BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4794

Length=831
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797237.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    362   3e-121   Nicotiana sylvestris
ref|XP_008246046.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    360   2e-120   Prunus mume [ume]
gb|AES67479.2|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       371   2e-119   Medicago truncatula
ref|XP_003597229.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    370   2e-119   
ref|XP_003597228.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    371   3e-119   
gb|AEZ55668.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       369   1e-118   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011089897.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    369   1e-118   Sesamum indicum [beniseed]
gb|AJA39985.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    369   1e-118   Salvia miltiorrhiza f. alba
gb|KDO73256.1|  hypothetical protein CISIN_1g0046341mg                  353   1e-118   Citrus sinensis [apfelsine]
gb|AID51432.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    368   2e-118   Astragalus membranaceus
gb|AHA11129.1|  chloroplast 4-hydroxy-3-methylbut-2-enyl diphosph...    368   3e-118   Picrorhiza kurrooa
ref|NP_001234648.1|  GcpE                                               367   3e-118   Solanum lycopersicum
ref|XP_009592136.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    366   1e-117   
gb|ADX06907.1|  1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate sy...    366   1e-117   Rauvolfia verticillata
gb|AEM42998.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    366   2e-117   Siraitia grosvenorii [arhat fruit]
gb|KHG03611.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    365   2e-117   Gossypium arboreum [tree cotton]
ref|XP_006340201.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    365   3e-117   Solanum tuberosum [potatoes]
emb|CDP07116.1|  unnamed protein product                                364   6e-117   Coffea canephora [robusta coffee]
gb|KJB26176.1|  hypothetical protein B456_004G228600                    364   8e-117   Gossypium raimondii
gb|KHN11204.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    364   8e-117   Glycine soja [wild soybean]
gb|KJB26175.1|  hypothetical protein B456_004G228600                    364   8e-117   Gossypium raimondii
ref|XP_003540178.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    364   9e-117   Glycine max [soybeans]
gb|ACT64770.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    360   9e-117   Artemisia annua [sweet Annie]
ref|XP_007016723.1|  4-hydroxy-3-methylbut-2-enyl diphosphate syn...    363   9e-117   
gb|AGQ04156.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       363   1e-116   Lavandula angustifolia [lavender]
ref|XP_002285130.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    363   1e-116   Vitis vinifera
emb|CAN72185.1|  hypothetical protein VITISV_005654                     363   1e-116   Vitis vinifera
ref|XP_003543457.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    363   2e-116   Glycine max [soybeans]
gb|KHN21521.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    363   2e-116   Glycine soja [wild soybean]
ref|XP_008344871.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    345   2e-116   
ref|XP_004487120.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    363   2e-116   
ref|XP_010253662.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    362   6e-116   Nelumbo nucifera [Indian lotus]
ref|XP_004148774.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    361   1e-115   Cucumis sativus [cucumbers]
ref|XP_010535603.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    361   1e-115   Tarenaya hassleriana [spider flower]
ref|XP_010043743.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    360   1e-115   Eucalyptus grandis [rose gum]
ref|XP_007207209.1|  hypothetical protein PRUPE_ppa002111mg             360   1e-115   
gb|EYU36192.1|  hypothetical protein MIMGU_mgv1a001893mg                360   2e-115   Erythranthe guttata [common monkey flower]
gb|EYU36193.1|  hypothetical protein MIMGU_mgv1a001893mg                360   2e-115   Erythranthe guttata [common monkey flower]
ref|XP_008463938.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    360   3e-115   Cucumis melo [Oriental melon]
ref|XP_008349746.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    359   4e-115   
dbj|BAF98296.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    359   6e-115   Hevea brasiliensis [jebe]
gb|AFQ98370.1|  hydroxymethylbutenyl diphosphate synthase               358   2e-114   Camellia sinensis [black tea]
ref|XP_004295028.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    357   4e-114   Fragaria vesca subsp. vesca
ref|XP_007150210.1|  hypothetical protein PHAVU_005G135800g             356   7e-114   Phaseolus vulgaris [French bean]
ref|XP_009335082.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    355   2e-113   Pyrus x bretschneideri [bai li]
ref|XP_006424585.1|  hypothetical protein CICLE_v10027881mg             355   2e-113   Citrus clementina [clementine]
ref|NP_001289212.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    355   3e-113   Pyrus x bretschneideri [bai li]
ref|XP_009367086.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    355   3e-113   Pyrus x bretschneideri [bai li]
ref|XP_012064829.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    354   6e-113   Jatropha curcas
ref|XP_011044361.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    353   8e-113   Populus euphratica
ref|XP_010098198.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    359   8e-113   
ref|XP_010689558.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    353   8e-113   Beta vulgaris subsp. vulgaris [field beet]
gb|ABG75916.2|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    353   1e-112   Stevia rebaudiana
ref|XP_006400831.1|  hypothetical protein EUTSA_v10012774mg             353   1e-112   Eutrema salsugineum [saltwater cress]
dbj|BAB09833.1|  GcpE protein                                           352   2e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAO24774.1|  GCPE protein                                            352   2e-112   Catharanthus roseus [chatas]
ref|XP_010483710.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    352   3e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010443862.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    352   3e-112   Camelina sativa [gold-of-pleasure]
gb|ACD70401.1|  putative chloroplast 4-hydroxy-3-methylbut-2-en-1...    350   3e-112   Populus trichocarpa [western balsam poplar]
ref|NP_200868.2|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     352   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851233.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     352   3e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAL91150.1|  GcpE protein                                            352   3e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19840.1|  AT5g60600/mup24_10                                      352   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006378969.1|  hypothetical protein POPTR_0009s01900g             351   5e-112   
gb|ABB78087.1|  (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate syn...    352   5e-112   Ginkgo biloba [ginkgo]
ref|XP_006378968.1|  hypothetical protein POPTR_0009s01900g             350   7e-112   
emb|CDY31531.1|  BnaA10g13400D                                          351   8e-112   Brassica napus [oilseed rape]
ref|XP_006378966.1|  hypothetical protein POPTR_0009s01900g             351   1e-111   
ref|XP_002864694.1|  hypothetical protein ARALYDRAFT_919295             350   1e-111   Arabidopsis lyrata subsp. lyrata
ref|XP_010456601.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    350   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_009120594.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    350   1e-111   Brassica rapa
ref|XP_008807336.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    350   2e-111   Phoenix dactylifera
ref|XP_008359197.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    350   2e-111   
ref|XP_006280064.1|  hypothetical protein CARUB_v10025946mg             350   2e-111   Capsella rubella
ref|XP_011040872.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    333   2e-111   Populus euphratica
emb|CDY53637.1|  BnaC09g54000D                                          349   3e-111   Brassica napus [oilseed rape]
ref|XP_009392271.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    347   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJA32313.1|  chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-di...    347   4e-110   Narcissus tazetta
ref|XP_006854508.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    346   5e-110   Amborella trichopoda
gb|AJA32314.1|  chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-di...    346   5e-110   Narcissus tazetta
ref|XP_010906493.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    346   9e-110   Elaeis guineensis
gb|AAO72576.1|  isoprenoid biosynthesis-like protein                    342   1e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004487119.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    346   2e-109   
ref|NP_001047365.1|  Os02g0603800                                       342   2e-108   
ref|XP_006384896.1|  hypothetical protein POPTR_0004s22010g             342   4e-108   
gb|ACL53652.1|  unknown                                                 340   8e-108   Zea mays [maize]
gb|ACG47448.1|  hydroxymethylbutenyl 4-diphosphate synthase             340   1e-107   Zea mays [maize]
gb|EPS62642.1|  hypothetical protein M569_12144                         321   2e-107   Genlisea aurea
ref|XP_006647487.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    338   5e-107   Oryza brachyantha
ref|NP_001105676.1|  LOC542690                                          338   5e-107   Zea mays [maize]
gb|AHN91473.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    338   5e-107   Dendrobium officinale
ref|XP_003575307.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    338   6e-107   Brachypodium distachyon [annual false brome]
ref|XP_002454137.1|  hypothetical protein SORBIDRAFT_04g025290          337   3e-106   Sorghum bicolor [broomcorn]
ref|XP_004953020.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    336   4e-106   Setaria italica
ref|XP_008225843.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    331   4e-104   Prunus mume [ume]
ref|XP_009803352.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    310   4e-103   Nicotiana sylvestris
gb|AAS75817.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    309   2e-101   Nicotiana benthamiana
ref|XP_001764903.1|  predicted protein                                  318   3e-100   
ref|XP_001766565.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    320   3e-100   
ref|XP_002973473.1|  hypothetical protein SELMODRAFT_149035             313   8e-98    
ref|XP_002986683.1|  hypothetical protein SELMODRAFT_158184             313   1e-97    
ref|XP_001755871.1|  predicted protein                                  305   9e-95    
ref|XP_002530286.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    304   3e-94    
gb|KDO73263.1|  hypothetical protein CISIN_1g0046341mg                  289   4e-94    Citrus sinensis [apfelsine]
gb|ABV02021.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate sy...    284   4e-93    Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_006488105.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    299   6e-92    
emb|CDY53636.1|  BnaC09g53990D                                          263   1e-84    Brassica napus [oilseed rape]
gb|AHG98060.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    254   1e-81    Plectranthus barbatus
ref|XP_005650225.1|  putative chloroplast 1-hydroxy-2-methyl-2-(E...    264   1e-78    Coccomyxa subellipsoidea C-169
ref|XP_001690937.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    262   2e-78    Chlamydomonas reinhardtii
gb|AAX54905.1|  putative chloroplast 1-hydroxy-2-methyl-2-(E)-but...    262   2e-78    Chlamydomonas reinhardtii
ref|XP_005841109.1|  hypothetical protein GUITHDRAFT_63981              261   4e-78    Guillardia theta CCMP2712
gb|KIZ04819.1|  hypothetical protein MNEG_3143                          258   4e-78    Monoraphidium neglectum
ref|XP_002953482.1|  hypothetical protein VOLCADRAFT_63610              254   2e-75    Volvox carteri f. nagariensis
gb|EMT15013.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    254   5e-75    
gb|EMS56222.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    251   1e-74    Triticum urartu
ref|XP_011400578.1|  26S proteasome non-ATPase regulatory subunit 1     259   1e-74    Auxenochlorella protothecoides
ref|XP_002506236.1|  predicted protein                                  251   4e-74    Micromonas commoda
ref|XP_003081089.1|  putative chloroplast 1-hydroxy-2-methyl-2-(ISS)    247   2e-72    Ostreococcus tauri
ref|XP_001419500.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    244   8e-72    Ostreococcus lucimarinus CCE9901
emb|CBJ30926.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    243   5e-71    Ectocarpus siliculosus
gb|ABG74579.1|  isoprenoid biosynthesis-like protein                    226   7e-71    Musa acuminata AAA Group [Cavendish banana]
ref|XP_003056663.1|  predicted protein                                  243   9e-71    Micromonas pusilla CCMP1545
ref|XP_007510861.1|  predicted protein                                  241   4e-70    Bathycoccus prasinos
ref|XP_006378965.1|  hypothetical protein POPTR_0009s01900g             228   2e-65    
ref|XP_006424584.1|  hypothetical protein CICLE_v10027881mg             226   9e-65    
ref|NP_001119467.1|  4-hydroxy-3-methylbut-2-enyl diphosphate syn...    225   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005848392.1|  hypothetical protein CHLNCDRAFT_144676             224   5e-64    Chlorella variabilis
gb|KDD76259.1|  GcpE                                                    211   5e-64    Helicosporidium sp. ATCC 50920
ref|XP_002292108.1|  gcpe-like protein                                  218   6e-62    Thalassiosira pseudonana CCMP1335
gb|ACI45948.1|  putative chloroplast 4-hydroxy-3-methylbut-2-en-1...    204   2e-60    Guillardia theta
ref|XP_002179061.1|  1-hydroxy-2-methyl-2-(E)-butenyl-4-diphospha...    214   4e-60    Phaeodactylum tricornutum CCAP 1055/1
gb|EFB40485.1|  hypothetical protein pah_c200o034                       212   5e-60    Parachlamydia acanthamoebae str. Hall's coccus
ref|WP_036746476.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    212   7e-60    Parachlamydia acanthamoebae
ref|XP_005783224.1|  hypothetical protein EMIHUDRAFT_442353             214   7e-60    Emiliania huxleyi CCMP1516
emb|CDZ80220.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    211   2e-59    Candidatus Rubidus massiliensis
ref|XP_009035331.1|  hypothetical protein AURANDRAFT_71112              216   2e-59    Aureococcus anophagefferens
gb|EJK67655.1|  hypothetical protein THAOC_11283                        210   1e-58    Thalassiosira oceanica
ref|WP_013925438.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    209   1e-58    Parachlamydia acanthamoebae
gb|KIA77148.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    209   1e-58    Parachlamydia acanthamoebae
ref|WP_039385010.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    207   4e-58    Neochlamydia sp. TUME1
ref|WP_042103571.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    206   8e-58    Parachlamydiaceae bacterium HS-T3
ref|WP_044882180.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    204   7e-57    Neochlamydia sp. EPS4
gb|KFG49560.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    206   7e-57    Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|KFH07783.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    206   7e-57    Toxoplasma gondii MAS
gb|KFG35221.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    205   7e-57    Toxoplasma gondii p89
gb|KFG65470.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    206   8e-57    Toxoplasma gondii RUB
gb|KFH10447.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    206   8e-57    Toxoplasma gondii VAND
ref|WP_011175290.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    202   3e-56    Candidatus Protochlamydia amoebophila
ref|WP_035395035.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    201   7e-56    
gb|KIC72391.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    201   7e-56    Candidatus Protochlamydia amoebophila
ref|WP_039357656.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    201   7e-56    Candidatus Protochlamydia amoebophila
gb|ESS31948.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    205   7e-56    Toxoplasma gondii VEG
gb|EPR62596.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    205   7e-56    Toxoplasma gondii GT1
gb|KFG52681.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    205   8e-56    Toxoplasma gondii FOU
ref|WP_042282293.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    201   8e-56    Candidatus Protochlamydia sp. R18
ref|XP_002365345.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    205   9e-56    Toxoplasma gondii ME49
ref|WP_042240386.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    200   2e-55    Neochlamydia sp. S13
ref|XP_765233.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate syn...    198   2e-54    Theileria parva strain Muguga
ref|XP_008882873.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    199   7e-54    
ref|XP_003882784.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    199   8e-54    Neospora caninum Liverpool
ref|XP_952048.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate ...    193   1e-52    Theileria annulata
ref|XP_009690697.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphospha...    193   2e-52    Theileria orientalis strain Shintoku
ref|WP_013943315.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    190   4e-52    Simkania negevensis
ref|XP_004829307.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    191   9e-52    Theileria equi strain WA
ref|WP_043587352.1|  hypothetical protein                               172   1e-49    
gb|EMR00731.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    173   1e-49    Cesiribacter andamanensis AMV16
dbj|BAG14389.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    183   4e-49    Perkinsus marinus ATCC 50439
ref|WP_043128162.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    171   5e-49    
ref|WP_008101242.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    182   6e-49    Verrucomicrobiae bacterium DG1235
ref|XP_002768617.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    182   1e-48    Perkinsus marinus ATCC 50983
emb|CDR33454.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    181   1e-48    Criblamydia sequanensis CRIB-18
ref|WP_041016942.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    181   1e-48    
emb|CDR94010.1|  gcpE protein, putative                                 181   2e-48    Babesia bigemina
ref|WP_013044727.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    179   8e-48    Coraliomargarita akajimensis
ref|WP_000541454.1|  hypothetical protein                               170   3e-47    
ref|WP_009036471.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    177   4e-47    Indibacter alkaliphilus
ref|XP_001610211.1|  gcpE protein                                       177   8e-47    Babesia bovis T2Bo
ref|WP_008627688.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    176   1e-46    Mariniradius saccharolyticus
ref|WP_028788241.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    176   1e-46    Terrimonas ferruginea
ref|WP_020152560.1|  hypothetical protein                               174   1e-46    
ref|WP_041873442.1|  hypothetical protein                               167   2e-46    
ref|WP_035071223.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    175   2e-46    Anditalea andensis
gb|EDM36017.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    174   4e-46    Pedobacter sp. BAL39
ref|WP_009185621.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    174   4e-46    Cecembia lonarensis
ref|WP_039866655.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    174   5e-46    Pedobacter sp. BAL39
ref|WP_013452189.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    174   5e-46    Marivirga tractuosa
ref|WP_014772391.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    174   6e-46    Belliella baltica
ref|WP_014681066.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    174   6e-46    Solitalea canadensis
ref|WP_026772720.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    173   1e-45    Asinibacterium sp. OR43
ref|WP_026768257.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    173   1e-45    Asinibacterium sp. OR53
ref|WP_002702180.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    172   1e-45    Microscilla marina
gb|AHM63652.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    172   3e-45    Flammeovirgaceae bacterium 311
ref|WP_015809258.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    172   3e-45    Pedobacter heparinus
ref|WP_025298932.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    172   3e-45    
ref|WP_012925967.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    171   4e-45    
gb|EOQ87425.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    171   4e-45    Leptospira yanagawae serovar Saopaulo str. Sao Paulo = ATCC 700523
ref|WP_024283448.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    171   4e-45    Algoriphagus marincola
ref|WP_009508000.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    172   4e-45    Opitutaceae bacterium TAV5
ref|WP_039929258.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    171   4e-45    Leptospira yanagawae
ref|WP_039477998.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    171   4e-45    
ref|WP_018627269.1|  hypothetical protein                               171   5e-45    Niabella aurantiaca
ref|WP_028261665.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    170   6e-45    
ref|WP_020149813.1|  hypothetical protein                               170   7e-45    
ref|WP_014020335.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    171   7e-45    Cyclobacterium marinum
gb|AEA43526.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    171   7e-45    Fluviicola taffensis DSM 16823
ref|WP_043024168.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   8e-45    
ref|WP_012388276.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    171   8e-45    Leptospira biflexa
gb|ELR70856.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    170   8e-45    Fulvivirga imtechensis AK7
ref|WP_040496810.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    171   8e-45    Fulvivirga imtechensis
ref|WP_015265930.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   9e-45    Echinicola vietnamensis
ref|WP_012377418.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   1e-44    Opitutus terrae
ref|WP_041952338.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   1e-44    Spirosoma spitsbergense
gb|EMJ86182.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    170   1e-44    Leptospira meyeri serovar Semaranga str. Veldrot Semarang 173
ref|WP_026946987.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   1e-44    Algoriphagus marincola
gb|EKJ85057.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    170   1e-44    Leptospira meyeri serovar Hardjo str. Went 5
ref|WP_001011572.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    170   1e-44    Leptospira interrogans
ref|WP_001011575.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    170   1e-44    Leptospira interrogans
ref|WP_001011584.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    170   1e-44    Leptospira interrogans
ref|WP_035983785.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    170   1e-44    Leptospira meyeri
ref|WP_030001802.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   1e-44    
gb|EMM80390.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    170   1e-44    Leptospira interrogans str. 2006001854
ref|WP_040917603.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    170   2e-44    Leptospira meyeri
ref|WP_025145959.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   2e-44    Pedobacter jeongneungensis
gb|ABG59455.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    169   2e-44    Cytophaga hutchinsonii ATCC 33406
ref|WP_001011587.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    169   2e-44    
ref|WP_041932708.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   2e-44    Cytophaga hutchinsonii
ref|WP_044117870.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    169   2e-44    Alkaliflexus imshenetskii
ref|WP_012500067.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    169   2e-44    Chloroherpeton thalassium
ref|WP_026952032.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   2e-44    Algoriphagus mannitolivorans
ref|WP_002625642.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    169   2e-44    Leptospira
ref|WP_016761207.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    169   2e-44    Leptospira weilii
ref|WP_004765637.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    169   2e-44    Leptospira kirschneri
ref|WP_004506808.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    169   3e-44    Leptospira weilii
ref|WP_027000276.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   3e-44    
ref|WP_037439696.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   3e-44    Pedobacter antarcticus
ref|WP_020765666.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    169   3e-44    Leptospira
ref|WP_029998282.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   3e-44    
ref|WP_026464184.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   3e-44    Adhaeribacter aquaticus
ref|WP_038162080.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   3e-44    Verrucomicrobium sp. BvORR106
ref|WP_002101771.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    169   3e-44    Leptospira interrogans
ref|WP_012509318.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    169   3e-44    Pelodictyon phaeoclathratiforme
ref|WP_009965977.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Verrucomicrobium spinosum
ref|WP_002752446.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    169   4e-44    
ref|WP_040580353.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    
ref|WP_016194246.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   4e-44    Arcticibacter svalbardensis
ref|WP_039126529.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   4e-44    Flavihumibacter sp. ZG627
ref|WP_001011580.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Leptospira interrogans
ref|WP_019111293.1|  hypothetical protein                               168   4e-44    Verrucomicrobia bacterium SCGC AAA164-L15
ref|WP_038029147.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   4e-44    Thermonema rossianum
ref|WP_011671608.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Leptospira borgpetersenii
ref|WP_038131498.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Verrucomicrobia bacterium SCGC AAA168-F10
gb|EEN83170.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    168   4e-44    Porphyromonas endodontalis ATCC 35406
ref|WP_001011576.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Leptospira interrogans
gb|EMM97799.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    168   4e-44    Leptospira interrogans serovar Zanoni str. LT2156
ref|WP_001011579.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Leptospira interrogans
ref|WP_001011571.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Leptospira interrogans
ref|WP_001011586.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Leptospira interrogans
ref|WP_004501491.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    168   4e-44    Leptospira weilii
ref|WP_001011585.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Leptospira interrogans
ref|WP_011670735.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   4e-44    Leptospira borgpetersenii
ref|WP_020888417.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   5e-44    Cyclobacterium qasimii
ref|WP_002725099.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    168   5e-44    Leptospira
ref|WP_039749913.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   5e-44    
emb|CCH52120.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    168   5e-44    Fibrisoma limi BUZ 3
ref|WP_028831439.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   5e-44    
ref|WP_004499155.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    168   5e-44    Leptospira weilii
ref|WP_002997489.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    168   5e-44    Leptospira weilii
ref|WP_040005539.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   6e-44    Fibrisoma limi
ref|WP_039449219.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   6e-44    Pedobacter glucosidilyticus
ref|WP_014855999.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   7e-44    Melioribacter roseus
ref|WP_020763499.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    168   7e-44    Leptospira kirschneri
ref|WP_004755752.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   7e-44    Leptospira kirschneri
ref|WP_004756563.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   7e-44    Leptospira kirschneri
ref|WP_019986408.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   7e-44    Rudanella lutea
ref|WP_020779677.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   7e-44    Leptospira kirschneri
ref|WP_026967844.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   8e-44    Algoriphagus terrigena
ref|WP_016752197.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   8e-44    Leptospira kirschneri
ref|WP_004783178.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   8e-44    Leptospira kirschneri
gb|EKQ84987.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    167   8e-44    
ref|WP_026898877.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   8e-44    
ref|WP_015681381.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   9e-44    
ref|WP_029284060.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   9e-44    
ref|WP_015030917.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   9e-44    
ref|WP_019599168.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   1e-43    
ref|WP_033418316.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   1e-43    
ref|WP_018477847.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   1e-43    
ref|WP_029996480.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   1e-43    
ref|WP_020784592.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   1e-43    
ref|WP_033412090.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   1e-43    
ref|WP_002974114.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-43    
ref|WP_004466801.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-43    
ref|WP_035610064.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-43    
ref|WP_004491347.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   1e-43    
gb|EKO79202.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    167   1e-43    
ref|WP_018472954.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   1e-43    
ref|WP_002981464.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   1e-43    
ref|WP_004479487.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   1e-43    
ref|WP_004461954.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    167   1e-43    
ref|WP_036885384.1|  hypothetical protein                               159   1e-43    
gb|EMF90050.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    167   1e-43    
ref|WP_004482338.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   1e-43    
ref|WP_004485858.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   1e-43    
ref|WP_032916231.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-43    
ref|WP_004484777.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   1e-43    
ref|WP_017852765.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-43    
ref|WP_001011577.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   2e-43    
ref|WP_001011578.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   2e-43    
ref|WP_029275774.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   2e-43    
ref|WP_014222823.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   2e-43    
ref|WP_017863172.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   2e-43    
ref|WP_020783453.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   2e-43    
ref|WP_020526939.1|  hypothetical protein                               167   2e-43    
ref|WP_039139364.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   2e-43    
ref|WP_044513706.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   2e-43    
ref|WP_028297123.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   2e-43    
ref|WP_010576785.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   2e-43    
ref|WP_039053483.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   2e-43    
ref|WP_026904001.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   2e-43    
ref|WP_012420427.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   2e-43    
ref|WP_045640961.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   2e-43    
ref|WP_031930960.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   3e-43    
ref|WP_031527052.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   3e-43    
ref|WP_040919883.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   3e-43    
ref|WP_016750149.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   3e-43    
ref|WP_006367343.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   3e-43    
ref|WP_008592103.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   3e-43    
ref|WP_022824903.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   3e-43    
ref|WP_022198292.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   3e-43    
gb|EHQ06249.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    166   3e-43    
gb|EKR08142.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    166   3e-43    
ref|WP_036852241.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   3e-43    
ref|WP_021069034.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   4e-43    
ref|WP_040762255.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   4e-43    
dbj|GAO45277.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    166   4e-43    
gb|EKY01400.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    165   4e-43    
ref|WP_026750307.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   4e-43    
ref|WP_002746741.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   4e-43    
ref|WP_020770260.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   4e-43    
ref|WP_026764890.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   4e-43    
ref|WP_039721940.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   4e-43    
ref|WP_044168752.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   5e-43    
ref|WP_016549865.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   5e-43    
ref|WP_036881806.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   5e-43    
ref|WP_033111082.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   5e-43    
ref|WP_044234467.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   5e-43    
ref|WP_040627083.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   5e-43    
ref|WP_022396268.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   5e-43    
gb|EHQ25285.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    165   5e-43    
ref|WP_012788578.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   6e-43    
ref|WP_020772242.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   6e-43    
ref|WP_001011583.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   6e-43    
ref|WP_024808156.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   6e-43    
ref|WP_010417793.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   7e-43    
ref|WP_020986937.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   7e-43    
ref|WP_007418591.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   8e-43    
ref|WP_035405552.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   8e-43    
ref|WP_011361395.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   8e-43    
ref|WP_025837262.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   9e-43    
ref|WP_003011709.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   9e-43    
ref|WP_040888669.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   1e-42    
ref|WP_002992820.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_033564087.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_042725663.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   1e-42    
ref|WP_010602512.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_010856632.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_018969131.1|  hypothetical protein                               164   1e-42    
gb|EDY17533.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    164   1e-42    
dbj|GAL87502.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    164   1e-42    
ref|WP_026995433.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_017729932.1|  hypothetical protein                               164   1e-42    
ref|WP_045469021.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_028070631.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_008199314.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_028980942.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   1e-42    
ref|WP_016544642.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    164   2e-42    
ref|WP_025761675.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   2e-42    
emb|CDJ42285.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    166   2e-42    
ref|WP_007658562.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   2e-42    
ref|WP_044200698.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   2e-42    
ref|WP_036845168.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   2e-42    
gb|EMO39017.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synth...    163   2e-42    
emb|CDJ67490.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    166   2e-42    
gb|ACD84022.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate sy...    163   2e-42    
ref|WP_011358682.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-42    
ref|WP_040585707.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   2e-42    
gb|EKE08670.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    152   2e-42    
gb|ETZ23959.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    163   2e-42    
ref|WP_041886704.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   3e-42    
gb|EMO27346.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    163   3e-42    
ref|WP_004450043.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   3e-42    
ref|WP_016560160.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   3e-42    
ref|WP_004452120.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   3e-42    
ref|WP_004456392.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   3e-42    
ref|WP_017215661.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   3e-42    
ref|WP_004419791.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   3e-42    
ref|WP_002177887.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   3e-42    
ref|WP_004447250.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   3e-42    
ref|WP_004426903.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   3e-42    
ref|WP_026955484.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   3e-42    
ref|WP_009053773.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   4e-42    
ref|WP_009060399.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    162   5e-42    
ref|WP_010526318.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    162   5e-42    
ref|WP_025605263.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   5e-42    
ref|WP_044004668.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   5e-42    
ref|WP_044017536.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   8e-42    
gb|KDU79597.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    161   8e-42    
ref|WP_017259779.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   8e-42    
gb|ERJ73001.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    161   8e-42    
ref|WP_011006385.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    161   9e-42    
ref|WP_027418785.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   9e-42    
ref|WP_045753255.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   1e-41    
ref|XP_743307.1|  GcpE protein                                          163   1e-41    
gb|EUD69889.1|  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synt...    163   1e-41    
ref|WP_044114366.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    161   1e-41    
ref|WP_009433030.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    161   1e-41    
ref|WP_029465287.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   1e-41    
ref|WP_044125133.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    161   1e-41    
ref|WP_038700675.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   1e-41    
emb|CDS45871.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    162   1e-41    
ref|WP_010575421.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    161   1e-41    
ref|WP_026632945.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   1e-41    
emb|CCH01413.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    161   2e-41    
ref|WP_041259095.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   2e-41    
ref|XP_740737.1|  hypothetical protein                                  151   2e-41    
ref|WP_022477760.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    158   2e-41    
ref|WP_010230169.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   2e-41    
gb|KGN83000.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    160   2e-41    
gb|KGN97437.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    160   3e-41    
ref|WP_044190040.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   3e-41    
ref|WP_044233106.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   3e-41    
ref|WP_022436495.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   3e-41    
gb|ETB58995.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    162   3e-41    
ref|WP_036884355.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   3e-41    
ref|WP_014559193.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    160   3e-41    
gb|EQB83053.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    160   4e-41    
ref|XP_008625669.1|  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate...    161   4e-41    
ref|WP_020149744.1|  hypothetical protein                               159   5e-41    
ref|WP_014944975.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   5e-41    
ref|WP_037525485.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   5e-41    
ref|WP_010883016.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   5e-41    
ref|WP_010422549.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   5e-41    
gb|ETR80258.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    159   6e-41    
ref|XP_729456.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate sy...    161   6e-41    
ref|WP_018358592.1|  hypothetical protein                               159   6e-41    
ref|WP_014517754.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   6e-41    
ref|WP_035403961.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   6e-41    
ref|XP_680310.1|  GcpE protein                                          160   6e-41    
ref|WP_035562438.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   7e-41    
gb|ETX02314.1|  hypothetical protein ETSY1_04030                        159   8e-41    
ref|WP_013633270.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   8e-41    
ref|WP_016776386.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   8e-41    
dbj|GAO29200.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    159   9e-41    
ref|WP_044227122.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   9e-41    
gb|EPP30393.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    157   1e-40    
gb|ETX05585.1|  hypothetical protein ETSY2_22100                        158   1e-40    
ref|WP_019943804.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   1e-40    
ref|WP_013926162.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   1e-40    
ref|WP_018028589.1|  hypothetical protein                               157   1e-40    
ref|WP_020036128.1|  hypothetical protein                               158   1e-40    
ref|WP_011097048.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    158   2e-40    
ref|WP_006344058.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    158   2e-40    
ref|WP_045071837.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    158   2e-40    
ref|WP_012780078.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   2e-40    
ref|WP_013407896.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   2e-40    
ref|WP_028523087.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   2e-40    
ref|WP_028665433.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   2e-40    
ref|WP_044222153.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   2e-40    
ref|WP_009596898.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    156   2e-40    
ref|WP_011744132.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   3e-40    
ref|WP_014943808.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   4e-40    
ref|WP_021930870.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   4e-40    
gb|EPJ23313.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    157   4e-40    
ref|WP_006343099.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   4e-40    
ref|WP_014518475.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   4e-40    
gb|EKD52354.1|  hypothetical protein ACD_62C00046G0001                  155   4e-40    
ref|WP_022309152.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   5e-40    
emb|CCF74567.1|  unnamed protein product                                157   5e-40    
ref|WP_019307250.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   6e-40    
ref|WP_014945938.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    156   7e-40    
ref|WP_037495597.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    156   7e-40    
ref|WP_012873985.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    156   7e-40    
ref|WP_016967917.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    156   7e-40    
ref|WP_014944250.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    156   7e-40    
ref|WP_026318442.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    155   8e-40    
ref|WP_032135488.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    155   8e-40    
ref|WP_014946610.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    156   8e-40    
ref|WP_030002905.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    153   9e-40    
ref|WP_038973847.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   1e-39    
ref|WP_012504874.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   1e-39    
ref|WP_012465168.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   1e-39    
ref|WP_011431793.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    153   1e-39    
ref|WP_010508976.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    152   2e-39    
ref|WP_041471440.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   2e-39    
gb|AGT69620.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    155   2e-39    
ref|WP_015505856.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   2e-39    
ref|WP_021757239.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   2e-39    
gb|AGT67768.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    155   2e-39    
gb|AEJ77048.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    155   2e-39    
gb|ADI50733.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    155   2e-39    



>ref|XP_009797237.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Nicotiana sylvestris]
Length=325

 Score =   362 bits (929),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS+D T++LHNLPY+EEK  RVHAARRLFE LSENSL+FPVIHHI FP D HRDDLVI A
Sbjct  119  KSTDVTMILHNLPYTEEKTGRVHAARRLFESLSENSLNFPVIHHIHFPNDTHRDDLVIGA  178

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  179  GANAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  238

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  239  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  298

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDPP EE
Sbjct  299  IQMEHATDALIQLIKDNGRWVDPPAEE  325



>ref|XP_008246046.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like, partial [Prunus mume]
Length=348

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+K+SRVHAARRLFEYL +NSL+FPVIHHI+FP  IHRDDLVI+A
Sbjct  142  KGIDATMLLHDLPFSEDKVSRVHAARRLFEYLGDNSLNFPVIHHIQFPSGIHRDDLVIAA  201

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  202  GTNAGALLVDGLGDGLLLEAADKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  261

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  262  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  321

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  322  IEMEHATDALIQLIKDHGRWVDPPAEE  348



>gb|AES67479.2| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Medicago truncatula]
Length=740

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E++ISRVHAARRLFEYLS+NSLDFPVIHHI+FP  IHRDDLVI A
Sbjct  534  KDVDATMLLHDLPYTEDRISRVHAARRLFEYLSDNSLDFPVIHHIQFPNGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSHAGALLVDGLGDGLLLEASDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  714  IAMEQATDALIDLIKEHGRWVDPPVEE  740



>ref|XP_003597229.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Medicago 
truncatula]
Length=731

 Score =   370 bits (951),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E++ISRVHAARRLFEYLS+NSLDFPVIHHI+FP  IHRDDLVI A
Sbjct  525  KDVDATMLLHDLPYTEDRISRVHAARRLFEYLSDNSLDFPVIHHIQFPNGIHRDDLVIGA  584

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  585  GSHAGALLVDGLGDGLLLEASDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  644

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  645  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  704

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  705  IAMEQATDALIDLIKEHGRWVDPPVEE  731



>ref|XP_003597228.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Medicago 
truncatula]
Length=767

 Score =   371 bits (952),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E++ISRVHAARRLFEYLS+NSLDFPVIHHI+FP  IHRDDLVI A
Sbjct  561  KDVDATMLLHDLPYTEDRISRVHAARRLFEYLSDNSLDFPVIHHIQFPNGIHRDDLVIGA  620

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  621  GSHAGALLVDGLGDGLLLEASDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  680

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  681  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  740

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  741  IAMEQATDALIDLIKEHGRWVDPPVEE  767



>gb|AEZ55668.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia miltiorrhiza]
Length=742

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K++DAT++LH++PYS+EK SRVHAARRLFEYLSENSLDFPVIHHIEFPK IHRDDLVI A
Sbjct  536  KTADATMILHHIPYSDEKTSRVHAARRLFEYLSENSLDFPVIHHIEFPKGIHRDDLVIGA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLE+PD +F+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GTNAGALLVDGLGDGILLESPDQEFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIR++TSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  656  LQEISAEIRDRTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  715

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI+LIKEHGRWVDPP EE
Sbjct  716  IAMEHATDALIELIKEHGRWVDPPVEE  742



>ref|XP_011089897.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
 ref|XP_011089899.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
 ref|XP_011089900.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
Length=742

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS+DAT++LH+LPY+EEK SRVHAARRLFEYL+ENSL+FPVIHHI+FPKD HRDDLVI A
Sbjct  536  KSTDATMILHDLPYTEEKTSRVHAARRLFEYLAENSLNFPVIHHIQFPKDTHRDDLVIGA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GTNAGALLVDGLGDGILLEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  656  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  715

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ AT+ALI LIK+HGRWVDPP EE
Sbjct  716  IDMEHATEALIQLIKDHGRWVDPPAEE  742



>gb|AJA39985.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia 
miltiorrhiza f. alba]
Length=742

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K++DAT++LH++PYS+EK SRVHAARRLFEYLSENSLDFPVIHHIEFPK IHRDDLVI A
Sbjct  536  KTADATMILHHIPYSDEKTSRVHAARRLFEYLSENSLDFPVIHHIEFPKGIHRDDLVIGA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLE+PD +F+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GTNAGALLVDGLGDGILLESPDQEFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIR++TSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  656  LQEISAEIRDRTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  715

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI+LIKEHGRWVDPP EE
Sbjct  716  IAMEHATDALIELIKEHGRWVDPPVEE  742



>gb|KDO73256.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73257.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73258.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73259.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73260.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73261.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73262.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
Length=275

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP++E+KI RV AARRLFEYLSEN+L+FPVIHHI+FP  IHRDDLVI A
Sbjct  69   KDIDATMILHDLPFNEDKIGRVQAARRLFEYLSENNLNFPVIHHIQFPNGIHRDDLVIGA  128

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+N G LLVDGLGDG+LLEAP  DFDF+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  129  GTNVGALLVDGLGDGLLLEAPGQDFDFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  188

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  189  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  248

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALI LIK+HGRW +PP EE
Sbjct  249  IAMEQATDALIQLIKDHGRWAEPPAEE  275



>gb|AID51432.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Astragalus 
membranaceus]
Length=742

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  D T++LH+LPY+EE++SRVHA+RRLFEYLSE SL+FPVIHHI+FP  IHRDDLVI A
Sbjct  536  KGVDVTMLLHDLPYTEERVSRVHASRRLFEYLSEKSLNFPVIHHIQFPNGIHRDDLVIGA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDG+LLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GSNAGALLVDGLGDGILLEASDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  656  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  715

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  716  IAMEQATDALIDLIKEHGRWVDPPAEE  742



>gb|AHA11129.1| chloroplast 4-hydroxy-3-methylbut-2-enyl diphosphate synthase 
[Picrorhiza kurrooa]
Length=748

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS+DAT++LH LPYSEEK SRVHAARRLFEYLSENSL+FPV+HHI+FPK IHRDDLVI A
Sbjct  542  KSTDATMILHELPYSEEKTSRVHAARRLFEYLSENSLEFPVVHHIQFPKAIHRDDLVIGA  601

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEA D DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  602  GTNAGGLLVDGLGDGILLEAHDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  661

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREK SHLPGVSIAIMGCIV+GPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  662  LQEISAEIREKISHLPGVSIAIMGCIVSGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  721

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALI LIKEHGRWVDPP +E
Sbjct  722  IAMEQATDALIQLIKEHGRWVDPPVDE  748



>ref|NP_001234648.1| GcpE [Solanum lycopersicum]
 ref|XP_010313199.1| PREDICTED: gcpE isoform X1 [Solanum lycopersicum]
 gb|AAO15447.1|AF435086_1 GcpE [Solanum lycopersicum]
Length=740

 Score =   367 bits (943),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KSSD T++LHNLPY+EEKI RV AARRLFEYLSENSL+FPVIHHI+FP + HRDDLVI A
Sbjct  534  KSSDVTMILHNLPYTEEKIGRVQAARRLFEYLSENSLNFPVIHHIQFPSNTHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+H RWVDPPTEE
Sbjct  714  IEMEHATDALIQLIKDHDRWVDPPTEE  740



>ref|XP_009592136.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009592137.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
Length=740

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS+D T++LHNLPY+EEKI RVHAARRLFEYLSENSL+FPVIHHI FP D HRDDLVI A
Sbjct  534  KSTDVTMILHNLPYTEEKIGRVHAARRLFEYLSENSLNFPVIHHIHFPSDTHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GANAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDPP EE
Sbjct  714  IQMEHATDALIQLIKDNGRWVDPPKEE  740



>gb|ADX06907.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Rauvolfia 
verticillata]
Length=740

 Score =   366 bits (939),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS DAT++LH+LP++EEKI RVHAARRLFEYLSENSL+FPVIHH++FPK IHRDDLVI A
Sbjct  534  KSLDATMILHDLPHTEEKIGRVHAARRLFEYLSENSLNFPVIHHMQFPKGIHRDDLVIRA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDGV+LEAPD DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSNAGALLVDGLGDGVMLEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  INMEHATDALIQLIKDHGRWVDPPAEE  740



>gb|AEM42998.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Siraitia 
grosvenorii]
Length=740

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++ H+L YSE+K+SRVHAARRLFEYL+EN+L+FPVIHHI+FPK IHRDDLVI A
Sbjct  534  KEIDATMLFHDLSYSEDKVSRVHAARRLFEYLAENALNFPVIHHIQFPKGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDGVLLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSNAGALLVDGLGDGVLLEAPDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRW+DPPTEE
Sbjct  714  IAMENATDALIQLIKDHGRWIDPPTEE  740



>gb|KHG03611.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Gossypium 
arboreum]
Length=740

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LHN+P+ EEKI RVHAARRLFEYLSENSLDFPVIHHI+FP   HRDDLVI+A
Sbjct  534  KDIDATMLLHNIPFDEEKIGRVHAARRLFEYLSENSLDFPVIHHIQFPNGTHRDDLVINA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IAMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_006340201.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Solanum tuberosum]
Length=740

 Score =   365 bits (937),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KSSD T++LHNLPY+EEKI RV AARRLFEYLSENSL+FPVIHHI+FP + HRDDLVI A
Sbjct  534  KSSDVTMILHNLPYTEEKIGRVQAARRLFEYLSENSLNFPVIHHIQFPSNTHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAP  DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPVKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDPPTEE
Sbjct  714  IEMEHATDALIQLIKDNGRWVDPPTEE  740



>emb|CDP07116.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   364 bits (934),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS+DAT++LH++PY+ EKI RVHAARRLFEYLSENSLDFPVIHHI+FP+ IHRDDLVI A
Sbjct  525  KSTDATMILHDIPYTVEKIGRVHAARRLFEYLSENSLDFPVIHHIQFPRAIHRDDLVIGA  584

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDGVLLEAP+ DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  585  GSNAGALLVDGLGDGVLLEAPEQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  644

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  645  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  704

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALI LIK++GRWV+P  EE
Sbjct  705  IAMEQATDALIQLIKDNGRWVEPSAEE  731



>gb|KJB26176.1| hypothetical protein B456_004G228600 [Gossypium raimondii]
Length=739

 Score =   364 bits (934),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LHN+P  EEKI RVHAARRLFEYLSENSLDFPVIHHI+FP   HRDDLVI+A
Sbjct  533  KDIDATMLLHNIPLDEEKIGRVHAARRLFEYLSENSLDFPVIHHIQFPNGTHRDDLVINA  592

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  593  GTNAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  652

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  653  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  712

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  713  IAMEHATDALIQLIKDHGRWVDPPAEE  739



>gb|KHN11204.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Glycine 
soja]
Length=741

 Score =   364 bits (934),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E+KISRVHAARRLFEYLS+NSL+FPVIHHI+FP  IHRDDLVI A
Sbjct  535  KGIDATMLLHDLPYTEDKISRVHAARRLFEYLSDNSLNFPVIHHIQFPNGIHRDDLVIGA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEAPD DF+FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GSDAGALLVDGLGDGLLLEAPDKDFEFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQE+SA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG PGKIDLYVGKTVVKR 
Sbjct  655  LQEVSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGTPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  715  IAMEHATNALIDLIKEHGRWVDPPAEE  741



>gb|KJB26175.1| hypothetical protein B456_004G228600 [Gossypium raimondii]
Length=740

 Score =   364 bits (934),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LHN+P  EEKI RVHAARRLFEYLSENSLDFPVIHHI+FP   HRDDLVI+A
Sbjct  534  KDIDATMLLHNIPLDEEKIGRVHAARRLFEYLSENSLDFPVIHHIQFPNGTHRDDLVINA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IAMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_003540178.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Glycine max]
 ref|XP_006592698.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Glycine max]
 ref|XP_006592699.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X3 [Glycine max]
Length=741

 Score =   364 bits (934),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E+KISRVHAARRLFEYLS+NSL+FPVIHHI+FP  IHRDDLVI A
Sbjct  535  KGIDATMLLHDLPYTEDKISRVHAARRLFEYLSDNSLNFPVIHHIQFPNGIHRDDLVIGA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEAPD DF+FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GSDAGALLVDGLGDGLLLEAPDKDFEFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQE+SA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG PGKIDLYVGKTVVKR 
Sbjct  655  LQEVSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGTPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  715  IAMEHATNALIDLIKEHGRWVDPPAEE  741



>gb|ACT64770.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Artemisia 
annua]
Length=617

 Score =   360 bits (924),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K++DAT++LH LPY+EEK  RVHAARRLFEYLSENSL+FPV+HHI+FPK I RDDLVISA
Sbjct  411  KTTDATMILHELPYAEEKTGRVHAARRLFEYLSENSLNFPVLHHIKFPKGIPRDDLVISA  470

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DF+FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  471  GANAGALLVDGLGDGILLEAPDQDFEFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  530

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R 
Sbjct  531  LQVISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRG  590

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  591  IAMEGATDALIQLIKDHGRWVDPPVEE  617



>ref|XP_007016723.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007016724.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY34342.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY34343.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
Length=740

 Score =   363 bits (933),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH++PY+E+KI RVHAARRLFEYLSEN+LDFPVIHHI+FP  IHRDDLVI+A
Sbjct  534  KGIDATMLLHDIPYNEDKIGRVHAARRLFEYLSENALDFPVIHHIQFPNGIHRDDLVINA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDGVLLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGVLLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IAMEHATDALIQLIKDHGRWVDPPAEE  740



>gb|AGQ04156.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Lavandula 
angustifolia]
Length=742

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  826  SSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAG  647
            ++DAT++LH++PYS+EK SRVHAARRLFEYLS+NSL+FPVIHHIEFP +IHRD+LVI AG
Sbjct  537  TTDATMILHHIPYSDEKTSRVHAARRLFEYLSDNSLNFPVIHHIEFPTEIHRDELVIGAG  596

Query  646  SNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDL  467
            +NAG LLVDGLGDG+LLEAPD +F+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDL
Sbjct  597  TNAGALLVDGLGDGILLEAPDQEFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDL  656

Query  466  QEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAI  287
            QEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR I
Sbjct  657  QEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGI  716

Query  286  AMDQATDALIDLIKEHGRWVDPPTEE  209
            AM+ ATDALI LIKEHGRWVDPP EE
Sbjct  717  AMEGATDALIQLIKEHGRWVDPPAEE  742



>ref|XP_002285130.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Vitis vinifera]
 emb|CBI16309.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   363 bits (932),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP +EEKISRVH+ARRLFEYLS+N+L+FPVIHHI+FPK IHRDDLVI A
Sbjct  534  KEVDATMILHDLPLTEEKISRVHSARRLFEYLSDNALNFPVIHHIQFPKGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAP+ DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPEQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IAMEHATDALIQLIKDHGRWVDPPAEE  740



>emb|CAN72185.1| hypothetical protein VITISV_005654 [Vitis vinifera]
Length=740

 Score =   363 bits (932),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP +EEKISRVH+ARRLFEYLS+N+L+FPVIHHI+FPK IHRDDLVI A
Sbjct  534  KEVDATMILHDLPLTEEKISRVHSARRLFEYLSDNALNFPVIHHIQFPKGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAP+ DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPEQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IAMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_003543457.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Glycine max]
Length=742

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E++ISRVHAARRLFEYLS+NSL+FPVIHHI+FP  IHRDDLVI A
Sbjct  536  KGVDATMLLHDLPYTEDRISRVHAARRLFEYLSDNSLNFPVIHHIQFPNGIHRDDLVIGA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEAPD DF+FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GSDAGALLVDGLGDGLLLEAPDKDFEFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQE+SA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG PGKIDLYVGKTVVKR 
Sbjct  656  LQEVSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGTPGKIDLYVGKTVVKRG  715

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  716  IAMEHATNALIDLIKEHGRWVDPPAEE  742



>gb|KHN21521.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Glycine 
soja]
Length=742

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E++ISRVHAARRLFEYLS+NSL+FPVIHHI+FP  IHRDDLVI A
Sbjct  536  KGVDATMLLHDLPYTEDRISRVHAARRLFEYLSDNSLNFPVIHHIQFPNGIHRDDLVIGA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEAPD DF+FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GSDAGALLVDGLGDGLLLEAPDKDFEFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQE+SA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG PGKIDLYVGKTVVKR 
Sbjct  656  LQEVSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGTPGKIDLYVGKTVVKRG  715

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  716  IAMEHATNALIDLIKEHGRWVDPPAEE  742



>ref|XP_008344871.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Malus domestica]
Length=201

 Score =   345 bits (885),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -3

Query  811  LVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGT  632
            ++LH+LP+ E+KISRVHAARRLFEYL +N+L+FPVIHHI+FP  IH DDLVI AG+NAG 
Sbjct  1    MILHDLPFGEDKISRVHAARRLFEYLGDNALNFPVIHHIQFPSGIHGDDLVIGAGTNAGA  60

Query  631  llvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA  452
            LLVDGLGDG+LLEAPD DFD++RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA
Sbjct  61   LLVDGLGDGLLLEAPDKDFDYLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA  120

Query  451  EIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQA  272
            +IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR I M+ A
Sbjct  121  QIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHA  180

Query  271  TDALIDLIKEHGRWVDPPTEE  209
            TDALI LIK+HGRWVDPP EE
Sbjct  181  TDALIQLIKDHGRWVDPPAEE  201



>ref|XP_004487120.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Cicer arietinum]
Length=740

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E+++SRVHAARRLFEYLS++SL+FPVIHHI+FP  IHRDDLVI A
Sbjct  534  KDVDATMLLHDLPYTEDRVSRVHAARRLFEYLSDSSLNFPVIHHIQFPNGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSHAGALLVDGLGDGLLLEAADKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQVISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  714  IAMEQATDALIDLIKEHGRWVDPPVEE  740



>ref|XP_010253662.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nelumbo nucifera]
 ref|XP_010253663.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nelumbo nucifera]
Length=740

 Score =   362 bits (928),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LHNLP +EE +SRVHAARRLFEYL++N+L+FPV+HH++FP+ IHRDDLVI A
Sbjct  534  KDVDATMLLHNLPSTEESVSRVHAARRLFEYLADNALNFPVVHHLQFPEGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDGVLLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSNAGALLVDGLGDGVLLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPPTEE
Sbjct  714  IEMEHATDALIQLIKDHGRWVDPPTEE  740



>ref|XP_004148774.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic [Cucumis sativus]
 ref|XP_011653452.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic [Cucumis sativus]
 gb|KGN64731.1| hypothetical protein Csa_1G084300 [Cucumis sativus]
Length=741

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K +DAT++ H+LPYSE+K+SRVHAARRLFEYLSEN L FPVIHHI+FP  +HRDDLVI A
Sbjct  535  KETDATMLFHDLPYSEDKVSRVHAARRLFEYLSENGLTFPVIHHIQFPNGVHRDDLVIGA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDGVLLEAPD DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GSNAGALLVDGLGDGVLLEAPDKDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  655  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ AT+ALI LIK++GRW +PPTEE
Sbjct  715  IAMENATEALIQLIKDNGRWAEPPTEE  741



>ref|XP_010535603.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Tarenaya hassleriana]
Length=743

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ D T++LH +P+ EEKISRVHAARRLFEYLS+NSLDFPVIHHI FPK  +RDDLVI A
Sbjct  535  KNVDVTMILHEVPFEEEKISRVHAARRLFEYLSDNSLDFPVIHHIHFPKGFNRDDLVIRA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG PGKIDLYVGKTVVKR 
Sbjct  655  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGTPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM +ATDALIDLIKEHGRWVDPPTE+
Sbjct  715  IAMAEATDALIDLIKEHGRWVDPPTED  741



>ref|XP_010043743.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85733.1| hypothetical protein EUGRSUZ_B02495 [Eucalyptus grandis]
Length=740

 Score =   360 bits (925),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS DAT++LHNLP +EEK SRVHAARRLFEYL EN+L FPVIHH++FP   HRDDLVI A
Sbjct  534  KSVDATMLLHNLPLNEEKTSRVHAARRLFEYLQENALTFPVIHHLQFPDGTHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDGVL+E PD D +F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGVLIEVPDQDLEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALI LIK+HGRWVDPP EE
Sbjct  714  IAMEQATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_007207209.1| hypothetical protein PRUPE_ppa002111mg [Prunus persica]
 gb|EMJ08408.1| hypothetical protein PRUPE_ppa002111mg [Prunus persica]
Length=715

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+K+SRVHAARRLFEYL +NSL+FPVIHHI+FP  IHRDDLVI+A
Sbjct  509  KGIDATMLLHDLPFSEDKVSRVHAARRLFEYLGDNSLNFPVIHHIQFPSGIHRDDLVIAA  568

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+N G LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  569  GTNVGALLVDGLGDGLLLEAPDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  628

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+RA
Sbjct  629  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVRRA  688

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  689  IEMEHATDALIQLIKDHGRWVDPPVEE  715



>gb|EYU36192.1| hypothetical protein MIMGU_mgv1a001893mg [Erythranthe guttata]
Length=743

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K++DA ++LH+LPY+EEK SRVHAARRLFEYLSE SL+FPVIHHI+FPK IHRDDLVI A
Sbjct  537  KTTDAIMILHDLPYTEEKTSRVHAARRLFEYLSEKSLNFPVIHHIQFPKGIHRDDLVIGA  596

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LL+AP  DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  597  GTNAGGLLVDGLGDGILLDAPHQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  656

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+RA
Sbjct  657  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRA  716

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWV+PP EE
Sbjct  717  IAMEHATDALIQLIKDHGRWVEPPAEE  743



>gb|EYU36193.1| hypothetical protein MIMGU_mgv1a001893mg [Erythranthe guttata]
Length=742

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K++DA ++LH+LPY+EEK SRVHAARRLFEYLSE SL+FPVIHHI+FPK IHRDDLVI A
Sbjct  536  KTTDAIMILHDLPYTEEKTSRVHAARRLFEYLSEKSLNFPVIHHIQFPKGIHRDDLVIGA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LL+AP  DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GTNAGGLLVDGLGDGILLDAPHQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+RA
Sbjct  656  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRA  715

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWV+PP EE
Sbjct  716  IAMEHATDALIQLIKDHGRWVEPPAEE  742



>ref|XP_008463938.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Cucumis melo]
 ref|XP_008463947.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Cucumis melo]
Length=741

 Score =   360 bits (924),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K +DAT++ H+LPYSE+K+SRVHAARRLFEYLSEN L FPVIHHI+FP  +HRDDLVI A
Sbjct  535  KETDATMLFHDLPYSEDKVSRVHAARRLFEYLSENGLTFPVIHHIQFPNGVHRDDLVIGA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDGVLLEA D DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GSNAGALLVDGLGDGVLLEAADKDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  655  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ AT+ALI LIK++GRWV+PPTEE
Sbjct  715  IAMENATEALIQLIKDNGRWVEPPTEE  741



>ref|XP_008349746.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
 ref|XP_008349747.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
Length=740

 Score =   359 bits (922),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+ E+KISRVHAARRLFEYL +N+L+FPVIHHI+FP  IHRDDLVI A
Sbjct  534  KGIDATMILHDLPFGEDKISRVHAARRLFEYLGDNALNFPVIHHIQFPSGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IEMEHATDALIQLIKDHGRWVDPPAEE  740



>dbj|BAF98296.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hevea brasiliensis]
Length=740

 Score =   359 bits (921),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP++E+KI RVHAARRLFE+LS+N+L+FPVIHHI+FP  IHRDDLVI A
Sbjct  534  KDIDATMILHDLPFTEDKIGRVHAARRLFEFLSDNALNFPVIHHIQFPNAIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ+ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQDISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IAMEGATDALIQLIKDHGRWVDPPAEE  740



>gb|AFQ98370.1| hydroxymethylbutenyl diphosphate synthase [Camellia sinensis]
Length=741

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT+VLH+LPY+E+KISRVHAARRLFE+LSEN+LD PVIHHI+FPK IHRDDLVI A
Sbjct  534  KNVDATMVLHDLPYTEDKISRVHAARRLFEFLSENALDLPVIHHIQFPKGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDGVLLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSNAGALLVDGLGDGVLLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IRE+TSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VVKR 
Sbjct  654  LQEISAQIREQTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKMVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDP  EE
Sbjct  714  IEMEHATDALIQLIKDNGRWVDPAAEE  740



>ref|XP_004295028.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Fragaria vesca subsp. vesca]
 ref|XP_011461710.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=740

 Score =   357 bits (916),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  D T++LH LPYSE+KISRVHAARRLFEYL +N L++PVIHHI FP  IHRDDLVISA
Sbjct  534  KRLDVTMLLHYLPYSEDKISRVHAARRLFEYLGDNGLNYPVIHHIHFPSGIHRDDLVISA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+N G LLVDGLGDG+LLEAPD DF+FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNVGALLVDGLGDGLLLEAPDKDFNFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IEMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_007150210.1| hypothetical protein PHAVU_005G135800g [Phaseolus vulgaris]
 gb|ESW22204.1| hypothetical protein PHAVU_005G135800g [Phaseolus vulgaris]
Length=740

 Score =   356 bits (914),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K +D T++LHNLPY+E+K+SR+HAARRLFE+LS NSL+FPVIHHI+FP   HRDDLVI A
Sbjct  534  KGADVTMILHNLPYTEDKVSRLHAARRLFEFLSNNSLNFPVIHHIQFPNGTHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEA D +F+FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSDAGALLVDGLGDGLLLEATDKEFEFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGTPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  714  IQMEHATNALIDLIKEHGRWVDPPVEE  740



>ref|XP_009335082.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009335083.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=740

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+ E+KISRVHAARRLFEYL +N+L FPVIHHI+FP  IH DDLVI A
Sbjct  534  KGIDATMILHDLPFGEDKISRVHAARRLFEYLGDNALSFPVIHHIQFPSGIHGDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IEMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_006424585.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 ref|XP_006424586.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 ref|XP_006488107.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X3 [Citrus sinensis]
 gb|ESR37825.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 gb|ESR37826.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
Length=741

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP++E+KI RV AARRLFEYLSEN+L+FPVIHHI+FP  IHRDDLVI A
Sbjct  535  KDIDATMILHDLPFNEDKIGRVQAARRLFEYLSENNLNFPVIHHIQFPNGIHRDDLVIGA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSN G LLVDGLGDG+LLEAP  DFDF+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GSNVGALLVDGLGDGLLLEAPGQDFDFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  655  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+QATDALI LIK+HGRW +PP EE
Sbjct  715  IAMEQATDALIQLIKDHGRWAEPPAEE  741



>ref|NP_001289212.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, chloroplastic 
[Pyrus x bretschneideri]
 gb|AHM26645.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase protein 
[Pyrus x bretschneideri]
Length=740

 Score =   355 bits (910),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+ E+KISRVHAARRLFEYL +N+L+FPVIHHI+FP  IH DDLVI A
Sbjct  534  KGIDATMILHDLPFGEDKISRVHAARRLFEYLGDNALNFPVIHHIQFPSGIHGDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFD++RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPDKDFDYLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IEMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_009367086.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009367087.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009367088.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
Length=740

 Score =   355 bits (910),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+ E+KISRVHAARRLFEYL +N+L+FPVIHHI+FP  IH DDLVI A
Sbjct  534  KGIDATMILHDLPFGEDKISRVHAARRLFEYLGDNALNFPVIHHIQFPSGIHGDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFD++RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPDKDFDYLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IEMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_012064829.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic [Jatropha curcas]
 ref|XP_012064830.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic [Jatropha curcas]
 gb|KDP44060.1| hypothetical protein JCGZ_05527 [Jatropha curcas]
Length=740

 Score =   354 bits (908),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP++E+KI RVHAARRLFE+LS+++L+FPVIHHI+FP  IHRDDLVI A
Sbjct  534  KDIDATMILHDLPFTEDKIGRVHAARRLFEFLSDHALNFPVIHHIQFPNAIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAP  DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPGQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IDMEGATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_011044361.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Populus euphratica]
 ref|XP_011044362.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Populus euphratica]
Length=740

 Score =   353 bits (907),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+KI RVH+ARRLFEYL+EN+L+ PVIHH++FPK IHRD+LVI A
Sbjct  534  KHIDATMLLHDLPFSEDKIGRVHSARRLFEYLAENALNVPVIHHLQFPKGIHRDELVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDGVL+EAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGVLVEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDPP EE
Sbjct  714  IEMEHATDALIQLIKDNGRWVDPPAEE  740



>ref|XP_010098198.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
 gb|EXB74654.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
Length=978

 Score =   359 bits (922),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+ E+K SRVHAARRLFEYLS+N+L+FPVIHHI FP  IHRDDLVI A
Sbjct  772  KGIDATMILHDLPFGEDKTSRVHAARRLFEYLSDNALNFPVIHHISFPNGIHRDDLVIGA  831

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSNAG LLVDGLGDGVLLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  832  GSNAGALLVDGLGDGVLLEAPDKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  891

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKT HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  892  LQEISAQIREKTLHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  951

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPPTEE
Sbjct  952  IEMEHATDALIQLIKDHGRWVDPPTEE  978



>ref|XP_010689558.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010689559.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=740

 Score =   353 bits (907),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH LP++EE +SRVHAARRLFEYLS+NSL+FPVIHHI+FP   HRDDLVI A
Sbjct  534  KEIDATMILHELPFTEENVSRVHAARRLFEYLSDNSLNFPVIHHIQFPSGTHRDDLVIRA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGVLLEA D DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGCLLVDGLGDGVLLEARDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  714  IAMEHATNALIDLIKEHGRWVDPPVEE  740



>gb|ABG75916.2| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Stevia 
rebaudiana]
Length=740

 Score =   353 bits (906),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS DAT++LH+LPYSEEK  RVHAARRLFEYLSENSL+FPV+HHI FPK + RD+LVI+A
Sbjct  534  KSIDATMILHDLPYSEEKTGRVHAARRLFEYLSENSLNFPVLHHITFPKGVPRDELVINA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LL+APD DF+FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GANAGALLVDGLGDGILLDAPDQDFEFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ ISAEIR+KTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R 
Sbjct  654  LQVISAEIRDKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ ATDALI LIK++GRWVDPP EE
Sbjct  714  IAMENATDALIQLIKDNGRWVDPPVEE  740



>ref|XP_006400831.1| hypothetical protein EUTSA_v10012774mg [Eutrema salsugineum]
 dbj|BAJ34115.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42284.1| hypothetical protein EUTSA_v10012774mg [Eutrema salsugineum]
Length=742

 Score =   353 bits (906),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH+LP++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  535  KNVDATMILHDLPFTEDKVSRVHAARRLFEFLSENSINFPVIHHINFPTGIHRDELVIHA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GTYAGALLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIR+KTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  655  LQEISAEIRDKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  715  IAMTEATDALISLIKEHGRWVDPPV  739



>dbj|BAB09833.1| GcpE protein [Arabidopsis thaliana]
Length=716

 Score =   352 bits (903),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  509  KNIDATMILHDVPFTEDKVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  568

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  569  GTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  628

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  629  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  688

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  689  IAMTEATDALIGLIKEHGRWVDPPV  713



>gb|AAO24774.1| GCPE protein [Catharanthus roseus]
Length=740

 Score =   352 bits (904),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ D T++LHNLP++EEKI RVHAARRLFEYLSENSL+FPVIHH++F   IHRDDLVI A
Sbjct  534  KNVDVTMILHNLPHTEEKIGRVHAARRLFEYLSENSLNFPVIHHMQFANAIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDGV+LEA D DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSDAGALLVDGLGDGVMLEAHDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP E+
Sbjct  714  IDMEHATDALIQLIKDHGRWVDPPAED  740



>ref|XP_010483710.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Camelina sativa]
Length=742

 Score =   352 bits (904),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+KISRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  535  KNIDATMILHDVPFTEDKISRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GTYAGALLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  655  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM  ATDALI LIKEHGRWVDPP 
Sbjct  715  IAMTGATDALIGLIKEHGRWVDPPV  739



>ref|XP_010443862.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Camelina sativa]
Length=741

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+KISRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  534  KNIDATMILHDVPFTEDKISRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGALLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM  ATDALI LIKEHGRWVDPP 
Sbjct  714  IAMTGATDALIGLIKEHGRWVDPPV  738



>gb|ACD70401.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase [Populus trichocarpa]
Length=680

 Score =   350 bits (899),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+KI RVH ARRLFEYL+EN+L+ PVIHH++FPK IHRD+LVI A
Sbjct  473  KHIDATMLLHDLPFSEDKIGRVHTARRLFEYLAENALNVPVIHHLQFPKGIHRDELVIGA  532

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDGVL+EAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  533  GTNAGALLVDGLGDGVLIEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  592

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  593  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  652

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDPP  E
Sbjct  653  IEMESATDALIQLIKDNGRWVDPPPAE  679



>ref|NP_200868.2| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 gb|AAO15446.1|AF434673_1 GcpE [Arabidopsis thaliana]
 gb|AED97354.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=740

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  533  KNIDATMILHDVPFTEDKVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  592

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  593  GTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  652

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  653  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  712

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  713  IAMTEATDALIGLIKEHGRWVDPPV  737



>ref|NP_851233.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 sp|F4K0E8.1|ISPG_ARATH RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic; AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase; AltName: Full=Protein 
CHLOROPLAST BIOGENESIS 4; AltName: Full=Protein CONSTITUTIVE 
SUBTILISIN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AED97353.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=741

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  534  KNIDATMILHDVPFTEDKVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  714  IAMTEATDALIGLIKEHGRWVDPPV  738



>gb|AAL91150.1| GcpE protein [Arabidopsis thaliana]
 gb|AAQ65096.1| At5g60600 [Arabidopsis thaliana]
Length=741

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  534  KNIDATMILHDVPFTEDKVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  714  IAMTEATDALIGLIKEHGRWVDPPV  738



>gb|AAM19840.1| AT5g60600/mup24_10 [Arabidopsis thaliana]
Length=741

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  534  KNIDATMILHDVPFTEDKVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  714  IAMTEATDALIGLIKEHGRWVDPPV  738



>ref|XP_006378969.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56766.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=708

 Score =   351 bits (900),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+KI RVH ARRLFEYL+EN+L+ PVIHH++FPK IHRD+LVI A
Sbjct  501  KHIDATMLLHDLPFSEDKIGRVHTARRLFEYLAENALNVPVIHHLQFPKGIHRDELVIGA  560

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDGVL+EAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  561  GTNAGALLVDGLGDGVLIEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  620

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  621  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  680

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDPP  E
Sbjct  681  IEMESATDALIQLIKDNGRWVDPPPAE  707



>gb|ABB78087.1| (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate synthase [Ginkgo 
biloba]
Length=741

 Score =   352 bits (902),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS D T++L NLP +E+KISRVHA+RRLFEYL E  L+FPVIHH+EFP   HRDDLVI+A
Sbjct  535  KSVDLTMILLNLPQTEKKISRVHASRRLFEYLQETGLNFPVIHHLEFPAGTHRDDLVINA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS AG LLVDGLGDG+LLEAPD DFDF+RNTSF LLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GSEAGALLVDGLGDGLLLEAPDQDFDFLRNTSFGLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKT+HLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGK VVKR 
Sbjct  655  LQEISAEIREKTAHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKEVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAMDQATDALI LIK+HGRWVDPP EE
Sbjct  715  IAMDQATDALIQLIKDHGRWVDPPVEE  741



>ref|XP_006378968.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56765.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=705

 Score =   350 bits (898),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+KI RVH ARRLFEYL+EN+L+ PVIHH++FPK IHRD+LVI A
Sbjct  498  KHIDATMLLHDLPFSEDKIGRVHTARRLFEYLAENALNVPVIHHLQFPKGIHRDELVIGA  557

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDGVL+EAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  558  GTNAGALLVDGLGDGVLIEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  617

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  618  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  677

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDPP  E
Sbjct  678  IEMESATDALIQLIKDNGRWVDPPPAE  704



>emb|CDY31531.1| BnaA10g13400D [Brassica napus]
Length=741

 Score =   351 bits (900),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  534  KNIDATMILHDVPFNEDKVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGALLVDGLGDGVMLEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  714  IAMSEATDALIGLIKEHGRWVDPPV  738



>ref|XP_006378966.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_006378967.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_002314268.2| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_006378970.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56763.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56764.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|EEE88223.2| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56767.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=741

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+KI RVH ARRLFEYL+EN+L+ PVIHH++FPK IHRD+LVI A
Sbjct  534  KHIDATMLLHDLPFSEDKIGRVHTARRLFEYLAENALNVPVIHHLQFPKGIHRDELVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDGVL+EAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGVLIEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK++GRWVDPP  E
Sbjct  714  IEMESATDALIQLIKDNGRWVDPPPAE  740



>ref|XP_002864694.1| hypothetical protein ARALYDRAFT_919295 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40953.1| hypothetical protein ARALYDRAFT_919295 [Arabidopsis lyrata subsp. 
lyrata]
Length=741

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS+ FPVIHHI FP  IHRD+LVI A
Sbjct  534  KNMDATMILHDVPFTEDKVSRVHAARRLFEFLSENSVSFPVIHHINFPTGIHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGALLVDGLGDGVMLEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  714  IAMTEATDALIGLIKEHGRWVDPPV  738



>ref|XP_010456601.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Camelina sativa]
Length=743

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ +AT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI+FP  IHRD+LVI A
Sbjct  536  KNIEATMILHDVPFTEDKVSRVHAARRLFEFLSENSVNFPVIHHIDFPTGIHRDELVIHA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GTYAGALLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  656  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  715

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM  ATDALI LIKEHGRWVDPP 
Sbjct  716  IAMTGATDALIGLIKEHGRWVDPPV  740



>ref|XP_009120594.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Brassica rapa]
Length=741

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS DAT++LH++P++E+ +SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  534  KSIDATMILHDVPFNEDNVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGALLVDGLGDGVMLEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  714  IAMSEATDALIGLIKEHGRWVDPPV  738



>ref|XP_008807336.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Phoenix dactylifera]
 ref|XP_008807344.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Phoenix dactylifera]
Length=743

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  814  TLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAG  635
            T++LHNLPY E+K+SR+HAARRLFEYL +N L+FPVIHHI+FP+ IHRDDLVI+AGS AG
Sbjct  542  TMLLHNLPYGEDKVSRIHAARRLFEYLEDNVLNFPVIHHIQFPEGIHRDDLVIAAGSYAG  601

Query  634  TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS  455
             LLVDGLGDGVLLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS
Sbjct  602  ALLVDGLGDGVLLEASDHDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS  661

Query  454  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQ  275
            A+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ 
Sbjct  662  AQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEH  721

Query  274  ATDALIDLIKEHGRWVDPPTEE  209
            AT+ALI LIK+HGRWVDPPT E
Sbjct  722  ATEALIQLIKDHGRWVDPPTNE  743



>ref|XP_008359197.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
Length=740

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+ E+K SRVHAARRLFEYL +N+L+ PVIHHI+FP  IH DDLVI A
Sbjct  534  KGIDATMILHDLPFGEDKXSRVHAARRLFEYLGDNALNXPVIHHIQFPSGIHGDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFD++RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAPDKDFDYLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  714  IEMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_006280064.1| hypothetical protein CARUB_v10025946mg [Capsella rubella]
 gb|EOA12962.1| hypothetical protein CARUB_v10025946mg [Capsella rubella]
Length=741

 Score =   350 bits (897),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP   HRD+LVI A
Sbjct  534  KNIDATMILHDVPFNEDKVSRVHAARRLFEFLSENSVNFPVIHHINFPTGTHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  654  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  713

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  714  IAMTEATDALIGLIKEHGRWVDPPV  738



>ref|XP_011040872.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Populus euphratica]
Length=247

 Score =   333 bits (855),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH LP SE+KI RVHAARRLFEYL++ +L  PVIHHI+FPK + RD+LVI A
Sbjct  41   KHVDATMILHVLPLSEDKIGRVHAARRLFEYLADKALSVPVIHHIQFPKGVRRDELVIGA  100

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G++AG  LVDGLGDGVL+EAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  101  GTDAGAFLVDGLGDGVLVEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  160

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  161  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  220

Query  289  IAMDQATDALIDLIKEHGRWVDPPTE  212
            I M+ AT ALI LIK++G WVDPP E
Sbjct  221  IEMEHATGALIQLIKDNGCWVDPPAE  246



>emb|CDY53637.1| BnaC09g54000D [Brassica napus]
Length=736

 Score =   349 bits (896),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+ +SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  529  KNIDATMILHDVPFNEDNVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  588

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DF+F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  589  GTYAGALLVDGLGDGVMLEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  648

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR 
Sbjct  649  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRG  708

Query  289  IAMDQATDALIDLIKEHGRWVDPPT  215
            IAM +ATDALI LIKEHGRWVDPP 
Sbjct  709  IAMSEATDALIGLIKEHGRWVDPPV  733



>ref|XP_009392271.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=745

 Score =   347 bits (890),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LH+LPYSE+K+SRVHAARRLFEYL  NSL+FPVIHH++FP+ IHRDDLVI AGS+
Sbjct  542  DITMLLHDLPYSEDKLSRVHAARRLFEYLEGNSLNFPVIHHLQFPEQIHRDDLVIMAGSS  601

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
            AG LLVDGLGDGVLLEA D +++F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  602  AGALLVDGLGDGVLLEASDQEYEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  661

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR IAM
Sbjct  662  ISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRGIAM  721

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + AT+ALI LIK+HGRWVDPP E+
Sbjct  722  EHATEALIQLIKDHGRWVDPPAED  745



>gb|AJA32313.1| chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase 
[Narcissus tazetta]
Length=745

 Score =   347 bits (889),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LHNLPYS+EKISRVHAARRLFEYL +N+L+FPVIHH++FP+   RD+LVI+AGS+
Sbjct  542  DITMLLHNLPYSDEKISRVHAARRLFEYLEDNTLNFPVIHHLQFPETTERDNLVIAAGSS  601

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
            AG LLVDGLGDGV+LEA D DF F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  602  AGALLVDGLGDGVMLEAADQDFGFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  661

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISA+IREKT HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR IAM
Sbjct  662  ISAQIREKTLHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIAM  721

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + AT+ALI LIK+HGRWVDPP EE
Sbjct  722  EHATEALIQLIKDHGRWVDPPVEE  745



>ref|XP_006854508.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Amborella trichopoda]
 gb|ERN15975.1| hypothetical protein AMTR_s00175p00057810 [Amborella trichopoda]
Length=741

 Score =   346 bits (888),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ D T++L+NLP +E+KISRVHAARRLF YL++N+L+FPVIHH++FP   HRDD+VI A
Sbjct  535  KNLDITMLLNNLPPTEDKISRVHAARRLFGYLADNALNFPVIHHLQFPSGAHRDDVVIGA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G++AG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GTDAGALLVDGLGDGLLLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  655  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  714

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I M  ATDALI LIK+HGRWVDPP+EE
Sbjct  715  IEMAHATDALIQLIKDHGRWVDPPSEE  741



>gb|AJA32314.1| chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase 
[Narcissus tazetta]
Length=745

 Score =   346 bits (888),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LHNLPYSEEKISRVHAARRLFEYL +N+L+FPVIHH++F +   RD+LVI+AGS+
Sbjct  542  DITMLLHNLPYSEEKISRVHAARRLFEYLEDNTLNFPVIHHLQFSEATERDNLVIAAGSS  601

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
            AG LLVDGLGDGV+LEA D DF F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  602  AGALLVDGLGDGVMLEAADQDFGFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  661

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISA+IREKT HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM
Sbjct  662  ISAQIREKTLHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  721

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + AT+ALI LIK+HGRWVDPP EE
Sbjct  722  EHATEALIQLIKDHGRWVDPPVEE  745



>ref|XP_010906493.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
 ref|XP_010906494.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
 ref|XP_010906496.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
Length=743

 Score =   346 bits (887),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  814  TLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAG  635
            T++LH+LPY E+KISR+HAARRLFEYL +N L+FPVIHHI+FP+ IHRDDLVI+AGS AG
Sbjct  542  TMLLHDLPYGEDKISRIHAARRLFEYLEDNVLNFPVIHHIQFPEGIHRDDLVITAGSYAG  601

Query  634  TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS  455
             LLVDGLGDGVLLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQ+IS
Sbjct  602  ALLVDGLGDGVLLEASDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQDIS  661

Query  454  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQ  275
            A+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ 
Sbjct  662  AQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEH  721

Query  274  ATDALIDLIKEHGRWVDPPTEE  209
            AT+ALI LIK++GRWVDPPT E
Sbjct  722  ATEALIQLIKDNGRWVDPPTNE  743



>gb|AAO72576.1| isoprenoid biosynthesis-like protein [Oryza sativa Japonica Group]
Length=608

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LH++PY EEK  RVHAARRLFEYL  N L+FPVIHHIEFPK ++RDDLVI AG+N
Sbjct  405  DITMLLHSVPYGEEKTGRVHAARRLFEYLETNGLNFPVIHHIEFPKSVNRDDLVIGAGAN  464

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGVLLEA D +F+F+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  465  VGALLVDGLGDGVLLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  524

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            +SA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R IAM
Sbjct  525  VSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAM  584

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + ATDALI LIK+HGRWVDPP EE
Sbjct  585  EGATDALIQLIKDHGRWVDPPVEE  608



>ref|XP_004487119.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Cicer arietinum]
Length=774

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 196/241 (81%), Gaps = 34/241 (14%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LPY+E+++SRVHAARRLFEYLS++SL+FPVIHHI+FP  IHRDDLVI A
Sbjct  534  KDVDATMLLHDLPYTEDRVSRVHAARRLFEYLSDSSLNFPVIHHIQFPNGIHRDDLVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS+AG LLVDGLGDG+LLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GSHAGALLVDGLGDGLLLEAADKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVS----------------------------------IAIMGCI  392
            LQ ISAEIREKTSHLPGVS                                  IAIMGCI
Sbjct  654  LQVISAEIREKTSHLPGVSVISPNLMLYNMRLHNKKCPLFYIIINNFCCFPHQIAIMGCI  713

Query  391  VNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            VNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR IAM+QATDALIDLIKEHGRWVDPP E
Sbjct  714  VNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEQATDALIDLIKEHGRWVDPPVE  773

Query  211  E  209
            E
Sbjct  774  E  774



>ref|NP_001047365.1| Os02g0603800 [Oryza sativa Japonica Group]
 sp|Q6K8J4.1|ISPG_ORYSJ RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic; AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD19354.1| putative GCPE protein [Oryza sativa Japonica Group]
 dbj|BAF09279.1| Os02g0603800 [Oryza sativa Japonica Group]
 dbj|BAH00163.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73552.1| hypothetical protein OsI_07973 [Oryza sativa Indica Group]
 gb|EEE57327.1| hypothetical protein OsJ_07430 [Oryza sativa Japonica Group]
Length=744

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LH++PY EEK  RVHAARRLFEYL  N L+FPVIHHIEFPK ++RDDLVI AG+N
Sbjct  541  DITMLLHSVPYGEEKTGRVHAARRLFEYLETNGLNFPVIHHIEFPKSVNRDDLVIGAGAN  600

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGVLLEA D +F+F+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  601  VGALLVDGLGDGVLLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  660

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            +SA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R IAM
Sbjct  661  VSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAM  720

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + ATDALI LIK+HGRWVDPP EE
Sbjct  721  EGATDALIQLIKDHGRWVDPPVEE  744



>ref|XP_006384896.1| hypothetical protein POPTR_0004s22010g [Populus trichocarpa]
 gb|ERP62693.1| hypothetical protein POPTR_0004s22010g [Populus trichocarpa]
Length=760

 Score =   342 bits (876),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            DAT++LH LP SE+KI RVHAARRLFEYL + +L  PVIHHI+FPK + RDDLVI AG++
Sbjct  557  DATMILHVLPLSEDKIGRVHAARRLFEYLVDKALSVPVIHHIQFPKGVRRDDLVIGAGTD  616

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
            AG LLVDGLGDGVL+EAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  617  AGALLVDGLGDGVLIEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  676

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR I M
Sbjct  677  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIEM  736

Query  280  DQATDALIDLIKEHGRWVDPPTE  212
            + ATDALI LIK++GRWVDPP E
Sbjct  737  EHATDALIQLIKDNGRWVDPPAE  759



>gb|ACL53652.1| unknown [Zea mays]
 gb|AFW72213.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=746

 Score =   340 bits (873),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LHN+PY EEK  RVHAARRLFEYL  N L+FPVIHHI FP+ I RD LVI AG+N
Sbjct  543  DITMLLHNVPYGEEKTGRVHAARRLFEYLQANGLNFPVIHHINFPETIDRDGLVIGAGAN  602

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGV LEA D +F+F+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  603  VGALLVDGLGDGVFLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  662

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+RAIAM
Sbjct  663  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRAIAM  722

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + ATDALI LIK+HGRWVDPP EE
Sbjct  723  EGATDALIQLIKDHGRWVDPPAEE  746



>gb|ACG47448.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=745

 Score =   340 bits (873),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LHN+PY EEK  RVHAARRLFEYL  N L+FPVIHHI FP+ I RD LVI AG+N
Sbjct  542  DITMLLHNVPYGEEKTGRVHAARRLFEYLQANGLNFPVIHHINFPETIDRDGLVIGAGAN  601

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGV LEA D +F+F+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  602  VGALLVDGLGDGVFLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  661

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+RAIAM
Sbjct  662  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRAIAM  721

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + ATDALI LIK+HGRWVDPP EE
Sbjct  722  EGATDALIQLIKDHGRWVDPPAEE  745



>gb|EPS62642.1| hypothetical protein M569_12144, partial [Genlisea aurea]
Length=182

 Score =   321 bits (823),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDF  575
            RRLFEYLSENSL+FPVIHHI+FPKD HRDDLVI AG+NAG LLVDGLGDG+LLEA D DF
Sbjct  1    RRLFEYLSENSLNFPVIHHIQFPKDTHRDDLVIGAGTNAGGLLVDGLGDGLLLEAADQDF  60

Query  574  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  395
            +FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC
Sbjct  61   EFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  120

Query  394  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  215
            IVNGPGEMADADFGYVGGAPGKIDLYVGKTV++R IAM+ AT+ALI LIK+HGRWVDPP 
Sbjct  121  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVLRRGIAMEHATEALIQLIKDHGRWVDPPV  180

Query  214  EE  209
            EE
Sbjct  181  EE  182



>ref|XP_006647487.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Oryza brachyantha]
Length=744

 Score =   338 bits (868),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LH++PY EEK  RVHA+RRLFEYL  N L+FPVIHHIEFP  I+RDDLVI AG+N
Sbjct  541  DITMLLHSVPYGEEKTGRVHASRRLFEYLETNGLNFPVIHHIEFPISINRDDLVIGAGAN  600

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGVLLEA D +F+F+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  601  VGALLVDGLGDGVLLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  660

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            +SA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R IAM
Sbjct  661  VSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAM  720

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + ATDALI LIK+HGRWVDPP EE
Sbjct  721  EGATDALIQLIKDHGRWVDPPVEE  744



>ref|NP_001105676.1| LOC542690 [Zea mays]
 gb|AAT70081.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
 gb|AAT70082.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=746

 Score =   338 bits (868),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LHN+PY EEK  RVHAARRLFEYL  N L+FPVIHHI FP+ I RD LVI AG+N
Sbjct  543  DITMLLHNVPYGEEKTGRVHAARRLFEYLQANGLNFPVIHHINFPETIDRDGLVIGAGAN  602

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGV LEA D +F+F+R+TSFNLLQGCRMRN KTEYVSCPSCGRTLFDLQE
Sbjct  603  VGALLVDGLGDGVFLEAADQEFEFLRDTSFNLLQGCRMRNAKTEYVSCPSCGRTLFDLQE  662

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+RAIAM
Sbjct  663  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRAIAM  722

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + ATDALI LIK+HGRWVDPP EE
Sbjct  723  EGATDALIQLIKDHGRWVDPPAEE  746



>gb|AHN91473.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Dendrobium 
catenatum]
Length=745

 Score =   338 bits (868),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K +D T++L  LPYSEEK+ RVH++RRLFEYL ENSL+ PVIHH++FP    RDDLVI A
Sbjct  539  KVADITMLLQCLPYSEEKVGRVHSSRRLFEYLQENSLNLPVIHHLQFPDGTERDDLVIGA  598

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS AG LLVDG GDG+L+EA D DFDF+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  599  GSEAGALLVDGFGDGILIEAQDHDFDFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  658

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ+ISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKR 
Sbjct  659  LQDISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRG  718

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            IAM+ AT+ALI LIK+HGRWVDPP EE
Sbjct  719  IAMEGATEALIQLIKDHGRWVDPPAEE  745



>ref|XP_003575307.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Brachypodium distachyon]
Length=744

 Score =   338 bits (868),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LHN+PY EEK  RVHAARRLFEYL  N L+FPVIHHI+FPK I RD LVI AGSN
Sbjct  541  DITMLLHNVPYGEEKTGRVHAARRLFEYLETNGLNFPVIHHIDFPKSIDRDGLVIGAGSN  600

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGVLLEA + +F+F+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  601  VGALLVDGLGDGVLLEATNQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  660

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R IAM
Sbjct  661  ISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAM  720

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + AT+ALI LIK+HGRWVDPP EE
Sbjct  721  EGATEALIQLIKDHGRWVDPPVEE  744



>ref|XP_002454137.1| hypothetical protein SORBIDRAFT_04g025290 [Sorghum bicolor]
 gb|EES07113.1| hypothetical protein SORBIDRAFT_04g025290 [Sorghum bicolor]
Length=746

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LHN+PY EEK  RVHAARRLFEYL  + L+FPVIHHI+FPK I RD LVI AG+N
Sbjct  543  DITMLLHNVPYGEEKTGRVHAARRLFEYLQASGLNFPVIHHIDFPKAIDRDGLVIGAGAN  602

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGVLLEA D +F+F+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  603  VGALLVDGLGDGVLLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  662

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R IAM
Sbjct  663  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAM  722

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + ATDALI LIK++GRWVDPP EE
Sbjct  723  EGATDALIQLIKDNGRWVDPPAEE  746



>ref|XP_004953020.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Setaria italica]
Length=746

 Score =   336 bits (862),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            D T++LHN+PY EE+  RVHAARRLFEYL  N L+FPVIHHI+FPK I RD LVI AG+N
Sbjct  543  DITMLLHNVPYGEERTGRVHAARRLFEYLQTNGLNFPVIHHIDFPKTIDRDALVIGAGAN  602

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGVLLEA D +F+F+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE
Sbjct  603  VGALLVDGLGDGVLLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  662

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R IAM
Sbjct  663  ISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAM  722

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + ATDALI LIK++GRWVDPP EE
Sbjct  723  EGATDALIQLIKDNGRWVDPPAEE  746



>ref|XP_008225843.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Prunus mume]
Length=749

 Score =   331 bits (849),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+K+SRVHAARRLFEYL +NSL+FPVIHHI+FP  IHRDDLVI+A
Sbjct  534  KGIDATMLLHDLPFSEDKVSRVHAARRLFEYLGDNSLNFPVIHHIQFPSGIHRDDLVIAA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEA D DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGLLLEAADKDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA
Sbjct  654  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  713

Query  289  IAMDQATDALIDL  251
            I M+ ATDALI L
Sbjct  714  IEMEHATDALIQL  726



>ref|XP_009803352.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like, partial [Nicotiana sylvestris]
Length=182

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -3

Query  751  RLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFD  572
            RLFEYLSENSL+FPVIHHI FP D HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFD
Sbjct  2    RLFEYLSENSLNFPVIHHIHFPNDTHRDDLVIGAGANAGALLVDGLGDGILLEAPDQDFD  61

Query  571  FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCI  392
            F+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCI
Sbjct  62   FLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCI  121

Query  391  VNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            VNGPGEMADADFGYVGGAPGKIDLYVGK VVKR I M+ ATDALI LIK++G WVDPP  
Sbjct  122  VNGPGEMADADFGYVGGAPGKIDLYVGKAVVKRGIQMEHATDALIQLIKDNGCWVDPPAA  181

Query  211  E  209
            E
Sbjct  182  E  182



>gb|AAS75817.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Nicotiana 
benthamiana]
Length=268

 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KS+D T++LH+LPY+EEKI RVHAARRLFEYLS+NSL+FPVIHHI FP D HRDDLVI A
Sbjct  94   KSTDVTMILHHLPYTEEKIGRVHAARRLFEYLSQNSLNFPVIHHIHFPNDTHRDDLVIGA  153

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  154  GANAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  213

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKT  305
            LQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLY GKT
Sbjct  214  LQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYDGKT  268



>ref|XP_001764903.1| predicted protein [Physcomitrella patens]
 gb|EDQ70345.1| predicted protein [Physcomitrella patens]
Length=618

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  D  ++LH LP  +E+ SRVHA+RRLFEYL  N+L+FPVIHHI+FP +I+RD+LVI A
Sbjct  411  KDLDLIMLLHYLPEGDERSSRVHASRRLFEYLQTNTLNFPVIHHIKFPANINRDELVIKA  470

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS  G +LVDGLGDGVLLEA D DFDF+R +SF +LQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  471  GSEVGAMLVDGLGDGVLLEASDLDFDFLRKSSFGMLQGCRMRNTKTEYVSCPSCGRTLFD  530

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ++SAEIREKT HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+R 
Sbjct  531  LQDVSAEIREKTDHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRG  590

Query  289  IAMDQATDALIDLIKEHGRWVDP-PTE  212
            IAM++ATD LI LIKEHGRWVDP PTE
Sbjct  591  IAMEKATDELIRLIKEHGRWVDPEPTE  617



>ref|XP_001766565.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Physcomitrella 
patens]
 gb|EDQ68630.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Physcomitrella 
patens]
Length=691

 Score =   320 bits (819),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 178/207 (86%), Gaps = 1/207 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  D  ++L  LP  +EK S VHA+R+LFEYL  N LDFPVIHH++FP + HRDDLVI A
Sbjct  484  KDLDLIMLLQYLPEGDEKSSHVHASRKLFEYLQTNKLDFPVIHHLKFPANTHRDDLVIKA  543

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS AG +LVDGLGDG++LEA D DFDFIRNTSF +LQGCRMR+TKTEYVSCPSCGRTLFD
Sbjct  544  GSEAGAMLVDGLGDGIMLEAADQDFDFIRNTSFGMLQGCRMRHTKTEYVSCPSCGRTLFD  603

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQEISAEIREKT HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+R 
Sbjct  604  LQEISAEIREKTDHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRG  663

Query  289  IAMDQATDALIDLIKEHGRWVDP-PTE  212
            IAM  AT+ LI LIKEHGRWVDP PTE
Sbjct  664  IAMAMATNELIGLIKEHGRWVDPEPTE  690



>ref|XP_002973473.1| hypothetical protein SELMODRAFT_149035 [Selaginella moellendorffii]
 gb|EFJ25847.1| hypothetical protein SELMODRAFT_149035 [Selaginella moellendorffii]
Length=690

 Score =   313 bits (802),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 177/203 (87%), Gaps = 1/203 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DA ++L N P+ EE +S VH ARRL EYL  NSL FPVIH++EF + + RDD VI A
Sbjct  484  KTVDAVMLLLNSPH-EETVSHVHNARRLLEYLQSNSLSFPVIHNLEFKQGLRRDDFVIKA  542

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS AG LLVDGLGDG+LL+A D DFDF+R+TSF LLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  543  GSEAGALLVDGLGDGILLDAADQDFDFVRSTSFGLLQGCRMRNTKTEYVSCPSCGRTLFD  602

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ++SAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VVKR 
Sbjct  603  LQDVSAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKQVVKRG  662

Query  289  IAMDQATDALIDLIKEHGRWVDP  221
            IA DQATDALI LIK+HGRWVDP
Sbjct  663  IAKDQATDALIQLIKDHGRWVDP  685



>ref|XP_002986683.1| hypothetical protein SELMODRAFT_158184 [Selaginella moellendorffii]
 gb|EFJ12246.1| hypothetical protein SELMODRAFT_158184 [Selaginella moellendorffii]
Length=690

 Score =   313 bits (801),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 177/203 (87%), Gaps = 1/203 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DA ++L N P+ EE +S VH ARRL EYL  NSL FPVIH++EF + + RDD VI A
Sbjct  484  KTVDAVMLLLNSPH-EETVSHVHNARRLLEYLQSNSLSFPVIHNLEFKQGLRRDDFVIKA  542

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS AG LLVDGLGDG+LL+A D DFDF+R+TSF LLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  543  GSEAGALLVDGLGDGILLDAADQDFDFVRSTSFGLLQGCRMRNTKTEYVSCPSCGRTLFD  602

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ++SAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VVKR 
Sbjct  603  LQDVSAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKQVVKRG  662

Query  289  IAMDQATDALIDLIKEHGRWVDP  221
            IA DQATDALI LIK+HGRWVDP
Sbjct  663  IAKDQATDALIQLIKDHGRWVDP  685



>ref|XP_001755871.1| predicted protein [Physcomitrella patens]
 gb|EDQ79156.1| predicted protein [Physcomitrella patens]
Length=687

 Score =   305 bits (781),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 178/207 (86%), Gaps = 4/207 (2%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  D  ++L  +P  +EK SRVHA   LFEYL  N ++FPVIHH++FP + HRDDLVI +
Sbjct  483  KDLDLIMLLLYIPEGDEKSSRVHA---LFEYLQTNDINFPVIHHLKFPANTHRDDLVIKS  539

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS AG +LVDGLGDGVLLEA D DFDF+RNTSF +LQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  540  GSEAGAMLVDGLGDGVLLEAADLDFDFLRNTSFGMLQGCRMRNTKTEYVSCPSCGRTLFD  599

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ++SAEIREKT HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+R 
Sbjct  600  LQDVSAEIREKTDHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRG  659

Query  289  IAMDQATDALIDLIKEHGRWVDP-PTE  212
            IAM++AT+ LI LIKEHGRWVDP P+E
Sbjct  660  IAMEKATNELIGLIKEHGRWVDPEPSE  686



>ref|XP_002530286.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Ricinus communis]
 gb|EEF32093.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Ricinus communis]
Length=716

 Score =   304 bits (779),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP +E+KI RVHAARRLFE+LS+NSL+FPVIHHI FP  IHRDDLVI A
Sbjct  536  KQIDATMILHDLPNTEDKIGRVHAARRLFEFLSDNSLNFPVIHHINFPNGIHRDDLVIGA  595

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  596  GANAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  655

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTV  302
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK V
Sbjct  656  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKRV  711



>gb|KDO73263.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
Length=240

 Score =   289 bits (740),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP++E+KI RV AARRLFEYLSEN+L+FPVIHHI+FP  IHRDDLVI A
Sbjct  69   KDIDATMILHDLPFNEDKIGRVQAARRLFEYLSENNLNFPVIHHIQFPNGIHRDDLVIGA  128

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+N G LLVDGLGDG+LLEAP  DFDF+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  129  GTNVGALLVDGLGDGLLLEAPGQDFDFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  188

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDL  320
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDL
Sbjct  189  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDL  238



>gb|ABV02021.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Nicotiana 
langsdorffii x Nicotiana sanderae]
Length=164

 Score =   284 bits (727),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  700  HIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRN  521
            HI FP D HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRN
Sbjct  1    HIHFPNDTHRDDLVIGAGANAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRN  60

Query  520  TKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG  341
            TKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG
Sbjct  61   TKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG  120

Query  340  APGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  209
            APGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP EE
Sbjct  121  APGKIDLYVGKTVVKRGIQMEHATDALIQLIKDNGRWVDPPAEE  164



>ref|XP_006488105.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006488106.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Citrus sinensis]
Length=751

 Score =   299 bits (766),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP++E+KI RV AARRLFEYLSEN+L+FPVIHHI+FP  IHRDDLVI A
Sbjct  535  KDIDATMILHDLPFNEDKIGRVQAARRLFEYLSENNLNFPVIHHIQFPNGIHRDDLVIGA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSN G LLVDGLGDG+LLEAP  DFDF+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GSNVGALLVDGLGDGLLLEAPGQDFDFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTV  302
            LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK +
Sbjct  655  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKVL  710



>emb|CDY53636.1| BnaC09g53990D [Brassica napus]
Length=183

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  673  RDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCP  494
            RD+LVI AG+ AG LLVDGLGDGV+LEAPD DF+F+RNTSFNLLQGCRMRNTKTEYVSCP
Sbjct  17   RDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCP  76

Query  493  SCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYV  314
            SCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYV
Sbjct  77   SCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYV  136

Query  313  GKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  218
            GKTVVKR IAM +ATDALI LIKEH RWVDPP
Sbjct  137  GKTVVKRGIAMSEATDALIGLIKEHDRWVDPP  168



>gb|AHG98060.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Plectranthus barbatus]
Length=154

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  691  FPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKT  512
            FP  IHRD+LVI AGSNAG LLVDGLGDG+LLEAPD +F+F+RNTSFNLLQGCRMRNTKT
Sbjct  4    FPSAIHRDELVIGAGSNAGGLLVDGLGDGILLEAPDQEFEFLRNTSFNLLQGCRMRNTKT  63

Query  511  EYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPG  332
            EY SCPSCG TLFDLQEISAEIRE+TSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPG
Sbjct  64   EYASCPSCGGTLFDLQEISAEIRERTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPG  123

Query  331  KIDLYVGKTVVKRAIAMDQATDALIDLIKEH  239
            KIDLYVGKTVVKR IAM+ AT ALI+LIKEH
Sbjct  124  KIDLYVGKTVVKRGIAMEYATTALIELIKEH  154



>ref|XP_005650225.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE25681.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Coccomyxa subellipsoidea C-169]
Length=748

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 158/203 (78%), Gaps = 3/203 (1%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            + S A L L N+      +SRVHA+RR FE L  + +D PVIH   FP  + RD+LV+++
Sbjct  527  RDSGAVLALLNVAPG---VSRVHASRRFFERLQSHDIDIPVIHQRVFPAGVSRDELVLTS  583

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+  G LLVDGLGDGV +E P  D DF+R  SF LLQG RMRNTKTEYVSCPSCGRTLFD
Sbjct  584  GTEIGALLVDGLGDGVAIECPSEDLDFLRTMSFGLLQGSRMRNTKTEYVSCPSCGRTLFD  643

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQE++ +IR +T HLPGVSIA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+R 
Sbjct  644  LQEVTEQIRTQTGHLPGVSIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRG  703

Query  289  IAMDQATDALIDLIKEHGRWVDP  221
            I MD A D L++LIKEHGRW +P
Sbjct  704  IPMDGACDQLVELIKEHGRWKEP  726



>ref|XP_001690937.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydomonas 
reinhardtii]
 gb|EDP05383.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydomonas 
reinhardtii]
Length=681

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = -3

Query  787  SEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgd  608
            +++ +SR+H++RR+F+ L  + +  PVIH I FP    RD++VI+ GS  G LLVDGLGD
Sbjct  480  TKDGVSRLHSSRRVFDVLKRHGITTPVIHRITFPAGTVRDEIVITTGSLVGGLLVDGLGD  539

Query  607  gvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSH  428
            G ++E P  D DF+R T+F LLQGCRMRN KTEYVSCPSCGRTLF+LQE++ +IR +T H
Sbjct  540  GAMVECPGEDTDFLRTTAFGLLQGCRMRNIKTEYVSCPSCGRTLFNLQEVTDQIRTRTGH  599

Query  427  LPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLI  248
            LPGV+IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+R I M+ A D LI+LI
Sbjct  600  LPGVAIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRGIPMESACDQLIELI  659

Query  247  KEHGRWVDPPTEE*YHHLMFT  185
            KEHGRWV+P  EE    L+ T
Sbjct  660  KEHGRWVEPAVEEESKELVAT  680



>gb|AAX54905.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Chlamydomonas reinhardtii]
Length=681

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = -3

Query  787  SEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgd  608
            +++ +SR+H++RR+F+ L  + +  PVIH I FP    RD++VI+ GS  G LLVDGLGD
Sbjct  480  TKDGVSRLHSSRRVFDVLKRHGITTPVIHRITFPAGTVRDEIVITTGSLVGGLLVDGLGD  539

Query  607  gvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSH  428
            G ++E P  D DF+R T+F LLQGCRMRN KTEYVSCPSCGRTLF+LQE++ +IR +T H
Sbjct  540  GAMVECPGEDTDFLRTTAFGLLQGCRMRNIKTEYVSCPSCGRTLFNLQEVTDQIRTRTGH  599

Query  427  LPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLI  248
            LPGV+IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+R I M+ A D LI+LI
Sbjct  600  LPGVAIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRGIPMESACDQLIELI  659

Query  247  KEHGRWVDPPTEE*YHHLMFT  185
            KEHGRWV+P  EE    L+ T
Sbjct  660  KEHGRWVEPAVEEESKELVAT  680



>ref|XP_005841109.1| hypothetical protein GUITHDRAFT_63981 [Guillardia theta CCMP2712]
 gb|EKX54129.1| hypothetical protein GUITHDRAFT_63981 [Guillardia theta CCMP2712]
Length=679

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 166/207 (80%), Gaps = 4/207 (2%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            KSS+A ++L  +P   +++SRVHA+RR+F +L ENS+D PVIHHI F  D  RD +V+  
Sbjct  471  KSSEAVMLLLRVP---DEVSRVHASRRVFNFLKENSIDTPVIHHIVFGADKSRDYVVLLT  527

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GS  G  LVDG GDGVL++AP    DF+R +SF LLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  528  GSEVGCSLVDGNGDGVLMQAP-LPLDFLRLSSFGLLQGCRMRNTKTEYVSCPSCGRTLFD  586

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQ ++ +I + T HLPGV+IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK +V++A
Sbjct  587  LQTVTDQISKATGHLPGVTIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKELVRKA  646

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            I  ++A D LI+LIKE+GRWV+P   E
Sbjct  647  IPSEKACDELIELIKENGRWVEPSKNE  673



>gb|KIZ04819.1| hypothetical protein MNEG_3143 [Monoraphidium neglectum]
Length=541

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            SRVHA+RR+F+ L +  +  PV+HHI F +   RD++VI+ GS  G LLVDGLGDG ++E
Sbjct  343  SRVHASRRVFQALKDAGVTIPVVHHIRFGEGAVRDEIVINTGSMVGGLLVDGLGDGAMIE  402

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            AP  D +F+R T+F LLQG RMRN KTEYVSCPSCGRTLFDLQE++ +IR+KT HLPGV+
Sbjct  403  APHEDPEFLRTTAFGLLQGSRMRNIKTEYVSCPSCGRTLFDLQEVTEQIRQKTGHLPGVA  462

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VVKRAI M+ A D L+ LIK++GR
Sbjct  463  IAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVKRAIPMESACDQLVQLIKDNGR  522

Query  232  WVDPP  218
            WV+PP
Sbjct  523  WVEPP  527



>ref|XP_002953482.1| hypothetical protein VOLCADRAFT_63610 [Volvox carteri f. nagariensis]
 gb|EFJ45455.1| hypothetical protein VOLCADRAFT_63610 [Volvox carteri f. nagariensis]
Length=679

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlL  596
            +SR+HA+RR+F+ +  +++  PVIH+I FP   HRD++VI+ GS  G LLVDGLGDG L+
Sbjct  480  VSRLHASRRVFDAIKRHNVTAPVIHNIRFPAGTHRDEIVINTGSLVGGLLVDGLGDGALI  539

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            E P  D DF+R T+F LLQG RMRNTKTEYVSCPSCGRTLF+LQE++ +IR++T HLPGV
Sbjct  540  ECPGEDLDFLRTTAFGLLQGSRMRNTKTEYVSCPSCGRTLFNLQEVTDQIRQRTGHLPGV  599

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
            +IA+MGCIVNGPG MADADFGYVGGAPGKIDLYVGK VV+RAI M+ A D LI+LIKE+G
Sbjct  600  AIAVMGCIVNGPGRMADADFGYVGGAPGKIDLYVGKEVVRRAIPMESACDQLIELIKEYG  659

Query  235  RW  230
            RW
Sbjct  660  RW  661



>gb|EMT15013.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Aegilops 
tauschii]
Length=723

 Score =   254 bits (648),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 156/204 (76%), Gaps = 19/204 (9%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            + T++LHN+PY EEK  RVHAARRLFEYL  N L+FPVIHHI+FPK I RD LVI AGSN
Sbjct  539  NITMLLHNIPYGEEKTGRVHAARRLFEYLETNGLNFPVIHHIDFPKSIDRDGLVIGAGSN  598

Query  640  AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             G LLVDGLGDGVLLEA   +F+F+R+TSFNLLQGCRMRNTKT                 
Sbjct  599  VGALLVDGLGDGVLLEAASQEFEFLRDTSFNLLQGCRMRNTKT-----------------  641

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
               +    + +L    IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R IAM
Sbjct  642  --VKHWPDSLYLCSWQIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAM  699

Query  280  DQATDALIDLIKEHGRWVDPPTEE  209
            + AT+ALI LIK+HGRWVDPPT+E
Sbjct  700  EGATEALIQLIKDHGRWVDPPTDE  723



>gb|EMS56222.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Triticum 
urartu]
Length=665

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 152/202 (75%), Gaps = 33/202 (16%)
 Frame = -3

Query  814  TLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAG  635
            T++LHN+PY EEK  RVHAARRLFEYL  + L+FPVIHHI+FPK I RD LVI AGSN G
Sbjct  497  TMLLHNVPYGEEKTGRVHAARRLFEYLETSGLNFPVIHHIDFPKSIDRDGLVIGAGSNVG  556

Query  634  TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS  455
             LLVDGLGDGVLLEA + +F+F+R+TSFNLLQGCRMRNTKT                   
Sbjct  557  ALLVDGLGDGVLLEAGNQEFEFLRDTSFNLLQGCRMRNTKT-------------------  597

Query  454  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQ  275
                          IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ 
Sbjct  598  --------------IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEG  643

Query  274  ATDALIDLIKEHGRWVDPPTEE  209
            AT+ALI LIK+HGRWVDPPTEE
Sbjct  644  ATEALIQLIKDHGRWVDPPTEE  665



>ref|XP_011400578.1| 26S proteasome non-ATPase regulatory subunit 1 [Auxenochlorella 
protothecoides]
 gb|KFM27595.1| 26S proteasome non-ATPase regulatory subunit 1 [Auxenochlorella 
protothecoides]
Length=1584

 Score =   259 bits (662),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = -3

Query  820   DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
             DATLVL  +      +SRVHA+RR+FE L+      PV+H +EF     R++LV+SAG+ 
Sbjct  1371  DATLVLLRV---APGVSRVHASRRVFEALTRARCHLPVVHALEFAPGTGREELVLSAGAL  1427

Query  640   AGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
              G L+VDG GDGV+L AP  D  ++R TSF LLQG RMRNTKT+YVSCPSCGRTLFDLQE
Sbjct  1428  VGALMVDGRGDGVMLSAPGQDLAYLRTTSFGLLQGVRMRNTKTDYVSCPSCGRTLFDLQE  1487

Query  460   ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
             ++ +IR+KT HLPGV+IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+RAI M
Sbjct  1488  VTDQIRQKTGHLPGVAIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRAIPM  1547

Query  280   DQATDALIDLIKEHGRWVD  224
             + A D L++LIKEHGRW D
Sbjct  1548  ESACDQLVELIKEHGRWKD  1566



>ref|XP_002506236.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67494.1| predicted protein [Micromonas sp. RCC299]
Length=697

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlL  596
            +SR+HA+RRLF  +       PVIHHI+F     +DD+VI +GS  G LL DGLGDGVL+
Sbjct  504  VSRLHASRRLFTNILAAGSSVPVIHHIQFTDADVKDDIVIQSGSQVGGLLCDGLGDGVLI  563

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            E P ++ D++R TSF LLQG RMRNTKTEYVSCPSCGRTLFDLQE++A I E+T HLPGV
Sbjct  564  EHPTAELDYLRRTSFGLLQGSRMRNTKTEYVSCPSCGRTLFDLQEVTAAISERTGHLPGV  623

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
            +IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VVKR I  D A D LI LIK+HG
Sbjct  624  AIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVKRGIDNDTACDELIQLIKDHG  683

Query  235  RWVD  224
            RWVD
Sbjct  684  RWVD  687



>ref|XP_003081089.1| putative chloroplast 1-hydroxy-2-methyl-2-(ISS) [Ostreococcus 
tauri]
 emb|CAL55258.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial-type 
[Ostreococcus tauri]
Length=726

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 158/210 (75%), Gaps = 8/210 (4%)
 Frame = -3

Query  826  SSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAG  647
            +SDA + L      E   SR+H++RRLFE ++      PVIHH+  P    R D+VI +G
Sbjct  518  ASDAVMALIKTKDGE---SRLHSSRRLFEEIANCGGKLPVIHHMFMPSG-DRSDVVIQSG  573

Query  646  SNAGTllvdglgdgvlLE----APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRT  479
            +  G LL DGLGDGVL++    A D   DF+R TSF LLQG RMRNTKTEYVSCPSCGRT
Sbjct  574  AQIGGLLCDGLGDGVLIQYTGAAKDISLDFLRTTSFGLLQGSRMRNTKTEYVSCPSCGRT  633

Query  478  LFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV  299
            LFDLQE++A+I+EKT HLPGV+IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV
Sbjct  634  LFDLQEVTAQIQEKTGHLPGVAIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVV  693

Query  298  KRAIAMDQATDALIDLIKEHGRWVDPPTEE  209
            +R IA + A D LI+LIKEHGRW D   EE
Sbjct  694  RRGIASEVACDELIELIKEHGRWKDKEVEE  723



>ref|XP_001419500.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
chloroplast precursor (1-hydroxy-2-methyl-2-(E)-butenyl  4-diphosphate 
synthase) (ISPG) [Ostreococcus lucimarinus CCE9901]
 gb|ABO97793.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
chloroplast precursor (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate 
synthase) (ISPG) [Ostreococcus lucimarinus CCE9901]
Length=680

 Score =   244 bits (624),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 159/210 (76%), Gaps = 8/210 (4%)
 Frame = -3

Query  826  SSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAG  647
            +SDA +VL      E   SR+H++RR+ E +++     PVIHH+  P    + D+VI +G
Sbjct  471  ASDAVMVLIKTKDGE---SRLHSSRRIAEVMAQVGAKMPVIHHMYMPTG-DKSDIVIQSG  526

Query  646  SNAGTllvdglgdgvlLEAPDSD----FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRT  479
            S  G LLVDG GDGVL++   SD     DF+R TSF LLQG RMRNTKTEYVSCPSCGRT
Sbjct  527  SQVGGLLVDGFGDGVLIQYAGSDKDVSLDFLRTTSFGLLQGSRMRNTKTEYVSCPSCGRT  586

Query  478  LFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV  299
            LFDLQE++A+I+EKT HLPGV+IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV
Sbjct  587  LFDLQEVTAQIQEKTGHLPGVAIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVV  646

Query  298  KRAIAMDQATDALIDLIKEHGRWVDPPTEE  209
            KR IAM+ A D LI LIK++ RW++   EE
Sbjct  647  KRGIAMETACDELIQLIKDNDRWIEKEVEE  676



>emb|CBJ30926.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase, chloroplast 
precursor [Ectocarpus siliculosus]
Length=695

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 157/202 (78%), Gaps = 6/202 (3%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFP--KDIHRDDLVISAGSNAGT  632
            L N+P     +SRVHA+RR+F++L++   D  VIH   FP   ++ +D  ++S G+  G 
Sbjct  492  LLNVPAG---VSRVHASRRVFQHLADAKNDLAVIHLASFPDASEMTQDKFILSVGAQVGG  548

Query  631  llvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA  452
             LVDGLGDGV+++AP  D   +R+  F LLQGCRMRNTKTEYVSCPSCGRTLFDLQE++A
Sbjct  549  CLVDGLGDGVMVQAPGLDVGMLRSVCFGLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVTA  608

Query  451  EIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQA  272
            +I EKT HLPGV+IAIMGCIVNG GEMADADFGYVGGAPGK+DLYVGK +V++ I  ++A
Sbjct  609  QIAEKTGHLPGVAIAIMGCIVNGVGEMADADFGYVGGAPGKVDLYVGKEMVQKGIPNEEA  668

Query  271  TDALIDLIKEHGRWVDP-PTEE  209
             DALIDLIK +GRWVD  P EE
Sbjct  669  CDALIDLIKANGRWVDKEPAEE  690



>gb|ABG74579.1| isoprenoid biosynthesis-like protein [Musa acuminata AAA Group]
Length=120

 Score =   226 bits (575),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            EA D +++F+RNTSFNLLQGCRMRNTK EYVSCPSCGRTLFDLQEISA+IREKTSHLPGV
Sbjct  3    EASDQEYEFLRNTSFNLLQGCRMRNTKAEYVSCPSCGRTLFDLQEISAQIREKTSHLPGV  62

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKE  242
            SIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR IAM+ AT+ALI LIKE
Sbjct  63   SIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRGIAMEHATEALIQLIKE  120



>ref|XP_003056663.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58308.1| predicted protein [Micromonas pusilla CCMP1545]
Length=732

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlL  596
            +SR+HA+RR+FE++       PVIH+++F     +D +VI +G+ AG LL DGLGDGV++
Sbjct  538  VSRLHASRRVFEWMHRAGSAVPVIHNMQFDASAEKDTVVIESGAQAGGLLCDGLGDGVVV  597

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            E P     ++R TSF LLQG RMRNTKTEYVSCPSCGRTLFDLQE++A I E+T HLPGV
Sbjct  598  EHPGVPLSYLRTTSFGLLQGSRMRNTKTEYVSCPSCGRTLFDLQEVTAAISERTGHLPGV  657

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
            +IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VVKR I  D A D LI LIK+HG
Sbjct  658  AIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVKRGIDNDTACDELIQLIKDHG  717

Query  235  RW  230
            RW
Sbjct  718  RW  719



>ref|XP_007510861.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18394.1| predicted protein [Bathycoccus prasinos]
Length=745

 Score =   241 bits (616),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 156/206 (76%), Gaps = 7/206 (3%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DA ++L     +E+  SR+H++RR+FE L  N +  PVIHH     D  + D+VI  
Sbjct  536  KDIDAIMLLIQ---TEKGRSRIHSSRRIFEVLQANGVKIPVIHHKHIV-DGDKSDVVIQC  591

Query  649  GSNAGTllvdglgdgvlLEAPDSD---FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRT  479
            G+  G LL DG GDGVLLE   ++     F+R TSF LLQG RMRNTKTEYVSCPSCGRT
Sbjct  592  GAQVGGLLCDGNGDGVLLEYVGNEKIPLSFLRTTSFGLLQGSRMRNTKTEYVSCPSCGRT  651

Query  478  LFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV  299
            LFDLQE++A+I EKT HLPGV+IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV
Sbjct  652  LFDLQEVTAQIAEKTGHLPGVAIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVV  711

Query  298  KRAIAMDQATDALIDLIKEHGRWVDP  221
            +R I M+ AT+ LI+LIKEH RWV+P
Sbjct  712  RRGIPMEGATEELIELIKEHDRWVEP  737



>ref|XP_006378965.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56762.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=678

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP+SE+KI RVH ARRLFEYL+EN+L+ PVIHH++FPK IHRD+LVI A
Sbjct  534  KHIDATMLLHDLPFSEDKIGRVHTARRLFEYLAENALNVPVIHHLQFPKGIHRDELVIGA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+NAG LLVDGLGDGVL+EAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTNAGALLVDGLGDGVLIEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSI  410
            LQEISA+IREKTSHLPGVS+
Sbjct  654  LQEISAQIREKTSHLPGVSV  673



>ref|XP_006424584.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 gb|ESR37824.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
Length=676

 Score =   226 bits (575),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K  DAT++LH+LP++E+KI RV AARRLFEYLSEN+L+FPVIHHI+FP  IHRDDLVI A
Sbjct  535  KDIDATMILHDLPFNEDKIGRVQAARRLFEYLSENNLNFPVIHHIQFPNGIHRDDLVIGA  594

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            GSN G LLVDGLGDG+LLEAP  DFDF+R+TSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  595  GSNVGALLVDGLGDGLLLEAPGQDFDFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  654

Query  469  LQEISAEIREKTSHLPGVSI  410
            LQEISAEIREKTSHLPGVS+
Sbjct  655  LQEISAEIREKTSHLPGVSV  674



>ref|NP_001119467.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 gb|AED97355.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=717

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  829  KSSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            K+ DAT++LH++P++E+K+SRVHAARRLFE+LSENS++FPVIHHI FP  IHRD+LVI A
Sbjct  534  KNIDATMILHDVPFTEDKVSRVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDELVIHA  593

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G+ AG LLVDGLGDGV+LEAPD DFDF+RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD
Sbjct  594  GTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  653

Query  469  LQEISAEIREKTSHLPGVSI  410
            LQEISAEIREKTSHLPGVS+
Sbjct  654  LQEISAEIREKTSHLPGVSV  673



>ref|XP_005848392.1| hypothetical protein CHLNCDRAFT_144676 [Chlorella variabilis]
 gb|EFN56290.1| hypothetical protein CHLNCDRAFT_144676 [Chlorella variabilis]
Length=698

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 138/186 (74%), Gaps = 14/186 (8%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlL  596
            +SRVH++RR+FE L +  +  PVIHHI FP    RDD+V+ +GS  G L+VDG GDG+++
Sbjct  510  LSRVHSSRRVFEQLQQQGISIPVIHHITFPDGTTRDDIVLQSGSMVGALMVDGYGDGLVV  569

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            E    D D++R T+F LLQGCRMRNTKTEY              E++ +IR +T HLPGV
Sbjct  570  ECASEDTDYLRTTAFGLLQGCRMRNTKTEY--------------EVTDQIRTRTGHLPGV  615

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
            SIA+MGCIVNGPGEMADADFGYVGGAPGKIDLYVGK VV+R I  + A D LIDLIKEHG
Sbjct  616  SIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKEVVRRNIPNESACDELIDLIKEHG  675

Query  235  RWVDPP  218
            RW +PP
Sbjct  676  RWQEPP  681



>gb|KDD76259.1| GcpE, partial [Helicosporidium sp. ATCC 50920]
Length=204

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 138/191 (72%), Gaps = 20/191 (10%)
 Frame = -3

Query  724  SLDFPVI-HHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDS-----------  581
            + D PV+ H+ +  +   R+ L+ +AGS  G LL+D LGDGVL+EA              
Sbjct  1    AADVPVVLHYRDLAERADREGLIFNAGSQLGALLMDALGDGVLVEAARGEAAEGEDVKRE  60

Query  580  --------DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHL  425
                    D  F+++T+F +LQG RMR+TKTEYVSCPSCGRTLFDLQE++A+I+ +T HL
Sbjct  61   DVGLEAPVDLAFLKDTAFGVLQGARMRSTKTEYVSCPSCGRTLFDLQEVTAQIKRRTGHL  120

Query  424  PGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIK  245
            PGV+IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYV K V+KR + M+ A D LI+LIK
Sbjct  121  PGVAIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVNKDVIKRGVPMEHACDELIELIK  180

Query  244  EHGRWVDPPTE  212
             HGRW DPP E
Sbjct  181  AHGRWQDPPVE  191



>ref|XP_002292108.1| gcpe-like protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90959.1| gcpe-like protein [Thalassiosira pseudonana CCMP1335]
Length=686

 Score =   218 bits (555),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 147/188 (78%), Gaps = 4/188 (2%)
 Frame = -3

Query  784  EEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdg  605
            +E++S++HA+RR+FE L  N ++ P IHH +       +DL +  G+  G+LL DG GDG
Sbjct  485  DEELSQLHASRRIFEILKTNEINVPAIHHYK-SSVADSNDLALELGTKIGSLLTDGNGDG  543

Query  604  vlLE-APDSDF--DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKT  434
            +L+E   +++F  +F+RNT F+LLQGCRMRNTKTE+VSCPSCGRTLFDLQE +A+I E T
Sbjct  544  ILIEQVGETNFSVEFLRNTGFSLLQGCRMRNTKTEFVSCPSCGRTLFDLQETTAKITEAT  603

Query  433  SHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALID  254
             HLPGV++A+MGCIVNGPGEMADADFGYVG  PGK+DLY GK VV++ I  D A ++L++
Sbjct  604  GHLPGVTVAVMGCIVNGPGEMADADFGYVGTLPGKVDLYYGKEVVRKNIPNDDAVESLVE  663

Query  253  LIKEHGRW  230
            LIKE+G W
Sbjct  664  LIKEYGMW  671



>gb|ACI45948.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase precursor [Guillardia theta]
Length=276

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  577  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  398
             DF+R +SF LLQGCRMRNTKTEYVSCPSCGRTLFDLQ ++ +I + T HLPG +IA+MG
Sbjct  148  LDFLRLSSFGLLQGCRMRNTKTEYVSCPSCGRTLFDLQTVTDQISKATGHLPGATIAVMG  207

Query  397  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  218
            CIVNGPGEMADADFGYVGGAPGKIDLYVGK +V++AI  ++A D LI+LIKE+GRWV+P 
Sbjct  208  CIVNGPGEMADADFGYVGGAPGKIDLYVGKELVRKAIPSEKACDELIELIKENGRWVEPS  267

Query  217  TEE  209
              E
Sbjct  268  KNE  270



>ref|XP_002179061.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Phaeodactylum 
tricornutum CCAP 1055/1]
 gb|ACI45957.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase precursor [Phaeodactylum tricornutum]
 gb|EEC49759.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Phaeodactylum 
tricornutum CCAP 1055/1]
Length=757

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 144/194 (74%), Gaps = 7/194 (4%)
 Frame = -3

Query  793  PYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdgl  614
            P SE  +S +H+ARR+FE    N ++  VIHH E   +   ++L +  G+  G+LL DG 
Sbjct  551  PKSE--LSHLHSARRVFELFKSNDIETAVIHHFESNTN-DANELALQVGTKIGSLLTDGN  607

Query  613  gdgvlLEAPDSD----FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
            GDG+++E    +     DF+R TSF+LLQG RMRNTKTE+VSCPSCGRTLFDLQE +A I
Sbjct  608  GDGIMIEQVGEEKPFSVDFLRRTSFSLLQGSRMRNTKTEFVSCPSCGRTLFDLQETTAGI  667

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            +E T HLPGV++A+MGCIVNGPGEMADADFGYVG  PGK+DLY GK VV++++   +A D
Sbjct  668  QEATGHLPGVTVAVMGCIVNGPGEMADADFGYVGTLPGKVDLYYGKEVVRKSVPNAEAVD  727

Query  265  ALIDLIKEHGRWVD  224
            ALIDLIKE+G W D
Sbjct  728  ALIDLIKEYGMWKD  741



>gb|EFB40485.1| hypothetical protein pah_c200o034 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=632

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 139/186 (75%), Gaps = 3/186 (2%)
 Frame = -3

Query  778  KISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvl  599
            K  R+HA+RR FE++    +  PV+ H  +  +  ++DL+I A +  G LL DGLG+G+ 
Sbjct  439  KEHRLHASRRFFEWIQNAKISTPVMLHFTYVSN--KEDLIIQAAAEFGALLCDGLGEGIW  496

Query  598  LEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPG  419
            +EAP  + DF+R  SFN+LQ  RMR +KT+++SCPSCGRTLFDLQ++S  IR +T+HLPG
Sbjct  497  IEAP-HELDFLRQLSFNILQAARMRISKTDFISCPSCGRTLFDLQDVSRNIRNRTAHLPG  555

Query  418  VSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEH  239
            V IAIMGCIVNGPGEMADADFGYVG  PG IDLY+GK  V++ I   +A D L++LIK H
Sbjct  556  VKIAIMGCIVNGPGEMADADFGYVGSKPGMIDLYLGKQCVEKDIPFSEAVDRLVELIKRH  615

Query  238  GRWVDP  221
            GRWV+P
Sbjct  616  GRWVEP  621



>ref|WP_036746476.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
Length=656

 Score =   212 bits (540),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 139/186 (75%), Gaps = 3/186 (2%)
 Frame = -3

Query  778  KISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvl  599
            K  R+HA+RR FE++    +  PV+ H  +  +  ++DL+I A +  G LL DGLG+G+ 
Sbjct  463  KEHRLHASRRFFEWIQNAKISTPVMLHFTYVSN--KEDLIIQAAAEFGALLCDGLGEGIW  520

Query  598  LEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPG  419
            +EAP  + DF+R  SFN+LQ  RMR +KT+++SCPSCGRTLFDLQ++S  IR +T+HLPG
Sbjct  521  IEAP-HELDFLRQLSFNILQAARMRISKTDFISCPSCGRTLFDLQDVSRNIRNRTAHLPG  579

Query  418  VSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEH  239
            V IAIMGCIVNGPGEMADADFGYVG  PG IDLY+GK  V++ I   +A D L++LIK H
Sbjct  580  VKIAIMGCIVNGPGEMADADFGYVGSKPGMIDLYLGKQCVEKDIPFSEAVDRLVELIKRH  639

Query  238  GRWVDP  221
            GRWV+P
Sbjct  640  GRWVEP  645



>ref|XP_005783224.1| hypothetical protein EMIHUDRAFT_442353 [Emiliania huxleyi CCMP1516]
 gb|EOD30795.1| hypothetical protein EMIHUDRAFT_442353 [Emiliania huxleyi CCMP1516]
Length=780

 Score =   214 bits (544),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 129/185 (70%), Gaps = 4/185 (2%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAG---Tllvdglgdg  605
            +SR+HA+RR+F    +  +D  VIH    P     ++L +  GS  G      +      
Sbjct  580  LSRLHASRRVFSLFEQEGIDSAVIHAFRPPPS-DGNELALQLGSQVGGLLCDGLGDGVAI  638

Query  604  vlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHL  425
            V  E      DF+R TSF LLQG RMR+TKTE+VSCPSCGRTLFDLQE++A+I  +T HL
Sbjct  639  VPQEGASFGTDFLRTTSFGLLQGARMRSTKTEFVSCPSCGRTLFDLQEVTAQISSRTGHL  698

Query  424  PGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIK  245
            PGV+IAIMGCIVNGPGEMADADFGYVGGAPGK+DLYVGK VV+R I  + A D LI+LIK
Sbjct  699  PGVAIAIMGCIVNGPGEMADADFGYVGGAPGKVDLYVGKEVVRRGIPNEDACDQLIELIK  758

Query  244  EHGRW  230
            E+G W
Sbjct  759  ENGMW  763



>emb|CDZ80220.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
sp. 'Rubis']
Length=653

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 139/183 (76%), Gaps = 3/183 (2%)
 Frame = -3

Query  769  RVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEA  590
            R+H +R  F +L +  +  PVI  + F   + ++DL+I A +  G LL DGLGDG+ ++A
Sbjct  464  RLHYSRSFFNWLHKKGITTPVI--LSFTYLVPKEDLIIQAAAECGALLCDGLGDGIWIQA  521

Query  589  PDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSI  410
             + D +FIRN SF++LQ  RMR +KT+++SCPSCGRTLFDLQE+S  IR +TSHLPGV I
Sbjct  522  QE-DINFIRNLSFSILQAARMRTSKTDFISCPSCGRTLFDLQEVSKRIRLRTSHLPGVKI  580

Query  409  AIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRW  230
            AIMGCIVNGPGEMADADFGYVG  PG IDLYVGK  V++ I  +QA D L++LIK+HGRW
Sbjct  581  AIMGCIVNGPGEMADADFGYVGSKPGMIDLYVGKECVEKDITFEQADDRLVELIKKHGRW  640

Query  229  VDP  221
            V+P
Sbjct  641  VEP  643



>ref|XP_009035331.1| hypothetical protein AURANDRAFT_71112 [Aureococcus anophagefferens]
 gb|EGB10547.1| hypothetical protein AURANDRAFT_71112 [Aureococcus anophagefferens]
Length=2166

 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 150/198 (76%), Gaps = 9/198 (5%)
 Frame = -3

Query  796  LPYSEEKISRVHAARRLFEYLSENSLD---FPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            L  ++  +SR+HA RRLFE L   +       V+HH+  P +  R +L +  G  AG LL
Sbjct  563  LAETDPSLSRLHATRRLFEKLGRGAPGDEGLSVVHHLRAP-ECDRSELALQLGMQAGGLL  621

Query  625  vdglgdgvlLE---APDSDFD--FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  461
             DGLGDGVL+E   A  ++FD  ++R+TSF LLQG RMRNTKTE+VSCPSCGRTLFDLQE
Sbjct  622  GDGLGDGVLVEPEVANTANFDVAYLRDTSFALLQGSRMRNTKTEFVSCPSCGRTLFDLQE  681

Query  460  ISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM  281
            ++A+I EKT HLPGV+IAIMGCIVNGPGEMADADFGYVG  PGKIDLYVGKTVV++ I  
Sbjct  682  VTAQISEKTGHLPGVAIAIMGCIVNGPGEMADADFGYVGTVPGKIDLYVGKTVVEKGIPD  741

Query  280  DQATDALIDLIKEHGRWV  227
            + A DALI LIK++G+WV
Sbjct  742  ELACDALIQLIKDNGKWV  759



>gb|EJK67655.1| hypothetical protein THAOC_11283, partial [Thalassiosira oceanica]
Length=756

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 132/188 (70%), Gaps = 5/188 (3%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdgl----gd  608
            +S++HA+RR+FE    N ++ P IHH +   D   +++ +  G+  G+LL DG       
Sbjct  564  LSQLHASRRIFEIFKSNDINTPAIHHFKTTSD-DSNEIALGLGTKVGSLLTDGNGDGILI  622

Query  607  gvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSH  428
              + E  +   DF+RNT F+LLQGCRMRNTKTE+VSCPSCGRTLFDLQE +A I E T H
Sbjct  623  EQVGETANFSVDFVRNTGFSLLQGCRMRNTKTEFVSCPSCGRTLFDLQETTASITEATGH  682

Query  427  LPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLI  248
            LPGV+IA+MGCIVNGPGEMADADFGYVG  PGK+DLY GK +V++ I  + A   L++LI
Sbjct  683  LPGVTIAVMGCIVNGPGEMADADFGYVGTTPGKVDLYYGKEIVRKGIKNEDAVGELVELI  742

Query  247  KEHGRWVD  224
            K +  W D
Sbjct  743  KSYDMWQD  750



>ref|WP_013925438.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
 emb|CCB87188.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae UV-7]
Length=656

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = -3

Query  778  KISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvl  599
            K  R+HA+RR FE++    +   V+ H  +  +  ++DL+I A +  G LL DGLG+G+ 
Sbjct  463  KEHRLHASRRFFEWIQNAKISTSVMLHFTYVSN--KEDLIIQAAAEFGALLCDGLGEGIW  520

Query  598  LEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPG  419
            +EAP  + DF+R  SFN+LQ  RMR +KT+++SCPSCGRTLFDLQ++S  IR +T+HLPG
Sbjct  521  IEAP-HELDFLRQLSFNILQAARMRISKTDFISCPSCGRTLFDLQDVSRNIRNRTAHLPG  579

Query  418  VSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEH  239
            V IAIMGCIVNGPGEMADADFGYVG  PG IDLY+GK  V++ I   +A D L++LIK H
Sbjct  580  VKIAIMGCIVNGPGEMADADFGYVGSKPGMIDLYLGKQCVEKDIPFSEAVDRLVELIKRH  639

Query  238  GRWVDP  221
            GRWV+P
Sbjct  640  GRWVEP  645



>gb|KIA77148.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
Length=673

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = -3

Query  778  KISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvl  599
            K  R+HA+RR FE++    +   V+ H  +  +  ++DL+I A +  G LL DGLG+G+ 
Sbjct  480  KEHRLHASRRFFEWIQNAKISTSVMLHFTYVSN--KEDLIIQAAAEFGALLCDGLGEGIW  537

Query  598  LEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPG  419
            +EAP  + DF+R  SFN+LQ  RMR +KT+++SCPSCGRTLFDLQ++S  IR +T+HLPG
Sbjct  538  IEAP-HELDFLRQLSFNILQAARMRISKTDFISCPSCGRTLFDLQDVSRNIRNRTAHLPG  596

Query  418  VSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEH  239
            V IAIMGCIVNGPGEMADADFGYVG  PG IDLY+GK  V++ I   +A D L++LIK H
Sbjct  597  VKIAIMGCIVNGPGEMADADFGYVGSKPGMIDLYLGKQCVEKDIPFSEAVDRLVELIKRH  656

Query  238  GRWVDP  221
            GRWV+P
Sbjct  657  GRWVEP  662



>ref|WP_039385010.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. TUME1]
 gb|KIC75889.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. TUME1]
Length=638

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            SRV  ARR F++L +N +  PVI  + F     ++DLVI A    G L  DGLG+G+ L+
Sbjct  455  SRVFKARRFFDWLKQNQIGIPVI--LNFHYSCSQEDLVIQASMEYGALFCDGLGEGIWLD  512

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
             P  D +++R+ SFN+LQ  RMR  KT+++SCPSCGRTLFDLQE++  IRE+TSHLPGV 
Sbjct  513  VP-QDINYLRHLSFNILQAARMRMVKTDFISCPSCGRTLFDLQEVTKRIRERTSHLPGVK  571

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVG   G IDLYVGK  V++ I   +A D L++L+K HGR
Sbjct  572  IAIMGCIVNGPGEMADADFGYVGSKAGMIDLYVGKECVQKNIPFAEADDKLVELLKSHGR  631

Query  232  WVDP  221
            W +P
Sbjct  632  WQEP  635



>ref|WP_042103571.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydiaceae 
bacterium HS-T3]
Length=649

 Score =   206 bits (525),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 141/191 (74%), Gaps = 6/191 (3%)
 Frame = -3

Query  793  PYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdgl  614
            P  EE   R+H +R  F+++ ++ L  PVI  + F     ++DL+I A +  G+LL DGL
Sbjct  460  PKDEE---RLHYSRHFFDWMKDHQLAIPVI--LNFRYSCSKEDLIIHASAECGSLLCDGL  514

Query  613  gdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKT  434
            G+G+ LE P  + +F+RN SFNLLQ  RMR  KT+++SCPSCGRTLFDLQ++S  IR +T
Sbjct  515  GEGLWLEGPYEN-NFLRNLSFNLLQAARMRTFKTDFISCPSCGRTLFDLQDVSKRIRSRT  573

Query  433  SHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALID  254
            +HLPGV IAIMGCIVNGPGEMADADFGYVG  PG IDLYVGK  V++ I+  +A D LID
Sbjct  574  AHLPGVKIAIMGCIVNGPGEMADADFGYVGSKPGMIDLYVGKKCVEKDISFAEADDRLID  633

Query  253  LIKEHGRWVDP  221
            LIK++ RW++P
Sbjct  634  LIKKYDRWIEP  644



>ref|WP_044882180.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. EPS4]
 gb|KIC74118.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. EPS4]
Length=638

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            SRV  ARR F++L +N +  PVI + ++     ++DLVI A    G L  DGLG+G+ LE
Sbjct  455  SRVFKARRFFDWLKQNQIGIPVILNFQYSGS--QEDLVIQASMEYGALFCDGLGEGIWLE  512

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            AP  D +++R+ SF++LQ  RMR  KT+++SCPSCGRTLFDLQE++  IRE+TSHLPGV 
Sbjct  513  AP-YDINYLRHLSFSILQAARMRMVKTDFISCPSCGRTLFDLQEVTKRIRERTSHLPGVK  571

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVG   G IDLYVGK  V++ I   +A D L++L+K +G+
Sbjct  572  IAIMGCIVNGPGEMADADFGYVGSKAGMIDLYVGKECVQKNIPFAEADDKLVELLKSYGK  631

Query  232  WVDP  221
            W +P
Sbjct  632  WQEP  635



>gb|KFG49560.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii GAB2-2007-GAL-DOM2]
Length=856

 Score =   206 bits (523),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  738  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  797

Query  373  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  798  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  851



>gb|KFH07783.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii MAS]
Length=848

 Score =   206 bits (523),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  730  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  789

Query  373  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  790  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  843



>gb|KFG35221.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii p89]
Length=848

 Score =   205 bits (522),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  730  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  789

Query  373  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  790  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  843



>gb|KFG65470.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Toxoplasma gondii RUB]
Length=893

 Score =   206 bits (523),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  775  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  834

Query  373  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  835  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  888



>gb|KFH10447.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Toxoplasma gondii VAND]
Length=892

 Score =   206 bits (523),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  774  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  833

Query  373  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  834  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  887



>ref|WP_011175290.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Candidatus Protochlamydia amoebophila]
 sp|Q6MD85.1|ISPG_PARUW RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23464.1| probable gcpE protein [Candidatus Protochlamydia amoebophila 
UWE25]
Length=654

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            +R+H +R+ FE+L +N L++PVI  + F      +D ++ A    G+LL DGLG+GV LE
Sbjct  469  NRLHYSRQFFEWLQQNQLNYPVI--LNFTYQGENEDTILLASMECGSLLCDGLGEGVWLE  526

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
             P  D  F+R  SF++LQ  R+R +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV 
Sbjct  527  GP-YDILFLRQLSFSILQAARLRMSKTDFISCPSCGRTLFNLQDVTKRIQSRTSHLPGVK  585

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVG  PGKIDLYVGK  V++ I    A D L++LI+ HGR
Sbjct  586  IAIMGCIVNGPGEMADADFGYVGSKPGKIDLYVGKECVEKDIDFADADDRLVNLIRAHGR  645

Query  232  WVDPPT  215
            W++P T
Sbjct  646  WIEPQT  651



>ref|WP_035395035.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Chlamydia sp. 'Diamant']
Length=638

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 135/184 (73%), Gaps = 3/184 (2%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            +R+H  R+ FE++ EN L  PVI +  +  D  ++D+ + A    G LL DGLG+G+ LE
Sbjct  458  NRLHYCRQFFEWVRENQLACPVILNFAYSGD--KEDVTLLASMECGALLCDGLGEGLWLE  515

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
             P  + DF+R  SF++LQ  RMR +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV 
Sbjct  516  GP-YEIDFLRQLSFSILQAARMRMSKTDFISCPSCGRTLFNLQDVTKRIQARTSHLPGVK  574

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVG  PG IDLYVGK  V+R I    A D LI+LIK HGR
Sbjct  575  IAIMGCIVNGPGEMADADFGYVGSKPGMIDLYVGKECVERNIDFADADDRLIELIKTHGR  634

Query  232  WVDP  221
            WV+P
Sbjct  635  WVEP  638



>gb|KIC72391.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia amoebophila]
Length=657

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            +R+H +R  FE+L +N L++PVI  + F      +D ++ A    G+LL DGLG+GV LE
Sbjct  472  NRLHYSRHFFEWLQQNQLNYPVI--LNFTYQGENEDTILLASMECGSLLCDGLGEGVWLE  529

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
             P  D  F+R  SF++LQ  R+R +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV 
Sbjct  530  GP-YDILFLRQLSFSILQAARLRMSKTDFISCPSCGRTLFNLQDVTKRIQSRTSHLPGVK  588

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVG  PGKIDLYVGK  V++ I    A D L++LI+ HGR
Sbjct  589  IAIMGCIVNGPGEMADADFGYVGSKPGKIDLYVGKECVEKDIDFADADDRLVNLIRAHGR  648

Query  232  WVDPPT  215
            W++P T
Sbjct  649  WIEPQT  654



>ref|WP_039357656.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia amoebophila]
Length=654

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            +R+H +R  FE+L +N L++PVI  + F      +D ++ A    G+LL DGLG+GV LE
Sbjct  469  NRLHYSRHFFEWLQQNQLNYPVI--LNFTYQGENEDTILLASMECGSLLCDGLGEGVWLE  526

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
             P  D  F+R  SF++LQ  R+R +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV 
Sbjct  527  GP-YDILFLRQLSFSILQAARLRMSKTDFISCPSCGRTLFNLQDVTKRIQSRTSHLPGVK  585

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVG  PGKIDLYVGK  V++ I    A D L++LI+ HGR
Sbjct  586  IAIMGCIVNGPGEMADADFGYVGSKPGKIDLYVGKECVEKDIDFADADDRLVNLIRAHGR  645

Query  232  WVDPPT  215
            W++P T
Sbjct  646  WIEPQT  651



>gb|ESS31948.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii VEG]
Length=1283

 Score =   205 bits (522),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
             FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1165  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1224

Query  373   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  1225  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  1278



>gb|EPR62596.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii GT1]
Length=1283

 Score =   205 bits (522),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
             FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1165  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1224

Query  373   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  1225  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  1278



>gb|KFG52681.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii FOU]
Length=1286

 Score =   205 bits (522),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
             FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1168  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1227

Query  373   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  1228  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  1281



>ref|WP_042282293.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia sp. R18]
Length=654

 Score =   201 bits (511),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            +R+H +R  FE+L +N L++PVI  + F      +D ++ A    G+LL DGLG+G+ LE
Sbjct  469  NRLHYSRHFFEWLQQNQLNYPVI--LNFTYQGENEDTILLASMECGSLLCDGLGEGIWLE  526

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
             P  D  F+R  SF++LQ  R+R +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV 
Sbjct  527  GP-YDILFLRQLSFSILQAARLRMSKTDFISCPSCGRTLFNLQDVTKRIQSRTSHLPGVK  585

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVG  PGKIDLYVGK  V++ I    A D L++LI+ HGR
Sbjct  586  IAIMGCIVNGPGEMADADFGYVGSKPGKIDLYVGKECVEKDIDFADADDRLVNLIRAHGR  645

Query  232  WVDPPT  215
            W++P T
Sbjct  646  WIEPQT  651



>ref|XP_002365345.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Toxoplasma gondii ME49]
 gb|EPT29635.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii ME49]
Length=1283

 Score =   205 bits (521),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  553   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
             FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1165  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1224

Query  373   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  1225  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  1278



>ref|WP_042240386.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. S13]
Length=638

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            SRV  ARR F++L +N +  PVI  + F     ++DLVI +    G L  DGLG+G+ L+
Sbjct  455  SRVFKARRFFDWLKQNQIGIPVI--LNFHYSGSQEDLVIQSSMEYGALFCDGLGEGIWLD  512

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
             P  D +++R+ SF++LQ  RMR  KT+++SCPSCGRTLFDLQE++  IRE+TSHLPGV 
Sbjct  513  VP-HDINYLRHLSFSILQAARMRMVKTDFISCPSCGRTLFDLQEVTKRIRERTSHLPGVK  571

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVG   G IDLYVGK  V++ I   +A D L++L+K +GR
Sbjct  572  IAIMGCIVNGPGEMADADFGYVGSKAGMIDLYVGKECVQKNIPFAEADDKLVELLKSYGR  631

Query  232  WVDP  221
            W +P
Sbjct  632  WQEP  635



>ref|XP_765233.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Theileria 
parva strain Muguga]
 gb|EAN32950.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Theileria parva]
Length=801

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -3

Query  778  KISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvl  599
            K++ ++  RR+F  L++   D PVIH + FP   ++ D+++ +    G  L+D +G+G++
Sbjct  616  KLNYMYTVRRIFGLLNKTKCDLPVIHQLNFPSLENQQDMLVDSCCLLGCNLIDKMGEGII  675

Query  598  LEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPG  419
            +++     D     S ++LQ  RMRN KT+++SCPSCGRTLF++QE + E+R +  HLPG
Sbjct  676  IKSK-LPIDITNKLSLDILQNSRMRNIKTDFISCPSCGRTLFNIQETTEEVRRRIGHLPG  734

Query  418  VSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEH  239
            V+IAIMGCIVNG GEMADADFGYVGG+PGK+DLYV K +++R I  DQA D LI+LIK+H
Sbjct  735  VTIAIMGCIVNGIGEMADADFGYVGGSPGKVDLYVKKQLIERNIPKDQACDKLIELIKKH  794

Query  238  GRWVDPP  218
             +WV+PP
Sbjct  795  NKWVEPP  801



>ref|XP_008882873.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hammondia 
hammondi]
 gb|KEP66165.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hammondia 
hammondi]
Length=1284

 Score =   199 bits (507),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  553   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
             FNLLQ CR+R+TKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1166  FNLLQACRLRSTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1225

Query  373   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+ LIK+HGRWVDPP E
Sbjct  1226  MADADFGYVGGAPGKVDLYVKKRVVKRGISSAEACDALVALIKQHGRWVDPPKE  1279



>ref|XP_003882784.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, related 
[Neospora caninum Liverpool]
 emb|CBZ52752.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, related 
[Neospora caninum Liverpool]
Length=1294

 Score =   199 bits (507),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  553   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  374
             FNLLQ CR+R+TKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1175  FNLLQACRLRSTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1234

Query  373   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
             MADADFGYVGGAPGK+DLYV K VVKR I   +A DAL+ LIK+HGRWVDPP E
Sbjct  1235  MADADFGYVGGAPGKVDLYVKKKVVKRGIPSAEACDALVALIKQHGRWVDPPKE  1288



>ref|XP_952048.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
annulata strain Ankara]
 emb|CAI74316.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase, putative 
[Theileria annulata]
Length=808

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 135/186 (73%), Gaps = 1/186 (1%)
 Frame = -3

Query  778  KISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvl  599
            K++ ++  RR+F  L++   D PVIH + FP   ++ D+++ +    G  L+D +G+G++
Sbjct  623  KLNYMYTVRRIFGLLNKTKSDLPVIHQLNFPSLENQQDMLVDSCCLLGCNLIDKMGEGII  682

Query  598  LEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPG  419
            +++     D     S ++LQ  RMRN KT+++SCPSCGRTLF++QE + E+R +  HLPG
Sbjct  683  IKSK-LPIDITNKLSLDILQNSRMRNIKTDFISCPSCGRTLFNIQETTEEVRRRVGHLPG  741

Query  418  VSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEH  239
            V+IAIMGCIVNG GEMADADFGYVGG+PGK+DLYV K +++R I  +QA D LI+LIK+H
Sbjct  742  VTIAIMGCIVNGIGEMADADFGYVGGSPGKVDLYVKKQLIERNIPKEQACDKLIELIKKH  801

Query  238  GRWVDP  221
             +WV+P
Sbjct  802  DKWVEP  807



>ref|XP_009690697.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
orientalis strain Shintoku]
 dbj|BAM40396.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
orientalis strain Shintoku]
Length=834

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = -3

Query  784  EEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdg  605
            + K++ ++  RR+F  +++ + D PVIH ++FP    + D+++ +    G  L+D +G+G
Sbjct  641  DSKLNYMYTVRRIFGLINKTNCDLPVIHQLKFPNLEDQQDMLVKSCCLLGCNLIDKMGEG  700

Query  604  vlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHL  425
            +++++           + N+LQ  RMRN KT+++SCPSCGRTLF++QE + EIR++  HL
Sbjct  701  IIIKSK-LPIQITNQLALNILQNSRMRNIKTDFISCPSCGRTLFNIQETTEEIRKRVGHL  759

Query  424  PGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIK  245
            PGV+IAIMGCIVNG GEMADADFGYVGG+PGK+DLYV K +++R I  ++A D LI+LIK
Sbjct  760  PGVTIAIMGCIVNGIGEMADADFGYVGGSPGKVDLYVKKKLIERNIPKEKACDKLIELIK  819

Query  244  EHGRWVDP  221
            +H +WV+P
Sbjct  820  QHNKWVEP  827



>ref|WP_013943315.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Simkania 
negevensis]
 emb|CCB88848.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Simkania 
negevensis Z]
Length=604

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 131/186 (70%), Gaps = 9/186 (5%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            S +H  R  F+++ ++ LD PVI  + +  D+  +D VI A +  G LL DG G+G+LL 
Sbjct  418  SPIHQGRYFFDWIQQSKLDIPVILVVSY--DLSEEDTVIHAAAELGALLGDGYGEGILLR  475

Query  592  A---PDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLP  422
                P  +    R+ SFN+LQ CR+R +KTE+++CP CGRTLFDLQE++  IR KTSHLP
Sbjct  476  TRLTPGQN----RSLSFNILQACRLRASKTEFIACPGCGRTLFDLQEVTKRIRLKTSHLP  531

Query  421  GVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKE  242
            GV IAIMGCIVNGPGEMADADFGYVG   GK+DLYVGK  V+R I  D A + LI+LIK 
Sbjct  532  GVKIAIMGCIVNGPGEMADADFGYVGSRAGKVDLYVGKECVERNIDFDAADERLIELIKA  591

Query  241  HGRWVD  224
            H RW++
Sbjct  592  HDRWIE  597



>ref|XP_004829307.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Babesia equi]
 gb|AFZ79641.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Babesia equi strain WA]
Length=770

 Score =   191 bits (484),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 129/187 (69%), Gaps = 5/187 (3%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGS--NAGTllvdglgdgv  602
            ++ V   RR+F  L   + + PVIH ++       +D+V++A +  +   +   G G   
Sbjct  587  LNNVATVRRIFGLLVRANSNIPVIHQLDLTSYKDHEDVVVAASTLVSCHLVDKLGEGLIC  646

Query  601  lLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLP  422
                P  + + I   S N+LQ  RMR+ KT+++SCPSCGRTLFD+Q+ + EI+++T HLP
Sbjct  647  KTSLPLQESNAI---SLNILQNARMRSFKTDFISCPSCGRTLFDIQKTTEEIKKRTGHLP  703

Query  421  GVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKE  242
            GV+IAIMGCIVNG GEMADADFGYVGG+PGK+DLYV K +V+R I  DQA D LIDLIK+
Sbjct  704  GVTIAIMGCIVNGIGEMADADFGYVGGSPGKVDLYVKKQLVERGIPNDQACDRLIDLIKK  763

Query  241  HGRWVDP  221
            HGRW+DP
Sbjct  764  HGRWIDP  770



>ref|WP_043587352.1| hypothetical protein [Diplosphaera colitermitum]
Length=143

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = -3

Query  586  DSDFDFIRNT--SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            ++D D  R T  ++N+LQG   R +KTEYV+CPSCGRTLFDLQ  +  IREKT HL GV 
Sbjct  4    ETDPDPTRATKLAYNILQGAGARVSKTEYVACPSCGRTLFDLQTTTQRIREKTGHLKGVK  63

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            +AIMGCIVNGPGEMADADFGYVGGAPGKI+LYVGKT V+  I   +A   LI LIKEHG+
Sbjct  64   LAIMGCIVNGPGEMADADFGYVGGAPGKINLYVGKTCVQYNIPQAEADARLIALIKEHGK  123

Query  232  WVDP  221
            W++P
Sbjct  124  WMEP  127



>gb|EMR00731.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cesiribacter 
andamanensis AMV16]
Length=186

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 114/176 (65%), Gaps = 11/176 (6%)
 Frame = -3

Query  712  PVIHHIEFPKDIHRDDLVISAGSNAGTllv-----dglgdgvlLEAPD-----SDFDFIR  563
            PVI H  + + +  D+L + A ++AG LL+       +      EAP       D   + 
Sbjct  8    PVIIHTTYSQ-LSADELQLWAATDAGGLLIDGLGDGLMLSLDYAEAPQPEQRLQDLRRLN  66

Query  562  NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNG  383
            N  F +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNG
Sbjct  67   NLGFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRQRTDHLKGVKIGIMGCIVNG  126

Query  382  PGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  215
            PGEMADAD+GYVG   GKI LY G+ VV+R +  +QA D LI LI+E GRW++P T
Sbjct  127  PGEMADADYGYVGSGKGKITLYRGQEVVERNVPSEQAVDKLIGLIREDGRWIEPAT  182



>dbj|BAG14389.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Perkinsus 
marinus]
Length=798

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 130/189 (69%), Gaps = 7/189 (4%)
 Frame = -3

Query  769  RVHAARRLFEYLSENSLDFPVIHHIEFPKDIHR-----DDLVISAGSNAGTllvdglgdg  605
            RVHA R++ + + ++ L  P++    +P+   +     D  VI   S  G+L VDGLGDG
Sbjct  606  RVHAGRQVAKAVRKSRL--PLLMWFTYPEGDSKAKAGSDAAVILGASEFGSLFVDGLGDG  663

Query  604  vlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHL  425
            +  +      +  R+   NL+QG RMR +KTE++SCPSCGRTLFDLQ+ +  IR+KT HL
Sbjct  664  IFWDDRGLTTEETRDVGLNLMQGSRMRLSKTEFISCPSCGRTLFDLQDTTERIRKKTGHL  723

Query  424  PGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIK  245
             G+ IA+MGC+VNGPGEMADADFGYVG  PGK+DLYVGK  V+RA+  D+A D L+DLIK
Sbjct  724  SGLRIAVMGCVVNGPGEMADADFGYVGSLPGKVDLYVGKQCVRRAVDYDKAEDVLVDLIK  783

Query  244  EHGRWVDPP  218
              G WVDPP
Sbjct  784  SEGLWVDPP  792



>ref|WP_043128162.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase, partial 
[Opitutaceae bacterium TAV1]
Length=147

 Score =   171 bits (432),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = -3

Query  586  DSDFDFIR--NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            ++D D +R    ++N+LQG   R TKTEYV+CPSCGRTLFDLQ  +  IR+KT HL GV 
Sbjct  22   ETDPDPVRANKLAYNILQGAGARVTKTEYVACPSCGRTLFDLQTTTQRIRQKTGHLKGVK  81

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            +AIMGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  V+  I   +A   LIDLIKEHG+
Sbjct  82   LAIMGCIVNGPGEMADADFGYVGGAPGKINLYVGKNCVQYNIPQAEADARLIDLIKEHGK  141

Query  232  WVDP  221
            W +P
Sbjct  142  WQEP  145



>ref|WP_008101242.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Verrucomicrobiae 
bacterium DG1235]
 gb|EDY83124.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Verrucomicrobiae 
bacterium DG1235]
Length=678

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = -3

Query  586  DSDFDFIRNT--SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            +S+ D +R+T  ++N+LQG   R TKTE+V+CPSCGRTLFDLQ  +  IREKT HL GV 
Sbjct  549  ESETDLVRSTRLTYNVLQGAGSRITKTEFVACPSCGRTLFDLQSTTQRIREKTGHLKGVK  608

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IAIMGCIVNGPGEMADADFGYVGGAP KI+LYVGKT VK  I   +A + LIDLI+EHG+
Sbjct  609  IAIMGCIVNGPGEMADADFGYVGGAPAKINLYVGKTCVKYNIPQAEADERLIDLIREHGK  668

Query  232  WVDP  221
            WVDP
Sbjct  669  WVDP  672



>ref|XP_002768617.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER01335.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Perkinsus marinus ATCC 50983]
Length=798

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 129/189 (68%), Gaps = 7/189 (4%)
 Frame = -3

Query  769  RVHAARRLFEYLSENSLDFPVIHHIEFPKDIHR-----DDLVISAGSNAGTllvdglgdg  605
            RVHA R++   + ++ L  P++    +P+   +     D  VI   S  G+L VDGLGDG
Sbjct  606  RVHAGRQVARAVRKSRL--PLLVWFTYPEGDSKAKAGSDAAVILGASEFGSLFVDGLGDG  663

Query  604  vlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHL  425
            +  +      +  R+   NL+QG RMR +KTE++SCPSCGRTLFDLQ+ +  IR+KT HL
Sbjct  664  IFWDDRGLTTEETRDVGLNLMQGSRMRLSKTEFISCPSCGRTLFDLQDTTERIRKKTGHL  723

Query  424  PGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIK  245
             G+ IA+MGC+VNGPGEMADADFGYVG  PGK+DLYVGK  V+RA+  D+A D L+DLIK
Sbjct  724  SGLRIAVMGCVVNGPGEMADADFGYVGSLPGKVDLYVGKQCVRRAVDYDKAEDVLVDLIK  783

Query  244  EHGRWVDPP  218
              G WVDPP
Sbjct  784  SEGLWVDPP  792



>emb|CDR33454.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Criblamydia 
sequanensis CRIB-18]
Length=619

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 130/183 (71%), Gaps = 1/183 (1%)
 Frame = -3

Query  769  RVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEA  590
            RV   RR +E+LS+N+L  P+  + ++      ++++I A    G+LL+DG+G+G++L  
Sbjct  435  RVQKTRRFYEWLSQNNLVIPLYLYFDYTNCKSFEEVIIQASCECGSLLMDGIGEGIILSG  494

Query  589  PDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSI  410
            P  + + ++  S ++LQ  R+R+ KTE++SCP CGRTLF+LQ+++ +IR  T HLPGV I
Sbjct  495  P-YEANSLKELSLSILQAARLRSHKTEFISCPGCGRTLFNLQQVTEKIRSLTGHLPGVKI  553

Query  409  AIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRW  230
            A+MGCIVNGPGEMADADFGYVG   G IDLY+GK  V++ I    A   L+DLIK HG+W
Sbjct  554  AVMGCIVNGPGEMADADFGYVGSKTGMIDLYIGKECVEKNIEETLAPHKLVDLIKSHGKW  613

Query  229  VDP  221
            V+P
Sbjct  614  VEP  616



>ref|WP_041016942.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Criblamydia 
sequanensis]
Length=622

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 130/183 (71%), Gaps = 1/183 (1%)
 Frame = -3

Query  769  RVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEA  590
            RV   RR +E+LS+N+L  P+  + ++      ++++I A    G+LL+DG+G+G++L  
Sbjct  438  RVQKTRRFYEWLSQNNLVIPLYLYFDYTNCKSFEEVIIQASCECGSLLMDGIGEGIILSG  497

Query  589  PDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSI  410
            P  + + ++  S ++LQ  R+R+ KTE++SCP CGRTLF+LQ+++ +IR  T HLPGV I
Sbjct  498  P-YEANSLKELSLSILQAARLRSHKTEFISCPGCGRTLFNLQQVTEKIRSLTGHLPGVKI  556

Query  409  AIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRW  230
            A+MGCIVNGPGEMADADFGYVG   G IDLY+GK  V++ I    A   L+DLIK HG+W
Sbjct  557  AVMGCIVNGPGEMADADFGYVGSKTGMIDLYIGKECVEKNIEETLAPHKLVDLIKSHGKW  616

Query  229  VDP  221
            V+P
Sbjct  617  VEP  619



>emb|CDR94010.1| gcpE protein, putative [Babesia bigemina]
Length=780

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 134/198 (68%), Gaps = 12/198 (6%)
 Frame = -3

Query  778  KISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvl  599
            K++ V   RR+F  L +N    PVIH ++  +    +++VI   +   T L+D LG+G++
Sbjct  582  KLNHVETVRRIFGILIKNGSKLPVIHQVDATECFDHEEVVIRVSAALSTHLIDKLGEGLI  641

Query  598  LEA--PDSDFDFIR----------NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS  455
            +++  P S+ + I           N S   LQ  RMR+ KTE++SCPSCGRTLFD+Q+ +
Sbjct  642  IKSRLPLSESNDIALSTLQVFNSVNPSIPRLQAARMRSFKTEFISCPSCGRTLFDIQKTT  701

Query  454  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQ  275
              I+++  HLPGVSIAIMGCIVNG GEMADADFGYVGGAP K+DLYV K +V+R I  ++
Sbjct  702  ENIKKRVGHLPGVSIAIMGCIVNGIGEMADADFGYVGGAPNKVDLYVKKKLVERNIPHEE  761

Query  274  ATDALIDLIKEHGRWVDP  221
            A D LIDLIK HG+WVDP
Sbjct  762  ACDRLIDLIKRHGKWVDP  779



>ref|WP_013044727.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Coraliomargarita 
akajimensis]
 gb|ADE56011.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Coraliomargarita 
akajimensis DSM 45221]
Length=681

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -3

Query  556  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  377
            ++N+LQG R R +KTE+V+CPSCGRTLFDLQ ++  IR +T HL GV+IAIMGCIVNGPG
Sbjct  569  AYNILQGARARISKTEFVACPSCGRTLFDLQSVTQRIRSRTDHLKGVTIAIMGCIVNGPG  628

Query  376  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            EMADADFGYVGGAPGKI+LYVGK  VK  +  ++A D LIDLIKEHG+WV+P
Sbjct  629  EMADADFGYVGGAPGKINLYVGKECVKYNVPSNEALDRLIDLIKEHGKWVEP  680



>ref|WP_000541454.1| hypothetical protein, partial [Leptospira interrogans]
Length=268

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 123/198 (62%), Gaps = 4/198 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS    +FP++ H  F      + L  SA    G L+
Sbjct  75   IKNVLFSLDSKEILYDYRKLGSILSR--FEFPILLHGSFSNP--EEALYNSAIGIGGLLI  130

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +  +   D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  131  DGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  190

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A +
Sbjct  191  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADE  250

Query  265  ALIDLIKEHGRWVDPPTE  212
             L+ LIK++G W DP  +
Sbjct  251  KLVQLIKDNGLWQDPSND  268



>ref|WP_009036471.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Indibacter 
alkaliphilus]
 gb|EOZ95046.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Indibacter 
alkaliphilus LW1]
Length=659

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 123/190 (65%), Gaps = 11/190 (6%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllv-------dglgdgv  602
            A RR F  L E ++D PV+  + +P D  +D  +++A ++AG +LV              
Sbjct  469  AIRRAFVRLLEQNIDIPVVIKLNYP-DQDKDQTMLNAATDAGGMLVDGLGDGIMLGISAK  527

Query  601  lLEAPDSDFDFIR---NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTS  431
              +   S  D ++   + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T 
Sbjct  528  TSQEKLSILDTVKLHNSVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTD  587

Query  430  HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDL  251
            HL GV I IMGCIVNGPGEMADADFGYVG   GKI LY GK VVKR++  ++A D LI++
Sbjct  588  HLKGVKIGIMGCIVNGPGEMADADFGYVGSGKGKITLYRGKEVVKRSVPSEKAVDELIEI  647

Query  250  IKEHGRWVDP  221
            IK+ G W +P
Sbjct  648  IKKDGMWNEP  657



>ref|XP_001610211.1| gcpE protein [Babesia bovis]
 gb|EDO06643.1| gcpE protein [Babesia bovis]
Length=772

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 137/190 (72%), Gaps = 5/190 (3%)
 Frame = -3

Query  784  EEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdg  605
            + K++ V   RR+F  L +N    PV+H ++  +    +++VI+  +   T L+D LG+G
Sbjct  585  DSKLNHVETVRRIFGILVKNGSKLPVVHMVDATECFDHEEVVINVSTALSTHLIDKLGEG  644

Query  604  vlLEA--PDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTS  431
            V++++  P ++ + I   + ++LQ  RMR+ KTE++SCPSCGRTLFD+Q+ +  I+++  
Sbjct  645  VMIKSRLPLAESNDI---ALSILQAARMRSFKTEFISCPSCGRTLFDIQKTTESIKKRVG  701

Query  430  HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDL  251
            HLPGVSIAIMGCIVNG GEMADADFGYVGGAP K+DLYV K +V+R +   +A D LI+L
Sbjct  702  HLPGVSIAIMGCIVNGIGEMADADFGYVGGAPHKVDLYVKKELVERNVPDVEACDRLIEL  761

Query  250  IKEHGRWVDP  221
            IK+HG+WV+P
Sbjct  762  IKKHGKWVEP  771



>ref|WP_008627688.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Mariniradius 
saccharolyticus]
 gb|EMS33361.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Mariniradius 
saccharolyticus AK6]
Length=663

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 122/209 (58%), Gaps = 14/209 (7%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA---  650
            D  ++LH+     +    + A RR F  L EN    PV+  +++P       ++ +A   
Sbjct  454  DVVIILHS-----DNAHNMAALRRAFVQLMENHSQIPVVVKVDYPAQTQDKTMLYAATDV  508

Query  649  ------GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSC  488
                  G   G ++          E          + SF +LQ  R R +KTEY+SCPSC
Sbjct  509  GGLLVDGLGEGIMIGLEAYREAPREVLLEQVKLHNSVSFGVLQAARTRMSKTEYISCPSC  568

Query  487  GRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGK  308
            GRTLFDLQE +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY GK
Sbjct  569  GRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKGK  628

Query  307  TVVKRAIAMDQATDALIDLIKEHGRWVDP  221
             VVKR++A ++A D LI++I++ G W++P
Sbjct  629  EVVKRSVASEKAVDELIEIIRKDGMWIEP  657



>ref|WP_028788241.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Terrimonas 
ferruginea]
Length=670

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  574  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  395
            +F+ NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A+IR +T HL GV IAIMGC
Sbjct  552  EFVNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTAKIRSRTHHLKGVKIAIMGC  611

Query  394  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            IVNGPGEMADADFGYVG  PGKI LY GK VVK+ +  + A D LI+L+KE+  WVDP
Sbjct  612  IVNGPGEMADADFGYVGSGPGKITLYKGKEVVKKNVNSETAVDELINLLKENEAWVDP  669



>ref|WP_020152560.1| hypothetical protein, partial [Verrucomicrobia bacterium SCGC 
AAA300-N18]
Length=535

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -3

Query  577  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  398
             D  R  ++N+LQG R R +KTE+V+CPSCGRTLFDLQ  + +++E TSHL GV+IA+MG
Sbjct  417  LDRNRGLAYNVLQGARARISKTEFVACPSCGRTLFDLQSTTQKVKEATSHLKGVTIAVMG  476

Query  397  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            CIVNGPGEMADADFGYVG  PGKIDLYVGK  VK AI  + A D L+DLI+E G+W++P
Sbjct  477  CIVNGPGEMADADFGYVGSGPGKIDLYVGKNRVKSAIPENDAVDRLVDLIQEEGKWIEP  535



>ref|WP_041873442.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA164-O14]
Length=256

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  556  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  377
            S+N+LQ    R  KT+YV+CPSCGRTLF+LQE + +IRE T HL GV IA+MGCIVNGPG
Sbjct  138  SYNILQAAGARIFKTDYVACPSCGRTLFNLQETTQKIREATGHLKGVRIAVMGCIVNGPG  197

Query  376  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            EMADADFGYVGGAPGKI+LYVGK  VK  I   +A + L DLI EHGRWVD P +
Sbjct  198  EMADADFGYVGGAPGKINLYVGKKAVKFNIPEGEAVERLQDLICEHGRWVDAPEQ  252



>ref|WP_035071223.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Anditalea 
andensis]
 gb|KEO74886.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Anditalea 
andensis]
Length=663

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 122/207 (59%), Gaps = 19/207 (9%)
 Frame = -3

Query  802  HNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA---------  650
            HN+P          A RR    L +  +  PV+  + +P   +   ++ +A         
Sbjct  465  HNMP----------ALRRAMVSLIKRGVMTPVVFQVSYPDQDNDKTMLYAATDVGGLLID  514

Query  649  GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFD  470
            G   G ++          E   +      + SF +LQ  R R +KTEY+SCPSCGRTLFD
Sbjct  515  GQGDGVMISMSKSKKQNREEIFAQIKLHNSVSFGVLQAARTRMSKTEYISCPSCGRTLFD  574

Query  469  LQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRA  290
            LQE +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY GK V+KR+
Sbjct  575  LQETTAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKGKEVMKRS  634

Query  289  IAMDQATDALIDLIKEHGRWVDPPTEE  209
            ++ D+A D LI++IK+ G+W++P TE+
Sbjct  635  VSSDRAVDELINIIKKDGQWIEPETEK  661



>gb|EDM36017.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pedobacter 
sp. BAL39]
Length=618

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 121/180 (67%), Gaps = 2/180 (1%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDS  581
            A R LF  L    L  PVI    +P  ++ DDL++ A ++ G LL DG+GDGV + A ++
Sbjct  440  AQRALFVELMRQELQIPVIIKRAYPS-VNADDLMLYAATDLGALLTDGMGDGVWITADET  498

Query  580  -DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAI  404
                 + +TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE +  IR +T HL G+ I I
Sbjct  499  VGLGLVNSTSFGILQATRTRISKTEYISCPSCGRTLFDLQETTQLIRSRTDHLKGIKIGI  558

Query  403  MGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  224
            MGCIVNGPGEMADAD+GYVG  P KI LY GK VVK+ +   +A D LI LIKE G WVD
Sbjct  559  MGCIVNGPGEMADADYGYVGTGPDKITLYRGKEVVKKNVNSARALDDLISLIKEDGNWVD  618



>ref|WP_009185621.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cecembia 
lonarensis]
 gb|EKB48817.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cecembia 
lonarensis LW9]
Length=659

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 124/210 (59%), Gaps = 14/210 (7%)
 Frame = -3

Query  823  SDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA--  650
             D  ++LH+     E +  + A RR F  L EN    PV+  + +PK      ++ +A  
Sbjct  453  KDVVIILHS-----ENLHNMPALRRAFFDLLENHNQLPVVIKVNYPKQPQDQTMLYAATD  507

Query  649  -------GSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPS  491
                   G   G ++      GV      +      + SF +LQ  R R +KTEY+SCPS
Sbjct  508  VGGLLVDGLGEGIMIGLEAYHGVERSEVLAQIKLHNSVSFGVLQAARTRMSKTEYISCPS  567

Query  490  CGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVG  311
            CGRTLFDLQE +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY G
Sbjct  568  CGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKG  627

Query  310  KTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            K VVKR++  ++A D LI++I++ G W++P
Sbjct  628  KEVVKRSVPSEKAVDELIEIIRKDGMWIEP  657



>ref|WP_039866655.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pedobacter 
sp. BAL39]
Length=653

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 121/180 (67%), Gaps = 2/180 (1%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDS  581
            A R LF  L    L  PVI    +P  ++ DDL++ A ++ G LL DG+GDGV + A ++
Sbjct  475  AQRALFVELMRQELQIPVIIKRAYPS-VNADDLMLYAATDLGALLTDGMGDGVWITADET  533

Query  580  -DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAI  404
                 + +TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE +  IR +T HL G+ I I
Sbjct  534  VGLGLVNSTSFGILQATRTRISKTEYISCPSCGRTLFDLQETTQLIRSRTDHLKGIKIGI  593

Query  403  MGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  224
            MGCIVNGPGEMADAD+GYVG  P KI LY GK VVK+ +   +A D LI LIKE G WVD
Sbjct  594  MGCIVNGPGEMADADYGYVGTGPDKITLYRGKEVVKKNVNSARALDDLISLIKEDGNWVD  653



>ref|WP_013452189.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Marivirga 
tractuosa]
 gb|ADR20038.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Marivirga 
tractuosa DSM 4126]
Length=651

 Score =   174 bits (440),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDF  575
            RRLF  L + S D PV+    + +D+  + L + + ++ G LL+DG GDGV + A +   
Sbjct  471  RRLFMELMQKSCDVPVVIGRAY-QDLSLEKLQLYSATDMGGLLIDGFGDGVFIAAENCGG  529

Query  574  D-FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  398
            D  I  T+FN+LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR +T+HL GV I IMG
Sbjct  530  DKAINETAFNILQASRTRISKTEYISCPSCGRTLFDLQETTAMIRNRTNHLKGVKIGIMG  589

Query  397  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            CIVNGPGEMADAD+GYVG   GKI LY G+ V+KR +  ++A D LID+I++ G+W++P
Sbjct  590  CIVNGPGEMADADYGYVGSGKGKITLYKGQEVMKRGVPSERAVDELIDIIRQDGKWLEP  648



>ref|WP_014772391.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Belliella 
baltica]
 gb|AFL84411.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Belliella 
baltica DSM 15883]
Length=659

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 117/198 (59%), Gaps = 9/198 (5%)
 Frame = -3

Query  787  SEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA---------GSNAG  635
            S E +    A RR F  + +N +  PV+  +++ +      ++ +A         G   G
Sbjct  460  SSENLHNYAALRRAFVKMIDNEIHLPVVIKVKYSQQTQDKTMLHAATDVGGLLIDGLGDG  519

Query  634  TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS  455
             LL          E          + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +
Sbjct  520  VLLDLSNYADQNRETILDQIKLHNSISFGVLQAARTRMSKTEYISCPSCGRTLFDLQETT  579

Query  454  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQ  275
            A IR++T HL GV I IMGCIVNGPGEMADADFGYVG   GKI LY GK VVKR++  ++
Sbjct  580  AMIRKRTDHLKGVKIGIMGCIVNGPGEMADADFGYVGSGKGKITLYKGKEVVKRSVPSEK  639

Query  274  ATDALIDLIKEHGRWVDP  221
            A D LI++IK+ G W+DP
Sbjct  640  AVDELIEIIKKDGMWIDP  657



>ref|WP_014681066.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Solitalea 
canadensis]
 gb|AFD07839.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Solitalea 
canadensis DSM 3403]
Length=670

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 126/202 (62%), Gaps = 4/202 (2%)
 Frame = -3

Query  826  SSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAG  647
            S+D TLVL         I  +   R+    L    LD PVI       D+  +D  + A 
Sbjct  469  SADKTLVL---ILETNSIHGMAEQRQFIFDLMIQQLDIPVIIK-RIYADVSEEDFQLEAS  524

Query  646  SNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDL  467
            ++ G LL DGLGDG+ ++        I +T+F +LQ  R R +KTEY+SCPSCGRTLFDL
Sbjct  525  TDVGALLTDGLGDGLWIQCDSVSSKVINSTAFGILQATRTRISKTEYISCPSCGRTLFDL  584

Query  466  QEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAI  287
            QE +  IR +T HL G+ I IMGCIVNGPGEMADAD+GYVG  PG I LY  K VVKR +
Sbjct  585  QETTQLIRSRTDHLKGIKIGIMGCIVNGPGEMADADYGYVGTGPGVITLYKEKEVVKRNV  644

Query  286  AMDQATDALIDLIKEHGRWVDP  221
            A + A D LI+LIKE+G WVDP
Sbjct  645  AAEHAVDELINLIKENGDWVDP  666



>ref|WP_026772720.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sediminibacterium 
sp. OR43]
Length=670

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -3

Query  574  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  395
             F+  T+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A IRE T+HL GV IAIMGC
Sbjct  550  QFVNATAFSILQATRTRISKTEYISCPSCGRTLFDLQETTARIREVTNHLKGVKIAIMGC  609

Query  394  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            IVNGPGEMADADFGYVG   GKI LY GK +VKR +  + A D LI+++KEHG WV+P
Sbjct  610  IVNGPGEMADADFGYVGSGVGKITLYKGKEIVKRNVESEVAVDELINILKEHGAWVEP  667



>ref|WP_026768257.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sediminibacterium 
sp. OR53]
Length=670

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -3

Query  574  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  395
             F+  T+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A IRE T+HL GV IAIMGC
Sbjct  550  QFVNATAFSILQATRTRISKTEYISCPSCGRTLFDLQETTARIREVTNHLKGVKIAIMGC  609

Query  394  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            IVNGPGEMADADFGYVG   GKI LY GK +VKR +  + A D LI+++KEHG WV+P
Sbjct  610  IVNGPGEMADADFGYVGSGVGKITLYKGKEIVKRNVESEVAVDELINILKEHGAWVEP  667



>ref|WP_002702180.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Microscilla 
marina]
 gb|EAY25803.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Microscilla 
marina ATCC 23134]
Length=664

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 115/188 (61%), Gaps = 7/188 (4%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKD-IHRDDLVISAGSNA------GTllvdglgdgvlL  596
            RR+F  L E  L+ PV+   ++ K+ I    L  S           G  ++   G     
Sbjct  476  RRVFFELMEQGLELPVVVKRDYAKENIELVQLYASTDVGGLLIDGWGDGIMLSNGQPENK  535

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            E      + + N SF +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV
Sbjct  536  EELLEQINQLNNLSFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGV  595

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
             I IMGCIVNGPGEMADAD+GYVG   GKI LY  KTVVKR +  + A D LI+LI+E G
Sbjct  596  KIGIMGCIVNGPGEMADADYGYVGSGKGKITLYRSKTVVKRGVPSEHAVDELIELIREDG  655

Query  235  RWVDPPTE  212
            RW++  +E
Sbjct  656  RWLERTSE  663



>gb|AHM63652.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Flammeovirgaceae 
bacterium 311]
Length=667

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 118/190 (62%), Gaps = 11/190 (6%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllv------dglgdgvl  599
            A RR F  L E  +  PV+ H  + K +  D+L + A ++ G LL+        L     
Sbjct  473  ALRRFFFRLMEAGVAAPVVVHRTY-KGLTADELQLYAATDVGGLLIDGLGDGVMLSQDKA  531

Query  598  LEAPDSDFDFIRNT----SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTS  431
              + D D   +  T     F +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T 
Sbjct  532  EHSVDVDKQLVTKTLNSLGFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRKRTD  591

Query  430  HLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDL  251
            HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY G+ VVKR +  ++A D LI L
Sbjct  592  HLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYRGQEVVKRNVPSEKAVDELIGL  651

Query  250  IKEHGRWVDP  221
            I+E GRW++P
Sbjct  652  IREDGRWLEP  661



>ref|WP_015809258.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pedobacter 
heparinus]
 gb|ACU05649.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pedobacter 
heparinus DSM 2366]
Length=644

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 123/185 (66%), Gaps = 4/185 (2%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlL  596
            ++ V A R  F  L E  L  PVI    +   ++ DDL++ A ++ G LL DG+GDGV +
Sbjct  459  LNGVAAQRAFFNALIEKGLQIPVIIKRSYTA-VNTDDLMLYAATDMGALLTDGMGDGVWI  517

Query  595  EAPDS--DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLP  422
            +A D+      I  TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE +  IR +T HL 
Sbjct  518  DA-DALLGLSLINATSFGILQATRTRISKTEYISCPSCGRTLFDLQETTQLIRSRTDHLK  576

Query  421  GVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKE  242
            G+ I IMGCIVNGPGEMADAD+GYVG  P KI LY GK VVK+ +   +A D LIDLIKE
Sbjct  577  GIKIGIMGCIVNGPGEMADADYGYVGTGPDKITLYRGKEVVKKNVNAARALDDLIDLIKE  636

Query  241  HGRWV  227
             G WV
Sbjct  637  DGNWV  641



>ref|WP_025298932.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Niabella 
soli]
 gb|AHF15883.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Niabella 
soli DSM 19437]
Length=674

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = -3

Query  586  DSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIA  407
            +S   F+ NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE + +IR  T+HL GV IA
Sbjct  553  NSVHQFLNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTTKIRSVTNHLKGVKIA  612

Query  406  IMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWV  227
            IMGCIVNGPGEMADADFGYVG  PGKI LY GK VVKR +  D A + LI+L+KE+  W+
Sbjct  613  IMGCIVNGPGEMADADFGYVGSGPGKITLYKGKEVVKRNVNSDIAVEELINLLKENEAWI  672

Query  226  DP  221
            +P
Sbjct  673  EP  674



>ref|WP_012925967.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Spirosoma 
linguale]
 gb|ADB37416.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Spirosoma 
linguale DSM 74]
Length=678

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 128/186 (69%), Gaps = 6/186 (3%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAP----  587
            RRL   L    +  PVI +  +P  +  +++ + A ++ G LL+DGLGDG++L AP    
Sbjct  491  RRLVVELINRGITAPVIINRGYPA-VSEEEVPLYASTDVGGLLIDGLGDGIMLSAPQANP  549

Query  586  -DSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSI  410
             D+D   + N SF +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV I
Sbjct  550  SDADLKRLNNLSFGILQAARTRITKTEYISCPSCGRTLFDLQETTALIRQRTDHLKGVKI  609

Query  409  AIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRW  230
             IMGCIVNGPGEMADAD+GYVG    KI LY G+ V+K+++  D+A D LI+LI+E  RW
Sbjct  610  GIMGCIVNGPGEMADADYGYVGIGRDKIALYRGQQVIKKSVPADRAVDELIELIREDNRW  669

Query  229  VDPPTE  212
            ++P  E
Sbjct  670  LEPTFE  675



>gb|EOQ87425.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
yanagawae serovar Saopaulo str. Sao Paulo = ATCC 700523]
Length=654

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 126/178 (71%), Gaps = 5/178 (3%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDF  575
            R+L   L E+  D+P++  +    D ++D L+ +A   AG  L+DG+GD + L   D + 
Sbjct  481  RKLAFLLKES--DYPIVLQV---TDQNKDQLMYNASIKAGGSLLDGIGDVIRLSYGDGEA  535

Query  574  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  395
            +   + SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A+I+EKT HL GV IA+MGC
Sbjct  536  EECLHLSFDILQATRLRLTKTEYISCPSCGRTMFDLQTTTAKIKEKTGHLKGVKIAVMGC  595

Query  394  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            IVNGPGEMADADFGYVG   GK+ LY GK +VK+ ++  +A + LI+LI+E+G W DP
Sbjct  596  IVNGPGEMADADFGYVGAGVGKVHLYKGKEIVKKGVSEVEAPELLIELIRENGMWNDP  653



>ref|WP_024283448.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Algoriphagus 
marincola]
Length=660

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 114/198 (58%), Gaps = 12/198 (6%)
 Frame = -3

Query  778  KISRVH---AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA---------GSNAG  635
            K S  H   A RR F  L +  +  PV+  + +P       ++ +A         G   G
Sbjct  460  KTSNAHGMPALRRAFVSLMDQQIQVPVVVKVSYPDQTADQTMLYAATDVGGLLVDGMGDG  519

Query  634  TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS  455
             L+          E          N SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +
Sbjct  520  ILISLEKEKSHTREEVLEQIKLHNNVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETT  579

Query  454  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQ  275
            A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY GK V+KR++  ++
Sbjct  580  AMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKGKEVIKRSVPSEK  639

Query  274  ATDALIDLIKEHGRWVDP  221
            A D LI++I+E G W +P
Sbjct  640  AVDELIEIIREDGMWSEP  657



>ref|WP_009508000.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutaceae 
bacterium TAV5]
 gb|AHF93002.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutaceae 
bacterium TAV5]
Length=738

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = -3

Query  586  DSDFDFIR--NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            ++D D +R    ++N+LQG   R TKTEYV+CPSCGRTLFDLQ  +  IR+KT HL GV 
Sbjct  606  ETDPDPVRANKLAYNILQGAGARVTKTEYVACPSCGRTLFDLQTTTQRIRQKTGHLKGVK  665

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            +AIMGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  V+  I   +A   LI+LIK+HG+
Sbjct  666  LAIMGCIVNGPGEMADADFGYVGGAPGKINLYVGKNCVQYNIPQAEADARLIELIKQHGK  725

Query  232  WVDP  221
            W++P
Sbjct  726  WMEP  729



>ref|WP_039929258.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
yanagawae]
Length=675

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 126/178 (71%), Gaps = 5/178 (3%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDF  575
            R+L   L E+  D+P++  +    D ++D L+ +A   AG  L+DG+GD + L   D + 
Sbjct  502  RKLAFLLKES--DYPIVLQV---TDQNKDQLMYNASIKAGGSLLDGIGDVIRLSYGDGEA  556

Query  574  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  395
            +   + SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A+I+EKT HL GV IA+MGC
Sbjct  557  EECLHLSFDILQATRLRLTKTEYISCPSCGRTMFDLQTTTAKIKEKTGHLKGVKIAVMGC  616

Query  394  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            IVNGPGEMADADFGYVG   GK+ LY GK +VK+ ++  +A + LI+LI+E+G W DP
Sbjct  617  IVNGPGEMADADFGYVGAGVGKVHLYKGKEIVKKGVSEVEAPELLIELIRENGMWNDP  674



>ref|WP_039477998.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pedobacter 
kyungheensis]
 gb|KIA92537.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pedobacter 
kyungheensis]
Length=661

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 121/188 (64%), Gaps = 4/188 (2%)
 Frame = -3

Query  778  KISRVHA---ARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgd  608
            K S VH     R  F  L   ++  PVI    + +D   D+L++ A ++ G LL DG GD
Sbjct  473  KTSAVHGMAEQRTFFTALQAQNIQVPVIIKRSY-EDADADNLMLYAATDLGALLTDGFGD  531

Query  607  gvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSH  428
            GV ++A   +   I +TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE +  IR +T H
Sbjct  532  GVWIDAQGQNLALINSTSFGILQATRTRISKTEYISCPSCGRTLFDLQETTQLIRSRTDH  591

Query  427  LPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLI  248
            L G+ I IMGCIVNGPGEMADAD+GYVG  P KI LY GK VVK+ +    A D LID+I
Sbjct  592  LKGIKIGIMGCIVNGPGEMADADYGYVGTGPDKITLYRGKEVVKKNVTTAYALDELIDII  651

Query  247  KEHGRWVD  224
            K  G WV+
Sbjct  652  KGDGNWVE  659



>ref|WP_018627269.1| hypothetical protein [Niabella aurantiaca]
Length=665

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  571  FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCI  392
            F+ NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE + +IR  T HL GV IAIMGCI
Sbjct  549  FMNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTTKIRSVTHHLKGVKIAIMGCI  608

Query  391  VNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            VNGPGEMADADFGYVG  PGKI LY GK VVKR +  D A D LI+L+KE+  W++P
Sbjct  609  VNGPGEMADADFGYVGSGPGKITLYKGKDVVKRNVNSDIAVDELINLLKENEAWIEP  665



>ref|WP_028261665.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Verrucomicrobia 
bacterium SCGC AAA027-I19]
Length=592

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 93/125 (74%), Gaps = 4/125 (3%)
 Frame = -3

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            AP   F      S+N+LQ   +R  KT+YV+CPSCGRTLF+LQ  + +IR  T HL GV 
Sbjct  466  APGQSFRL----SYNILQAAGVRIFKTDYVACPSCGRTLFNLQSTTQKIRAATGHLKGVR  521

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            IA+MGCIVNGPGEMADADFGYVGGAPGKI+LYVGKT VK  I  D+A   LIDLI EHG+
Sbjct  522  IAVMGCIVNGPGEMADADFGYVGGAPGKINLYVGKTAVKFNIPEDEAVSRLIDLITEHGK  581

Query  232  WVDPP  218
            WVD P
Sbjct  582  WVDAP  586



>ref|WP_020149813.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA164-M04]
Length=590

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = -3

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            EAP          S+N+LQ    R  KT+YV+CPSCGRTLF+LQE + +IRE T HL GV
Sbjct  463  EAPGQSLRL----SYNILQAAGARIFKTDYVACPSCGRTLFNLQETTQKIREATGHLKGV  518

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
             IA+MGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  VK  I   +A + L DLI+EHG
Sbjct  519  RIAVMGCIVNGPGEMADADFGYVGGAPGKINLYVGKKAVKFNIPEGEAVERLQDLIREHG  578

Query  235  RWVDPPTE  212
            RWVD P +
Sbjct  579  RWVDAPEQ  586



>ref|WP_014020335.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cyclobacterium 
marinum]
 gb|AEL26042.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cyclobacterium 
marinum DSM 745]
Length=663

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 116/194 (60%), Gaps = 9/194 (5%)
 Frame = -3

Query  769  RVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA---------GSNAGTllvdg  617
            ++ A RR    L +  ++ PV+  + + +      ++ SA         G   G ++   
Sbjct  466  QMQAIRRAIVSLIDAEINLPVVPKVSYSEKDAEKTMLFSATDVGGLLIDGLGDGMVIGLD  525

Query  616  lgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREK  437
                   E   +      + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++
Sbjct  526  QLQLRDKEEKLAQVKLHNSVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTALIRKR  585

Query  436  TSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALI  257
            T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY GK V+KR++  + A D LI
Sbjct  586  TDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKGKEVMKRSVPSENAVDELI  645

Query  256  DLIKEHGRWVDPPT  215
            D+IKE G+W++P T
Sbjct  646  DIIKEDGQWIEPET  659



>gb|AEA43526.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Fluviicola 
taffensis DSM 16823]
Length=644

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  568  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  389
            + + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE + +IRE+TSHL G+ I IMGCIV
Sbjct  527  LNSLSFGILQATRTRISKTEYISCPSCGRTLFDLQETTGKIRERTSHLKGLKIGIMGCIV  586

Query  388  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            NGPGEMADAD+GYVG  PGKI+LY  KTVVK+ ++ ++A DALI LI+++G W++P
Sbjct  587  NGPGEMADADYGYVGTGPGKINLYKEKTVVKKNVSEEEAVDALIQLIRDNGDWIEP  642



>ref|WP_043024168.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Fluviicola 
taffensis]
Length=632

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  568  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  389
            + + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE + +IRE+TSHL G+ I IMGCIV
Sbjct  515  LNSLSFGILQATRTRISKTEYISCPSCGRTLFDLQETTGKIRERTSHLKGLKIGIMGCIV  574

Query  388  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            NGPGEMADAD+GYVG  PGKI+LY  KTVVK+ ++ ++A DALI LI+++G W++P
Sbjct  575  NGPGEMADADYGYVGTGPGKINLYKEKTVVKKNVSEEEAVDALIQLIRDNGDWIEP  630



>ref|WP_012388276.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
biflexa]
 gb|ABZ93753.1| Deoxyxylulose biosynthesis protein [Leptospira biflexa serovar 
Patoc strain 'Patoc 1 (Ames)']
 gb|ABZ97395.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase) [Leptospira 
biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Length=675

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 126/180 (70%), Gaps = 5/180 (3%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDS  581
            + R+L   L E+  D+P++ ++      ++D L+  A   AG  L+DG+GD + L   D 
Sbjct  500  SLRKLACLLQES--DYPIVLNVSAK---NKDQLMYDASIKAGGSLLDGIGDVIRLSFGDG  554

Query  580  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  401
            + +   + SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A+I+EKT HL GV IA+M
Sbjct  555  EAEECLHLSFDILQATRLRLTKTEYISCPSCGRTMFDLQSTTAKIKEKTGHLKGVKIAVM  614

Query  400  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            GCIVNGPGEMADADFGYVG   GK+ LY GK +VK+ ++  +A D LI+LI+E+G W DP
Sbjct  615  GCIVNGPGEMADADFGYVGAGVGKVHLYKGKEIVKKGVSETEAPDLLIELIRENGMWNDP  674



>gb|ELR70856.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Fulvivirga 
imtechensis AK7]
Length=619

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 126/216 (58%), Gaps = 15/216 (7%)
 Frame = -3

Query  826  SSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAG  647
              DAT++L     S +    +   RR F  L  N+L+ PVI    +  D+  D L I A 
Sbjct  407  KGDATVIL---VLSTDNKHGLAEQRRAFFELIRNNLEIPVIIKRSYA-DLTDDQLQIYAA  462

Query  646  SNAG-----------TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVS  500
            ++ G            L  +    G   E   +      NT F +LQ  R R TKTEY+S
Sbjct  463  TDVGGLLIDGLGDGVMLGTEIAAGGKSREEMQNLVQSYNNTGFGILQAARTRMTKTEYIS  522

Query  499  CPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDL  320
            CPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI L
Sbjct  523  CPSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITL  582

Query  319  YVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            Y G+ VVKR++  ++A D LI++I++ G W++  +E
Sbjct  583  YKGQEVVKRSVPSEKAVDELIEIIRQDGNWLEKKSE  618



>ref|WP_040496810.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Fulvivirga 
imtechensis]
Length=662

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 126/214 (59%), Gaps = 15/214 (7%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSN  641
            DAT++L     S +    +   RR F  L  N+L+ PVI    +  D+  D L I A ++
Sbjct  452  DATVIL---VLSTDNKHGLAEQRRAFFELIRNNLEIPVIIKRSYA-DLTDDQLQIYAATD  507

Query  640  AG-----------TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCP  494
             G            L  +    G   E   +      NT F +LQ  R R TKTEY+SCP
Sbjct  508  VGGLLIDGLGDGVMLGTEIAAGGKSREEMQNLVQSYNNTGFGILQAARTRMTKTEYISCP  567

Query  493  SCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYV  314
            SCGRTLFDLQE +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY 
Sbjct  568  SCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYK  627

Query  313  GKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  212
            G+ VVKR++  ++A D LI++I++ G W++  +E
Sbjct  628  GQEVVKRSVPSEKAVDELIEIIRQDGNWLEKKSE  661



>ref|WP_015265930.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Echinicola 
vietnamensis]
 gb|AGA78371.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Echinicola 
vietnamensis DSM 17526]
Length=661

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 5/133 (4%)
 Frame = -3

Query  592  APDSD-----FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSH  428
            APD D          + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T H
Sbjct  529  APDRDALMETIKLHNSVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDH  588

Query  427  LPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLI  248
            L GV I IMGCIVNGPGEMADAD+GYVG   GKI LY GK VVKRA+  +QA D LI++I
Sbjct  589  LKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKGKEVVKRAVPSEQAVDELINII  648

Query  247  KEHGRWVDPPTEE  209
            +E G+W++P   E
Sbjct  649  REDGQWIEPEAVE  661



>ref|WP_012377418.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutus 
terrae]
 gb|ACB77904.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutus 
terrae PB90-1]
Length=677

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = -3

Query  586  DSDFDFIRNT--SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            +++ D +R T  ++N+LQG   R +KTE+V+CPSCGRTLFDLQ  +  IR +T HL GV 
Sbjct  549  ETEADPVRATKLAYNVLQGAGARTSKTEFVACPSCGRTLFDLQTTTQRIRAQTGHLKGVK  608

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            +AIMGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  V   I   +A   LI LIKEHG+
Sbjct  609  LAIMGCIVNGPGEMADADFGYVGGAPGKINLYVGKQCVAYNIPQAEADARLIALIKEHGK  668

Query  232  WVDP  221
            WVDP
Sbjct  669  WVDP  672



>ref|WP_041952338.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Spirosoma 
spitsbergense]
Length=649

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 126/179 (70%), Gaps = 2/179 (1%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDS-D  578
            RRLF  L   S+  P+     +  ++  +D+ + A ++ G LL+DGLGDG++L  P+S D
Sbjct  467  RRLFVELINQSITTPIAVQRSY-SNVPDEDVPLYAATDVGGLLIDGLGDGIMLAQPESGD  525

Query  577  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  398
               + + +F +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMG
Sbjct  526  LKTLNSLAFGILQAARTRITKTEYISCPSCGRTLFDLQETTARIRQRTDHLKGVKIGIMG  585

Query  397  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            CIVNGPGEMADAD+GYVG    KI LY G+ V+K+++  D+A D LI+LI+E  RW++P
Sbjct  586  CIVNGPGEMADADYGYVGIGRDKIALYRGQQVIKKSVPADRAVDELIELIREDARWIEP  644



>gb|EMJ86182.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
meyeri serovar Semaranga str. Veldrot Semarang 173]
Length=661

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 9/182 (5%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVI--HHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAP  587
              R+L   L E+  D+P+I  HH E      +D+L+  +  + G  L+DG+GD V L   
Sbjct  486  TVRKLAYQLRES--DYPIILVHHSE-----DKDELLYESSIHVGGSLLDGIGDVVRLSYG  538

Query  586  DSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIA  407
            D + +   + SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I++KT HL GV IA
Sbjct  539  DGEPEESLHLSFDILQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKQKTGHLKGVKIA  598

Query  406  IMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWV  227
            +MGCIVNGPGEMADADFGYVG   GK+ LY GK +VK+ ++  +A D LIDLI+E+G W 
Sbjct  599  VMGCIVNGPGEMADADFGYVGAGIGKVHLYKGKEIVKKGVSETEAADLLIDLIRENGMWN  658

Query  226  DP  221
            DP
Sbjct  659  DP  660



>ref|WP_026946987.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Algoriphagus 
marincola]
Length=660

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 114/198 (58%), Gaps = 12/198 (6%)
 Frame = -3

Query  778  KISRVH---AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA---------GSNAG  635
            K S  H   A RR F  L +  +  PV+  + +P       ++ +A         G   G
Sbjct  460  KTSNAHGMPALRRAFVSLMDLQIQVPVVVKVSYPDQTADQTMLYAATDVGGLLVDGMGDG  519

Query  634  TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEIS  455
             L+          E          N SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +
Sbjct  520  ILISLEKEKAHTREEVLEQIKLHNNVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETT  579

Query  454  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQ  275
            A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY GK V+KR++  ++
Sbjct  580  AMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKGKEVIKRSVPSEK  639

Query  274  ATDALIDLIKEHGRWVDP  221
            A D LI++I+E G W +P
Sbjct  640  AVDELIEIIREDGMWSEP  657



>gb|EKJ85057.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
meyeri serovar Hardjo str. Went 5]
Length=661

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 122/180 (68%), Gaps = 5/180 (3%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDS  581
              R+L   L E+     ++HH E      +D+L+  +  + G  L+DG+GD V L   D 
Sbjct  486  TVRKLSYQLRESDYPIVLVHHSE-----DKDELLYESSIHVGGSLLDGIGDVVRLSYGDG  540

Query  580  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  401
            + +   + SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I++KT HL GV IA+M
Sbjct  541  EPEESLHLSFDILQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKQKTGHLKGVKIAVM  600

Query  400  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            GCIVNGPGEMADADFGYVG   GK+ LY GK +VK+ ++  +A D LIDLI+E+G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGIGKVHLYKGKEIVKKGVSETEAADLLIDLIRENGMWNDP  660



>ref|WP_001011572.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EJP04903.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Bulgarica str. Mallika]
Length=663

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 122/195 (63%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS    +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGSILSR--FEFPILLHGSFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +  +   D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWQDP  660



>ref|WP_001011575.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EKO04935.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. C10069]
 gb|EKO96673.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. Brem 329]
 gb|EKR15531.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pyrogenes str. 2006006960]
 gb|EMN30563.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pyrogenes str. L0374]
 gb|EMN53644.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Autumnalis str. LP101]
 gb|EMN64626.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pyrogenes str. R168]
 gb|EMP04908.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pyrogenes str. 200701872]
Length=663

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 122/195 (63%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS    +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGSILSR--FEFPILLHGSFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +  +   D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWQDP  660



>ref|WP_001011584.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EKO89042.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. Andaman]
 gb|EKP83542.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. 2006006986]
 gb|EKR57322.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. UI 12758]
Length=663

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 122/195 (63%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS    +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGSILSR--FEFPILLHGSFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +  +   D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWQDP  660



>ref|WP_035983785.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
meyeri]
Length=681

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 9/182 (5%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVI--HHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAP  587
              R+L   L E+  D+P+I  HH E      +D+L+  +  + G  L+DG+GD V L   
Sbjct  506  TVRKLAYQLRES--DYPIILVHHSE-----DKDELLYESSIHVGGSLLDGIGDVVRLSYG  558

Query  586  DSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIA  407
            D + +   + SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I++KT HL GV IA
Sbjct  559  DGEPEESLHLSFDILQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKQKTGHLKGVKIA  618

Query  406  IMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWV  227
            +MGCIVNGPGEMADADFGYVG   GK+ LY GK +VK+ ++  +A D LIDLI+E+G W 
Sbjct  619  VMGCIVNGPGEMADADFGYVGAGIGKVHLYKGKEIVKKGVSETEAADLLIDLIRENGMWN  678

Query  226  DP  221
            DP
Sbjct  679  DP  680



>ref|WP_030001802.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Marinimicrobia 
bacterium SCGC AAA003-E22]
Length=649

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 134/201 (67%), Gaps = 5/201 (2%)
 Frame = -3

Query  823  SDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGS  644
            +D T VL    Y+E  ++     RRLF  L   +   PVI    +  D+  ++L + + +
Sbjct  445  NDPTAVLLIYTYNEHGMAE---QRRLFMELISENCQTPVIIGKAY-GDLTPENLQLYSAT  500

Query  643  NAGTllvdglgdgvlLEAPD-SDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDL  467
            + G LL+DGLGDGV +EA      + +  T+F +LQ  R R +KTEY+SCPSCGRTLFDL
Sbjct  501  DMGALLIDGLGDGVFIEAEGCGSLEQVNQTAFGILQASRTRISKTEYISCPSCGRTLFDL  560

Query  466  QEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAI  287
            QE +A +R +TSHL G+ I IMGCIVNGPGEMADAD+GYVG   GKI LY G+ VV+  +
Sbjct  561  QETTALVRNRTSHLKGIKIGIMGCIVNGPGEMADADYGYVGTGVGKISLYRGQNVVQANL  620

Query  286  AMDQATDALIDLIKEHGRWVD  224
             M++A DALIDL+KE G WV+
Sbjct  621  PMEEAVDALIDLMKEDGVWVE  641



>gb|EMM80390.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2006001854]
Length=663

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 122/195 (63%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS    +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGSILSR--FEFPILLHGSFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +  +   D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWQDP  660



>ref|WP_040917603.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
meyeri]
Length=681

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 122/180 (68%), Gaps = 5/180 (3%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDS  581
              R+L   L E+     ++HH E      +D+L+  +  + G  L+DG+GD V L   D 
Sbjct  506  TVRKLSYQLRESDYPIVLVHHSE-----DKDELLYESSIHVGGSLLDGIGDVVRLSYGDG  560

Query  580  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  401
            + +   + SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I++KT HL GV IA+M
Sbjct  561  EPEESLHLSFDILQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKQKTGHLKGVKIAVM  620

Query  400  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            GCIVNGPGEMADADFGYVG   GK+ LY GK +VK+ ++  +A D LIDLI+E+G W DP
Sbjct  621  GCIVNGPGEMADADFGYVGAGIGKVHLYKGKEIVKKGVSETEAADLLIDLIRENGMWNDP  680



>ref|WP_025145959.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
sp. H1ai]
Length=659

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 116/177 (66%), Gaps = 1/177 (1%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDF  575
            R  F  L E ++  PVI    + +D   D L++ A ++ G L  DG GDGV ++A   + 
Sbjct  482  RAFFIALQEQNIQIPVIVKRTY-QDADADHLMLYAATDIGALFTDGFGDGVWIDAEGQNL  540

Query  574  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  395
              I +TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE +  IR +T HL G+ I IMGC
Sbjct  541  SLINSTSFGILQATRTRISKTEYISCPSCGRTLFDLQETTQLIRSRTDHLKGIKIGIMGC  600

Query  394  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  224
            IVNGPGEMADAD+GYVG  P KI LY GK VVK+ +    A D LID+IK  G WV+
Sbjct  601  IVNGPGEMADADYGYVGTGPDKITLYRGKEVVKKNVTTAYALDELIDIIKGDGNWVE  657



>gb|ABG59455.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cytophaga 
hutchinsonii ATCC 33406]
Length=665

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 126/216 (58%), Gaps = 14/216 (6%)
 Frame = -3

Query  826  SSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAG  647
            +SD T VL    ++E  ++ +   RR F  L    +  PVI    +    + + L ++A 
Sbjct  452  ASDTTAVLILESFNEHAMAEL---RRSFITLMNREIATPVIIKRAYTHK-NEETLFLAAS  507

Query  646  SNAG----------TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSC  497
            ++AG            L          EA  +    + N  F +LQ  R R TKTEY+SC
Sbjct  508  TDAGGLLVDGLGDGIFLSSEKMILAEKEALLAYLKSVNNLGFGILQAARTRMTKTEYISC  567

Query  496  PSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLY  317
            PSCGRTLFDLQE +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG    KI LY
Sbjct  568  PSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGVGKDKIALY  627

Query  316  VGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  209
             G+TVV +A+  D+A D LI++IKE G+W++P   E
Sbjct  628  RGQTVVNKAVHSDKAVDELINIIKEDGKWLEPVVSE  663



>ref|WP_001011587.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EMN47606.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. L1207]
Length=663

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 122/195 (63%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS    +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGSILSR--FEFPILLHGSFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +  +   D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY GK +V + + ++ A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKGIVLKNVPIEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWQDP  660



>ref|WP_041932708.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cytophaga 
hutchinsonii]
Length=657

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 126/216 (58%), Gaps = 14/216 (6%)
 Frame = -3

Query  826  SSDATLVLHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAG  647
            +SD T VL    ++E  ++ +   RR F  L    +  PVI    +    + + L ++A 
Sbjct  444  ASDTTAVLILESFNEHAMAEL---RRSFITLMNREIATPVIIKRAYTHK-NEETLFLAAS  499

Query  646  SNAG----------TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSC  497
            ++AG            L          EA  +    + N  F +LQ  R R TKTEY+SC
Sbjct  500  TDAGGLLVDGLGDGIFLSSEKMILAEKEALLAYLKSVNNLGFGILQAARTRMTKTEYISC  559

Query  496  PSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLY  317
            PSCGRTLFDLQE +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG    KI LY
Sbjct  560  PSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGVGKDKIALY  619

Query  316  VGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  209
             G+TVV +A+  D+A D LI++IKE G+W++P   E
Sbjct  620  RGQTVVNKAVHSDKAVDELINIIKEDGKWLEPVVSE  655



>ref|WP_044117870.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Alkaliflexus 
imshenetskii]
Length=625

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 122/185 (66%), Gaps = 1/185 (1%)
 Frame = -3

Query  775  ISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlL  596
            I+ V   R  F  ++ +++  PVI H  + K      L I AG++ G L +DG GDG+ +
Sbjct  441  INGVAEQRAFFLAMNHHAITNPVIVHRHY-KLTDESALQIIAGADTGMLFLDGFGDGISI  499

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
             AP+     +  T F +LQ  R+R ++TEY+SCP CGRTLFDLQ  + E+R KTSHL G+
Sbjct  500  HAPNVSLASVVETQFGILQASRVRFSRTEYISCPGCGRTLFDLQTTTEEVRRKTSHLKGL  559

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
             IA+MGCIVNG GEMADAD+GYVG  PG + L+  + +V R +  ++A DALIDLIKE G
Sbjct  560  KIAVMGCIVNGIGEMADADYGYVGAGPGVVSLFKNRELVSRNLPQEEAVDALIDLIKESG  619

Query  235  RWVDP  221
             WVDP
Sbjct  620  DWVDP  624



>ref|WP_012500067.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chloroherpeton 
thalassium]
 gb|ACF13983.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chloroherpeton 
thalassium ATCC 35110]
Length=687

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 122/185 (66%), Gaps = 1/185 (1%)
 Frame = -3

Query  766  VHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAP  587
            V A R L    +E+ L+FPV+          R  +++ +   AGT L DG+GD + L   
Sbjct  501  VFATRYLVRLFNESELNFPVMLRYNGKGISERQHVLVDSSIQAGTPLADGIGDAISL-VT  559

Query  586  DSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIA  407
            D       N ++++LQ  R+R +KTE++SCP CGRTLFDL+E + +I+ +T+HL G+ I 
Sbjct  560  DLTHKEELNFAYSILQAARIRVSKTEFISCPGCGRTLFDLEEATGKIKARTAHLKGLKIG  619

Query  406  IMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWV  227
            IMGCIVNGPGEMADADFGYVG   G+I LYVGK  V+R I  D+A D L++LIKEHG+W 
Sbjct  620  IMGCIVNGPGEMADADFGYVGTGHGEISLYVGKECVQRHIPEDEAVDKLVELIKEHGKWQ  679

Query  226  DPPTE  212
            +P  E
Sbjct  680  EPKEE  684



>ref|WP_026952032.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Algoriphagus 
mannitolivorans]
Length=660

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 112/191 (59%), Gaps = 9/191 (5%)
 Frame = -3

Query  760  AARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA---------GSNAGTllvdglgd  608
            A RR F  L E     PV+  + +P+      ++ SA         G   G ++      
Sbjct  469  ALRRAFVSLIEAKSTIPVVVKVSYPEQTADMTMLYSATDVGGLLVDGLGDGIMISLEKEG  528

Query  607  gvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSH  428
                +          + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T H
Sbjct  529  EHSRQEILDQIKLHNSVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDH  588

Query  427  LPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLI  248
            L GV I IMGCIVNGPGEMADAD+GYVG   GKI LY GK VVKR++  D+A D LI++I
Sbjct  589  LKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKGKEVVKRSVPSDRAVDELIEII  648

Query  247  KEHGRWVDPPT  215
            +E G W +P T
Sbjct  649  REDGMWNEPET  659



>ref|WP_002625642.1| MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira]
 gb|EMJ59981.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira sp. P2653]
 gb|EMM73393.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira weilii str. 2006001855]
 gb|EMN88120.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira weilii str. UI 13098]
 gb|EMY13564.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira weilii str. Ecochallenge]
Length=663

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 120/194 (62%), Gaps = 4/194 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S E    ++  R+L   LS    +FP++ H  FP     + L  SA    G L+
Sbjct  470  IKNVLFSIESKEILYDYRKLGSILSH--YEFPILLHGSFPNP--EEALYDSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +      D + I   S++LLQG R+R TKTEY+SCPSCGRTLF+LQE +A I
Sbjct  526  DGIGDLIRIKTPKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFNLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVMKNVPSEVADE  645

Query  265  ALIDLIKEHGRWVD  224
             L++LIKE G W D
Sbjct  646  KLVELIKEQGLWQD  659



>ref|WP_016761207.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
weilii]
Length=663

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 120/194 (62%), Gaps = 4/194 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S E    ++  R+L   LS    +FP++ H  FP     + L  SA    G L+
Sbjct  470  IKNVLFSIESKEILYDYRKLGSILSH--YEFPILLHGSFPNP--EEALYDSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +      D + I   S++LLQG R+R TKTEY+SCPSCGRTLF+LQE +A I
Sbjct  526  DGIGDLIRIKTPKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFNLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVMKNVPSEVADE  645

Query  265  ALIDLIKEHGRWVD  224
             L++LIKE G W D
Sbjct  646  KLVELIKEQGLWQD  659



>ref|WP_004765637.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri]
 gb|EKO15499.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. H1]
 gb|EKO61584.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. H2]
Length=663

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 121/195 (62%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS  S +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGNILS--SFEFPILLHGSFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +      D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTPKIKDIEEIFQLSYDLLQGARLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWSDP  660



>ref|WP_004506808.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira weilii]
 gb|EMF82040.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira weilii serovar Topaz str. LT2116]
Length=663

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 120/194 (62%), Gaps = 4/194 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S E    ++  R+L   LS    +FP++ H  FP     + L  SA    G L+
Sbjct  470  IKNVLFSIESKEILYDYRKLGSILSH--YEFPILLHGSFPNP--EEALYDSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +      D + I   S++LLQG R+R TKTEY+SCPSCGRTLF+LQE +A I
Sbjct  526  DGIGDLIRIKTPKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFNLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVMKNVPSEVADE  645

Query  265  ALIDLIKEHGRWVD  224
             L++LIKE G W D
Sbjct  646  KLVELIKEQGLWQD  659



>ref|WP_027000276.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flexibacter 
elegans]
Length=684

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 118/202 (58%), Gaps = 11/202 (5%)
 Frame = -3

Query  787  SEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAG---------  635
            S ++ + +   R   ++L    +  PV+ H  +   +  + L + A ++ G         
Sbjct  479  STQQPNALQTLRNAIQHLMRKDIQIPVLIHRTYSHTLDAESLQLQAATDMGGLLIDGLGD  538

Query  634  -TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEI  458
              +L          EA +     +   SF +LQ  R R TKTEY+SCPSCGRTLFDLQE 
Sbjct  539  GVMLSLDKYSDDKAEALEQ-VKMLNALSFGILQAARTRMTKTEYISCPSCGRTLFDLQET  597

Query  457  SAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMD  278
            +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG    KI LY G  VVKRA+  D
Sbjct  598  TAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKDKITLYRGMNVVKRAVPSD  657

Query  277  QATDALIDLIKEHGRWVDPPTE  212
            +A D LI LI+E G+W++ P+E
Sbjct  658  KAVDELIALIREDGKWIERPSE  679



>ref|WP_037439696.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
antarcticum]
 gb|KEQ30514.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
antarcticus 4BY]
Length=656

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  754  RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAP-DSD  578
            R  F  L    L FPVI    +P  I  + L + A ++ G L  DG GDGV L A  D  
Sbjct  475  RSFFTSLLNAGLTFPVIIKRSYPI-IDAETLQLYAATDLGALFTDGFGDGVWLNASEDIS  533

Query  577  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  398
               + +TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE + +IR +T HL G+ I IMG
Sbjct  534  LSLLNSTSFGILQATRTRISKTEYISCPSCGRTLFDLQETTQQIRSRTDHLKGIKIGIMG  593

Query  397  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  224
            CIVNGPGEMADAD+GYVG  PGKI LY GK VVK+ +    A D LI LIKE G W++
Sbjct  594  CIVNGPGEMADADYGYVGTGPGKITLYRGKEVVKKNVDSANALDDLIGLIKEDGNWIE  651



>ref|WP_020765666.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira santarosai]
 gb|EMK08546.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira santarosai str. CBC613]
Length=663

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 121/195 (62%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS  S +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGNILS--SFEFPILLHGSFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +      D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTPKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWSDP  660



>ref|WP_029998282.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Marinimicrobia 
bacterium SCGC AAA003-L08]
Length=645

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -3

Query  577  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  398
             D +  TSF +LQ  R R TKTEY+SCPSCGRTLFDLQE++A IR KT HL G+ I IMG
Sbjct  527  LDKVNRTSFGILQATRTRITKTEYISCPSCGRTLFDLQEVTARIRSKTQHLKGLKIGIMG  586

Query  397  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            CIVNGPGEMADAD+GYVG    KI LY    V+++ + MDQA +ALI+LIKE+G W+DP
Sbjct  587  CIVNGPGEMADADYGYVGTGIEKISLYKKHNVIQKDVPMDQADEALINLIKENGDWIDP  645



>ref|WP_026464184.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Adhaeribacter 
aquaticus]
Length=658

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 123/202 (61%), Gaps = 12/202 (6%)
 Frame = -3

Query  796  LPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAG------  635
            L Y+E K +     R+ F  L  N +  PVI   ++  D+H +   + A ++ G      
Sbjct  452  LLYTENKHAMAEL-RKGFFRLMNNGITNPVIIKRQY-TDMHAEQTQLYASTDVGGLLLDG  509

Query  634  ----TllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDL  467
                 +L   L      EA  S+ D +   SF +LQ  R R +KTEY+SCPSCGRTLFDL
Sbjct  510  FGDGIILSTALLSSRTKEAWLSEIDGLNKLSFGILQAARTRMSKTEYISCPSCGRTLFDL  569

Query  466  QEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAI  287
            QE +A IR++T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY G+ V+K+++
Sbjct  570  QETTAMIRKRTDHLKGVKIGIMGCIVNGPGEMADADYGYVGVGKGKIALYRGQNVIKKSV  629

Query  286  AMDQATDALIDLIKEHGRWVDP  221
                A D LI+LI+E G+WV+P
Sbjct  630  PEVAAVDELIELIREDGKWVEP  651



>ref|WP_038162080.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Verrucomicrobium 
sp. BvORR106]
Length=596

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = -3

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            EAP   F      S+N+LQ    R  KT+YV+CPSCGRTLF+LQ  + +IR  T HL GV
Sbjct  468  EAPGQSF----RISYNILQAAGTRIFKTDYVACPSCGRTLFNLQTTTQKIRAATGHLKGV  523

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
             IA+MGCIVNGPGEMADADFGYVGGAP KI+LYVGKT VK  I   +A + LIDLIKEH 
Sbjct  524  RIAVMGCIVNGPGEMADADFGYVGGAPDKINLYVGKTAVKFNIPEGEAVERLIDLIKEHN  583

Query  235  RWVDPPT  215
            RWVD PT
Sbjct  584  RWVDAPT  590



>ref|WP_002101771.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans]
 gb|EKR27856.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Bataviae str. L1111]
Length=663

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 122/195 (63%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS    +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGSILSR--FEFPILLHGFFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +  +   D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWQDP  660



>ref|WP_012509318.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Pelodictyon 
phaeoclathratiforme]
 gb|ACF44846.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pelodictyon 
phaeoclathratiforme BU-1]
Length=688

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 128/197 (65%), Gaps = 4/197 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIH-RDDLVISAGSNAGTl  629
            +  L +S      V   RRL E  +  +LD+P+I  + F K+   R + +I +   AGTL
Sbjct  491  VQRLIFSILSTDSVFVYRRLVEVFNRYALDYPLI--VRFKKESSDRLETLIDSSVQAGTL  548

Query  628  lvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAE  449
              DG+GD +      S  D ++  +FN+LQG R+R +KTE++SCP CGRT F+L++ +A 
Sbjct  549  FCDGIGDMLAFHTSLSWDDEVQ-LAFNILQGARVRMSKTEFISCPGCGRTYFELEKATAA  607

Query  448  IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQAT  269
            I+++T HL G+ I IMGCIVNGPGEMADADFGYVG    +I LYVGK  V+  I+   A 
Sbjct  608  IKQRTVHLKGLKIGIMGCIVNGPGEMADADFGYVGAGKNRISLYVGKECVEENISELDAV  667

Query  268  DALIDLIKEHGRWVDPP  218
            D LIDLI+E G+WVDPP
Sbjct  668  DRLIDLIRERGKWVDPP  684



>ref|WP_009965977.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Verrucomicrobium 
spinosum]
Length=596

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = -3

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            EAP   F      S+N+LQ    R  KT+YV+CPSCGRTLF+LQ  + +IR  T HL GV
Sbjct  468  EAPGQSF----RISYNILQAAGTRIFKTDYVACPSCGRTLFNLQTTTQKIRAATGHLKGV  523

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
             IA+MGCIVNGPGEMADADFGYVGGAP KI+LYVGKT VK  I   +A + LIDLIKEH 
Sbjct  524  RIAVMGCIVNGPGEMADADFGYVGGAPDKINLYVGKTAVKFNIPEGEAVERLIDLIKEHN  583

Query  235  RWVDPPT  215
            RWVD PT
Sbjct  584  RWVDAPT  590



>ref|WP_002752446.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii]
 gb|EMO63423.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii serovar Pomona str. 200901868]
Length=663

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 122/194 (63%), Gaps = 4/194 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S E    ++  R+L   LS++  +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSIESKEILYDYRKLGSILSQH--EFPILLHGSFSNP--EEALYDSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +      D + I   S++LLQG R+R TKTEY+SCPSCGRTLF+LQE +A I
Sbjct  526  DGIGDLIRIKTPKMKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFNLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVMKNVPSEVADE  645

Query  265  ALIDLIKEHGRWVD  224
             L++LIK+HG W D
Sbjct  646  KLVELIKKHGLWQD  659



>ref|WP_040580353.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Porphyromonas 
endodontalis]
Length=596

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 122/188 (65%), Gaps = 0/188 (0%)
 Frame = -3

Query  772  SRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE  593
            +RV   RR    L+E  +  P+    +F      + + I+A ++ GTLL++G G  ++L 
Sbjct  401  NRVGLWRRTIALLAEMGITAPIALEAQFAPHESLEKVQIAAATDLGTLLLEGAGSAIMLT  460

Query  592  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  413
            AP      ++  +  +LQ  R+R + TEY+SCP CGRTL++L+   A I++ TSHL  + 
Sbjct  461  APHLPLSSLQALALGILQATRLRFSHTEYISCPGCGRTLYNLEGTIARIKKATSHLSNLK  520

Query  412  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  233
            I IMGCIVNGPGEMADAD+GYVGGAP KIDLY G+  ++R IA + A DALI LI+E+G 
Sbjct  521  IGIMGCIVNGPGEMADADYGYVGGAPHKIDLYKGQKCMRRGIAEEDAVDALIALIRENGD  580

Query  232  WVDPPTEE  209
            WV+P   E
Sbjct  581  WVEPKQRE  588



>ref|WP_016194246.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Arcticibacter 
svalbardensis]
 gb|EOR95689.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Arcticibacter 
svalbardensis MN12-7]
Length=672

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  568  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  389
            I +TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE +  IR +TSHL GV IAIMGCIV
Sbjct  551  IVSTSFVILQATRSRISKTEYISCPSCGRTLFDLQETTQMIRSRTSHLKGVKIAIMGCIV  610

Query  388  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  224
            NGPGEMADAD+GYVG  PGKI LY GK VVK+++  D A D LID+I+E G W++
Sbjct  611  NGPGEMADADYGYVGMGPGKITLYRGKEVVKKSVNKDNALDELIDIIREDGNWIE  665



>ref|WP_039126529.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flavihumibacter 
sp. ZG627]
 gb|KIC92210.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flavihumibacter 
sp. ZG627]
Length=667

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  571  FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCI  392
            F  NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A+IR  T HL GV IAIMGCI
Sbjct  549  FTNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTAKIRSVTHHLKGVKIAIMGCI  608

Query  391  VNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  221
            VNGPGEMADADFGYVG  PGKI LY GK VVKR +  + A   LI+L+KE+  WV+P
Sbjct  609  VNGPGEMADADFGYVGSGPGKITLYKGKEVVKRNVDSEVAVAELINLLKENEAWVEP  665



>ref|WP_001011580.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EMN69039.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. UI 08434]
 gb|EMN72160.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Bataviae str. UI 08561]
 gb|AJR15281.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Leptospira 
interrogans serovar Linhai str. 56609]
Length=663

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 121/195 (62%), Gaps = 4/195 (2%)
 Frame = -3

Query  805  LHNLPYSEEKISRVHAARRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISAGSNAGTll  626
            + N+ +S +    ++  R+L   LS    +FP++ H  F      + L  SA    G L+
Sbjct  470  IKNVLFSLDSKEILYDYRKLGSILSR--FEFPILLHGSFSNP--EEALYNSAIGIGGLLI  525

Query  625  vdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEI  446
                    +  +   D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I
Sbjct  526  DGIGDLIRISTSKIKDIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARI  585

Query  445  REKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATD  266
            + +T HL GV IA+MGCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A +
Sbjct  586  KSRTGHLKGVKIAVMGCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADE  645

Query  265  ALIDLIKEHGRWVDP  221
             L+ LIK++G W DP
Sbjct  646  KLVQLIKDNGLWQDP  660



>ref|WP_019111293.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA164-L15]
Length=590

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = -3

Query  595  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  416
            EAP          S+N+LQ    R  KT+YV+CPSCGRTLF+LQE + +IRE T HL GV
Sbjct  463  EAPGQSLRL----SYNILQAAGARIFKTDYVACPSCGRTLFNLQETTQKIREATGHLKGV  518

Query  415  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  236
             IA+MGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  VK  I   +A + L DLI EHG
Sbjct  519  RIAVMGCIVNGPGEMADADFGYVGGAPGKINLYVGKKAVKFNIPEGEAVERLQDLICEHG  578

Query  235  RWVDPPTE  212
            RWVD P +
Sbjct  579  RWVDAPEQ  586



>ref|WP_038029147.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Thermonema 
rossianum]
Length=661

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 130/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  820  DATLVLHNLPYSEEKISRVHAA---RRLFEYLSENSLDFPVIHHIEFPKDIHRDDLVISA  650
            +  LVLH          R HA    RR F +L E  +  PV+  IE   +   +  ++ A
Sbjct  455  NIVLVLHT--------GRAHAMPALRRAFLFLMEQDIRVPVV--IERRYNEAWEQSILYA  504

Query  649  GSNAGTllvdglgdgvlLEAPDSDFD---------FIRNTSFNLLQGCRMRNTKTEYVSC  497
             ++ G LL+DG+GDGV L     D D          +   +F +LQ  R R TKTEY++C
Sbjct  505  STDIGGLLLDGMGDGVFLRPAVEDKDKAAKLLELKQLNQLAFGILQASRTRTTKTEYIAC  564

Query  496  PSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLY  317
            PSCGRTLFDLQE +A IR  T HL GV I IMGCIVNGPGEMADAD+GYVG   GKI LY
Sbjct  565  PSCGRTLFDLQETTAMIRRHTEHLKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLY  624

Query  316  VGKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  218
             GK VV+R +  ++A  ALI+LI+E GRW++PP
Sbjct  625  RGKEVVRRNVPSEEAVQALIELIREDGRWIEPP  657



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1793589148520