +++EA   GI SSSK
Sbjct  169  GFCDDSEATPSGIDSSSK  186



>ref|XP_006453696.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 ref|XP_006453697.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66936.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66937.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
Length=744

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 101/198 (51%), Gaps = 52/198 (26%)
 Frame = +1

Query  304  SGR----ALFVEGGILSEWQRFDS------TPDREKnlrggngngsrnPAIGSKNAAPNs  453
            SGR    +LFVEGG+LS+WQ+         +  R+ NL   +GN + +  + SK+ +   
Sbjct  30   SGRRLRNSLFVEGGLLSDWQQQQQPQLNSFSKARKSNLNSNSGNLNPSKVLASKSGS---  86

Query  454  ssgsgsrsrsesKQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKES  633
                        K++ GNA  Y YPS  +++     + G++   +S    PI LLGSK+S
Sbjct  87   ------------KKSNGNAFGYQYPSVDLKELCFGGNDGDINLDES---QPINLLGSKDS  131

Query  634  KIVAYIDEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGL  813
            +IVAY+D+  + +PQN+ +  DY ++  LG                       +++HRGL
Sbjct  132  RIVAYVDQTPDLKPQNLIYSCDYDSSFVLG-----------------------DSSHRGL  168

Query  814  GFYNEAEAM-HGIGSSSK  864
            GF +++EA   GI SSSK
Sbjct  169  GFCDDSEATPSGIDSSSK  186



>ref|XP_004146703.1| PREDICTED: uncharacterized protein LOC101215133 isoform X2 [Cucumis 
sativus]
Length=793

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 77/175 (44%), Gaps = 35/175 (20%)
 Frame = +1

Query  316  LFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesKQ  495
            LFV+GG L +WQ       RE            + A G   +  ++       S S +KQ
Sbjct  35   LFVDGGFLFDWQCSPPISARE----------GNSRAKGKSGSKSDTLDRKKIASSSGTKQ  84

Query  496  TRGNAIAYMYPSDGVQDGLASESSGEVKDVK--SVGMHPIVLLGSKESKIVAYIDEGSNK  669
            + G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE    
Sbjct  85   SNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENPPL  144

Query  670  EPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
               N+E  YDY T+  LG                       E++HRGLGF+++ E
Sbjct  145  MADNLEFTYDYGTSFVLG-----------------------ESSHRGLGFHDDDE  176



>ref|XP_010542083.1| PREDICTED: uncharacterized protein LOC104815398 [Tarenaya hassleriana]
Length=798

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 97/193 (50%), Gaps = 47/193 (24%)
 Frame = +1

Query  316  LFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesKQ  495
            LFVEGGILS+++R DSTP               +P+ G  +    S  G+  R+++ +  
Sbjct  44   LFVEGGILSDFRR-DSTP--------------FSPSRGGNSQRKGSKHGTSDRAKASAST  88

Query  496  TRG------NAIAYMYPSDGVQDGLASES--SGEVKDVKSVGMHPIVLLGSKESKIVAYI  651
            T G      NA  Y YPS  VQ GL  ES  +G     K    +P+VL+ SKE+KIVAY+
Sbjct  89   TTGPRNCNSNAFGYQYPSMDVQ-GLEGESGNAGNYSCDKLDESNPMVLVESKENKIVAYL  147

Query  652  DEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYST-GFSVDENTHRGLGFYNE  828
            D G +   ++++  Y                      Y+Y+T GF + + +HRGLGF +E
Sbjct  148  DRGPSSSSKDIDVNY---------------------AYEYNTPGFVLGDGSHRGLGFCDE  186

Query  829  AEA-MHGIGSSSK  864
            ++A   G  S+SK
Sbjct  187  SDAGQSGTVSTSK  199



>gb|KJB64581.1| hypothetical protein B456_010G054900 [Gossypium raimondii]
Length=786

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 85/189 (45%), Gaps = 49/189 (26%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesK  492
            +LFVEGG+LS+WQ  DS   +    R       R  A  SK     +             
Sbjct  49   SLFVEGGLLSDWQ-LDSQGRKRNGNRISGLGSDRAKASTSKKGPSTNIG-----------  96

Query  493  QTRGNAIAYMYPSDGVQDG----LASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEG  660
               G+AI Y YPS  +QD     LA E      D K   +HPI+LL SKES+IVAY+D+ 
Sbjct  97   ---GSAIRYEYPSLDLQDPESDILAHEG-----DNKKDELHPIILL-SKESQIVAYMDQT  147

Query  661  SNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAM  840
            +  +P  + + Y Y +   LG++                       +H GLGF +E+EA 
Sbjct  148  TPSKPSLVNYTYGYGSDFVLGDK-----------------------SHTGLGFDDESEAT  184

Query  841  -HGIGSSSK  864
              GI S SK
Sbjct  185  PSGIESCSK  193



>ref|XP_011017950.1| PREDICTED: uncharacterized protein LOC105121122 [Populus euphratica]
Length=737

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 80/191 (42%), Gaps = 58/191 (30%)
 Frame = +1

Query  316  LFVEGGILSEWQ-----RFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsr  480
            LF++GG+L +W      R  +     K +     +       GSKN              
Sbjct  46   LFIDGGLLEDWSPIHSGRSVNVNSNSKWVSKPGNSSQGKVGSGSKNGP------------  93

Query  481  sesKQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGM---HPIVLLGSKESKIVAYI  651
               +++  NA  Y YPS  +Q+G+              GM    PIV++ SKE++IVAY+
Sbjct  94   ---RKSCENAFGYSYPSSELQEGVGR------------GMDESQPIVVVHSKETEIVAYL  138

Query  652  DEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEA  831
            DE    +P N+   Y+YS+   LG                       E++H+GLGF  E 
Sbjct  139  DETPTSKPYNLNSTYNYSSDFLLG-----------------------ESSHKGLGFCEEL  175

Query  832  EAMHGIGSSSK  864
            EA  G  SSSK
Sbjct  176  EATTGAESSSK  186



>ref|XP_011033482.1| PREDICTED: uncharacterized protein LOC105131955 [Populus euphratica]
Length=724

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 80/184 (43%), Gaps = 42/184 (23%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesK  492
            +LFVEGG+L++W    S         G + N   N   GSK    N          +  K
Sbjct  86   SLFVEGGVLADWSPIHS---------GRSSNVKSNSKSGSKPGNSNQGKACSGSKNAPRK  136

Query  493  QTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKE  672
             +  NA  Y YP   VQ+G + +      DV      PIVL+ SKE+ IVAY+DE    +
Sbjct  137  ASE-NAFGYNYPCFDVQEGTSRDM-----DVS----QPIVLVDSKETHIVAYLDETQTLK  186

Query  673  PQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAMHGIG  852
            P N+   Y+YS+   LG                       E++HR LGF  E EA  G  
Sbjct  187  PCNLNLTYEYSSDFLLG-----------------------ESSHRELGFCEEFEATPGAE  223

Query  853  SSSK  864
            SSSK
Sbjct  224  SSSK  227



>ref|XP_008242893.1| PREDICTED: uncharacterized protein LOC103341193 [Prunus mume]
Length=769

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 90/187 (48%), Gaps = 40/187 (21%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesK  492
            ALFV+GG+LS+W    S+P      +  + N       G+K A+          S+SES+
Sbjct  42   ALFVDGGVLSDW----SSPQTSLRGKNPSSNNKSASKSGAKVAS---------GSKSESR  88

Query  493  QTRGNAIAYMYPSDGVQDGLASESSGEVKDV-KSVGMH-PIVLLGSKESKIVAYIDEGSN  666
            ++  NAI Y YPS   Q+GL      E  DV KS+    P+VL+  K ++IVA++D+   
Sbjct  89   KSNVNAIGYQYPSVERQEGLLP-GLHEGNDVGKSMDESCPLVLVDFKNTQIVAHVDQTVA  147

Query  667  KEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAM-H  843
              P  +E  Y Y ++  LG                       E++HRGLGFY E E    
Sbjct  148  SSPHEVEFTYQYGSSFVLG-----------------------ESSHRGLGFYEELEGTAS  184

Query  844  GIGSSSK  864
            GI +SSK
Sbjct  185  GIEASSK  191



>gb|KGN65218.1| hypothetical protein Csa_1G266150 [Cucumis sativus]
Length=783

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 56/117 (48%), Gaps = 25/117 (21%)
 Frame = +1

Query  490  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVK--SVGMHPIVLLGSKESKIVAYIDEGS  663
            KQ+ G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE  
Sbjct  73   KQSNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENP  132

Query  664  NKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
                 N+E  YDY T+  LG                       E++HRGLGF+++ E
Sbjct  133  PLMADNLEFTYDYGTSFVLG-----------------------ESSHRGLGFHDDDE  166



>ref|XP_007203786.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica]
 gb|EMJ04985.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica]
Length=767

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 89/187 (48%), Gaps = 40/187 (21%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesK  492
            A FVEGG+LS+W    S+P      +  + N       G+K A+          S+SES+
Sbjct  40   APFVEGGVLSDW----SSPQTSLRGKNPSSNNKSASKSGAKVAS---------GSKSESR  86

Query  493  QTRGNAIAYMYPSDGVQDGLASESSGEVKDV-KSVGMH-PIVLLGSKESKIVAYIDEGSN  666
            ++  NAI Y YPS   Q+GL      E  DV KS     P+VL+  K ++IVA++D+   
Sbjct  87   KSNVNAIGYQYPSVERQEGLRP-GLHEGNDVGKSTDESCPLVLVDFKNTQIVAHVDQTVA  145

Query  667  KEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAM-H  843
              P  +E  Y Y ++  LG                       E++HRGLGFY+E E    
Sbjct  146  SSPHEVEFTYQYGSSFVLG-----------------------ESSHRGLGFYDELEGTAS  182

Query  844  GIGSSSK  864
            GI +SSK
Sbjct  183  GIEASSK  189



>ref|XP_010244790.1| PREDICTED: uncharacterized protein LOC104588524 [Nelumbo nucifera]
Length=737

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 85/187 (45%), Gaps = 35/187 (19%)
 Frame = +1

Query  304  SGRALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrs  483
            SGR LFV+GG L   Q+  S P   +                S + +  S     S SR 
Sbjct  18   SGRTLFVDGGFLYNGQKNPSLPRSPRGKISRENGK-------SASKSRKSDKQRTSASRD  70

Query  484  esKQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  663
             +++  GNA  Y YP   VQ+ L SES G   + +S   HPIVLL S E+++ A++DE  
Sbjct  71   GARKPTGNAFGYEYPVLDVQELLRSES-GVDGNTRS---HPIVLLDSIETQVAAHVDETP  126

Query  664  NKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE-AM  840
              +P N +  Y+Y ++  LG                        + HRGLGF +E E   
Sbjct  127  CVKPFNGDTTYEYGSSFVLG-----------------------GSCHRGLGFNDELEKTQ  163

Query  841  HGIGSSS  861
            +GI +SS
Sbjct  164  NGIWASS  170



>ref|XP_006381900.1| hypothetical protein POPTR_0006s20380g [Populus trichocarpa]
 gb|ERP59697.1| hypothetical protein POPTR_0006s20380g [Populus trichocarpa]
Length=461

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 70/152 (46%), Gaps = 32/152 (21%)
 Frame = +1

Query  313  ALFVEGGILSEWQ-----RFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrs  477
            +LFVEGG+L++W      R  +     K+      +       GSKNA            
Sbjct  45   SLFVEGGVLADWSPIHSGRSSNVKSNSKSGSKPGNSNQGKACSGSKNAP-----------  93

Query  478  rsesKQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDE  657
                ++  GNA  Y YP   +Q+G + +      DV      PIVL+ SKE+ IVAY+DE
Sbjct  94   ----RKASGNAFVYNYPCFDLQEGTSRD-----MDVS----QPIVLVDSKETHIVAYLDE  140

Query  658  GSNKEPQNMEHVYDYSTTCTLGERPDVEHQEM  753
                +P N+   Y+YS+   LGE     H+E+
Sbjct  141  TPTLKPCNLNLTYEYSSDFLLGESS---HREL  169



>ref|XP_010687767.1| PREDICTED: uncharacterized protein LOC104901840 [Beta vulgaris 
subsp. vulgaris]
Length=801

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 82/181 (45%), Gaps = 42/181 (23%)
 Frame = +1

Query  310  RALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrses  489
            ++LFVEGGIL+ +    S+  R                   KN    S +     S+   
Sbjct  23   QSLFVEGGILAGYDSPCSSNSRR-----------------GKNGNLRSGNSGNGNSKGGV  65

Query  490  KQTRGNAIAYMYPSDGVQD-GLASESSGEVKDVKS-VGMHPIVLLGSKESKIVAYIDEGS  663
            +++  ++  Y YPS   +D G + + + E  D  S +G+ P++LLG K+SKIVA+ D   
Sbjct  66   RKSSADSFRYNYPSVDFKDVGQSEQWTRERNDDGSLIGLQPVILLGPKDSKIVAFEDSAP  125

Query  664  NKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAMH  843
            +  P  +E+ Y+Y++   LG                       E++H GLGFY+E E   
Sbjct  126  SALPSKVEYCYEYNSDFVLG-----------------------ESSHCGLGFYDEPETTP  162

Query  844  G  846
            G
Sbjct  163  G  163



>ref|XP_002325162.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
 gb|EEF03727.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
Length=737

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 78/188 (41%), Gaps = 52/188 (28%)
 Frame = +1

Query  316  LFVEGGILSEWQ-----RFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsr  480
            LF+EGG+L +W      R  +     K +     +        SKN              
Sbjct  46   LFIEGGLLEDWSPSHSGRSVNVNSNSKWVSKPGNSSQGKVGSSSKNGP------------  93

Query  481  sesKQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEG  660
               +++ GNA  Y Y S  +Q+G+        +D+      PIV++ SKE++IVA +DE 
Sbjct  94   ---RKSYGNAFGYSYASSELQEGVG-------RDMDES--QPIVVVDSKETEIVACLDET  141

Query  661  SNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAM  840
               +P N+   Y+YS+   LG                       E++H+GLGF  E EA 
Sbjct  142  PTSKPYNLNSTYNYSSDFLLG-----------------------ESSHKGLGFCEELEAT  178

Query  841  HGIGSSSK  864
             G   SSK
Sbjct  179  TGAELSSK  186



>ref|XP_009338424.1| PREDICTED: uncharacterized protein LOC103930775 [Pyrus x bretschneideri]
Length=762

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 78/175 (45%), Gaps = 37/175 (21%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesK  492
             L VEGG+LS+W    S+P              +NP+  +K+A  + +  +        +
Sbjct  40   GLLVEGGVLSDW----SSPQ--------TAQRGKNPSSSNKSATKSVAKAASGSKSDS-R  86

Query  493  QTRGNAIAYMYPSDGVQDGLASE-SSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  669
            ++   AI Y YPS   Q+G  SE  +G   D  +    P+VL+  K+++I+A+ D+    
Sbjct  87   RSNVTAIGYQYPSVEFQEGFYSELRNGSDADKDTYESCPLVLVDYKDTQILAHGDQTQPS  146

Query  670  EPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
             P  +E  Y Y ++  LGE                       ++HRGLGF +E E
Sbjct  147  SPNEVEFTYHYGSSFVLGE-----------------------SSHRGLGFSDELE  178



>ref|XP_004287228.1| PREDICTED: uncharacterized protein LOC101294206 [Fragaria vesca 
subsp. vesca]
Length=778

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 88/186 (47%), Gaps = 38/186 (20%)
 Frame = +1

Query  316  LFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesKQ  495
            LFVEGG+LS+W     TP              RNP+   K +   S   +GS S+S S +
Sbjct  40   LFVEGGLLSDWS-LPQTP-----------ITGRNPSSDKKKSGSKSGGNAGSDSKSGSLK  87

Query  496  TRGNAIAYMYPSDGVQDGLASE--SSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  669
            +  NAI Y YPS  +Q+G  S+    G+ +D       P+VL+   +++I A+ D+    
Sbjct  88   SNVNAIGYRYPSPELQEGFTSKFRIKGDAEDDNMDVSSPMVLVDLSDTQISAHADQTPAS  147

Query  670  EPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAEAM-HG  846
            EPQ+++  Y Y ++  LG                       E++HRGLGF  E E    G
Sbjct  148  EPQDVKFTYHYGSSFVLG-----------------------ESSHRGLGFSEELEETPSG  184

Query  847  IGSSSK  864
            + ++SK
Sbjct  185  VEATSK  190



>ref|XP_007013705.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007013706.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007013707.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31324.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31325.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31326.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
Length=650

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 50/89 (56%), Gaps = 24/89 (27%)
 Frame = +1

Query  601  HPIVLLGSKESKIVAYIDEGSNKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTG  780
            H +VL  SKE++IVAY+D+ +  +P ++++ Y+Y + C LG                   
Sbjct  5    HTVVLFDSKETQIVAYMDQTTPPKPHHVKYTYEYDSDCVLG-------------------  45

Query  781  FSVDENTHRGLGFYNEAEAM-HGIGSSSK  864
                +++HRGLGF +E+EA   GI SS+K
Sbjct  46   ----DSSHRGLGFGDESEANPSGIESSTK  70



>ref|XP_010109666.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Morus notabilis]
 gb|EXC23988.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Morus notabilis]
Length=804

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 78/177 (44%), Gaps = 36/177 (20%)
 Frame = +1

Query  313  ALFVEGGILSEWQRFDSTPDREKnlrggngngsrnPAIGSKNAAPNsssgsgsrsrsesK  492
            ALFVEGG+LS+W  +  TP R KN      N       GSK+ + + +  +        K
Sbjct  43   ALFVEGGLLSDWS-YAPTPSRGKNPSVSGSNNKS----GSKSGSLDQTKAASGPKSGSRK  97

Query  493  QTRGNAIAYMY---PSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  663
             + GN   Y Y     + +Q     ES+ E   + S     I L+ SK+++I AYID   
Sbjct  98   -SLGNTFRYQYTPFEQESLQPEPRHESNNEDNSLSSS--RTIALVDSKDAQIFAYID---  151

Query  664  NKEPQNMEHVYDYSTTCTLGERPDVEHQEMECVYDYSTGFSVDENTHRGLGFYNEAE  834
                                + P    QEM   YDYS+  ++ + +HRGLGF +E E
Sbjct  152  --------------------QTPSSRSQEMAFSYDYSS--ALGDGSHRGLGFSDELE  186



Lambda      K        H        a         alpha
   0.315    0.132    0.389    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1963610081719