BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4783

Length=1192
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       484   9e-163   Nicotiana tomentosiformis
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       482   7e-162   Nicotiana sylvestris
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       481   9e-162   Solanum lycopersicum
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       475   2e-159   Solanum tuberosum [potatoes]
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       467   3e-156   Nicotiana tomentosiformis
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       465   3e-155   Solanum tuberosum [potatoes]
gb|AFU61111.1|  F-box protein                                           464   4e-155   Capsicum annuum
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       458   1e-152   Nicotiana sylvestris
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       450   1e-149   Solanum lycopersicum
emb|CDP10419.1|  unnamed protein product                                436   3e-144   Coffea canephora [robusta coffee]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       419   3e-137   Sesamum indicum [beniseed]
ref|XP_010086585.1|  hypothetical protein L484_002248                   397   5e-129   Morus notabilis
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       396   3e-128   Populus euphratica
ref|XP_012078802.1|  PREDICTED: EIN3-binding F-box protein 1-like       395   7e-128   Jatropha curcas
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg                393   2e-127   Erythranthe guttata [common monkey flower]
ref|XP_002524506.1|  grr1, plant, putative                              392   6e-127   Ricinus communis
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       384   7e-124   Pyrus x bretschneideri [bai li]
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       383   3e-123   Populus euphratica
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             382   5e-123   
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1            382   7e-123   Cucumis sativus [cucumbers]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       382   7e-123   Pyrus x bretschneideri [bai li]
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       380   3e-122   
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       380   8e-122   Nelumbo nucifera [Indian lotus]
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       379   9e-122   Vitis vinifera
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             377   3e-121   
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       377   5e-121   Cucumis melo [Oriental melon]
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       377   6e-121   Nelumbo nucifera [Indian lotus]
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       376   1e-120   
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       377   2e-120   
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like       375   2e-120   Fragaria vesca subsp. vesca
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             372   6e-119   Phaseolus vulgaris [French bean]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       367   4e-117   Eucalyptus grandis [rose gum]
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             366   4e-117   
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     365   5e-117   Eucalyptus grandis [rose gum]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       365   3e-116   Eucalyptus grandis [rose gum]
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       367   3e-116   
gb|KJB54023.1|  hypothetical protein B456_009G017100                    364   6e-116   Gossypium raimondii
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      362   2e-115   Gossypium arboreum [tree cotton]
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   359   2e-114   Citrus sinensis [apfelsine]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    358   8e-114   Gossypium raimondii
ref|XP_002515516.1|  grr1, plant, putative                              358   1e-113   Ricinus communis
emb|CAN83761.1|  hypothetical protein VITISV_043743                     357   3e-113   Vitis vinifera
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      355   2e-112   Gossypium arboreum [tree cotton]
ref|XP_012076562.1|  PREDICTED: EIN3-binding F-box protein 1            354   2e-112   Jatropha curcas
gb|KJB07737.1|  hypothetical protein B456_001G042600                    354   3e-112   Gossypium raimondii
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                      354   3e-112   Gossypium arboreum [tree cotton]
gb|KJB55011.1|  hypothetical protein B456_009G058000                    354   4e-112   Gossypium raimondii
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       353   6e-112   Glycine max [soybeans]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             352   3e-111   Prunus persica
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       352   3e-111   Glycine max [soybeans]
ref|XP_007011864.1|  EIN3-binding F box protein 1                       353   3e-111   
ref|XP_002308665.2|  grr1 family protein                                350   9e-111   
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       349   3e-110   Glycine max [soybeans]
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       347   1e-109   Cicer arietinum [garbanzo]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             347   1e-109   Phaseolus vulgaris [French bean]
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    346   3e-109   Prunus mume [ume]
gb|KJB65823.1|  hypothetical protein B456_010G114900                    344   4e-108   Gossypium raimondii
gb|KJB65824.1|  hypothetical protein B456_010G114900                    343   4e-108   Gossypium raimondii
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       343   7e-108   Populus euphratica
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      343   7e-108   Gossypium arboreum [tree cotton]
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       343   7e-108   Populus euphratica
gb|AFT92041.1|  EIN3 binding F-box 1                                    342   1e-107   Malus domestica [apple tree]
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       343   2e-107   
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       342   3e-107   Nicotiana tomentosiformis
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            341   5e-107   Nicotiana sylvestris
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             340   1e-106   Citrus clementina [clementine]
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    340   1e-106   
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    339   2e-106   
gb|KJB82811.1|  hypothetical protein B456_013G215000                    339   2e-106   Gossypium raimondii
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             338   3e-106   Populus trichocarpa [western balsam poplar]
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       339   3e-106   Vitis vinifera
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       338   4e-106   Pyrus x bretschneideri [bai li]
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            337   2e-105   Sesamum indicum [beniseed]
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       336   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       337   4e-105   Sesamum indicum [beniseed]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             335   4e-105   
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like       335   4e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       335   5e-105   
emb|CBI21043.3|  unnamed protein product                                334   5e-105   Vitis vinifera
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             334   1e-104   Phaseolus vulgaris [French bean]
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    332   1e-103   Glycine max [soybeans]
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       332   1e-103   Solanum tuberosum [potatoes]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       332   1e-103   Citrus sinensis [apfelsine]
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       331   2e-103   Fragaria vesca subsp. vesca
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    331   2e-103   
gb|KHN33913.1|  EIN3-binding F-box protein 1                            330   8e-103   Glycine soja [wild soybean]
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                330   8e-103   Erythranthe guttata [common monkey flower]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    331   9e-103   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    331   9e-103   
emb|CAN82790.1|  hypothetical protein VITISV_030601                     331   2e-102   Vitis vinifera
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       328   2e-102   Populus euphratica
ref|XP_003588766.1|  Ein3-binding f-box protein                         328   3e-102   Medicago truncatula
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       328   3e-102   Pyrus x bretschneideri [bai li]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  327   5e-102   Cucumis sativus [cucumbers]
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       324   8e-101   
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       323   4e-100   Cicer arietinum [garbanzo]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    323   9e-100   
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    320   4e-99    Eucalyptus grandis [rose gum]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       313   2e-96    
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like       313   4e-96    Elaeis guineensis
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like       312   7e-96    Elaeis guineensis
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like       310   4e-95    
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like       310   4e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    309   6e-95    Glycine max [soybeans]
gb|KHN07078.1|  EIN3-binding F-box protein 1                            309   7e-95    Glycine soja [wild soybean]
gb|AEK81539.1|  EIN3 binding F-box 1                                    308   2e-94    Dianthus caryophyllus [carnation]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            306   7e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like       306   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            305   2e-93    Cucumis melo [Oriental melon]
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       305   3e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like       305   3e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1            305   4e-93    Cucumis sativus [cucumbers]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like       305   5e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       303   1e-92    Phoenix dactylifera
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like       301   2e-92    Cucumis melo [Oriental melon]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like       301   3e-92    Cucumis sativus [cucumbers]
gb|AES91540.2|  EIN3-binding F-box-like protein                         300   2e-91    Medicago truncatula
ref|XP_002880682.1|  ein3-binding F box protein 1                       299   3e-91    
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             300   3e-91    Phaseolus vulgaris [French bean]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                300   3e-91    Erythranthe guttata [common monkey flower]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       298   4e-91    Tarenaya hassleriana [spider flower]
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            298   8e-91    Camelina sativa [gold-of-pleasure]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             298   1e-90    Eutrema salsugineum [saltwater cress]
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like       298   1e-90    Phoenix dactylifera
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             297   2e-90    Capsella rubella
ref|NP_565597.1|  EIN3-binding F-box protein 1                          296   5e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       295   1e-89    Tarenaya hassleriana [spider flower]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            294   3e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       292   1e-88    Camelina sativa [gold-of-pleasure]
gb|KJB07621.1|  hypothetical protein B456_001G033400                    292   1e-88    Gossypium raimondii
dbj|BAH20224.1|  AT2G25490                                              291   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197917.1|  EIN3-binding F-box protein 2                          291   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609343.1|  Ein3-binding f-box protein                         300   2e-88    
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       291   5e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            290   5e-88    Camelina sativa [gold-of-pleasure]
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     290   9e-88    Eucalyptus grandis [rose gum]
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            289   2e-87    Tarenaya hassleriana [spider flower]
gb|EPS63879.1|  f-box family protein                                    290   4e-87    Genlisea aurea
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like       287   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g             285   6e-86    Phaseolus vulgaris [French bean]
ref|XP_006842065.1|  PREDICTED: EIN3-binding F-box protein 1            285   1e-85    Amborella trichopoda
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             283   6e-85    Capsella rubella
gb|AFZ84555.1|  f-box transcription factor                              271   2e-84    Populus alba [abele]
gb|AFZ84556.1|  f-box transcription factor                              271   2e-84    Populus tremula [European aspen]
gb|AEX34712.2|  f-box transcription factor                              271   2e-84    Populus balsamifera [balsam poplar]
gb|AFZ84553.1|  f-box transcription factor                              270   4e-84    Populus trichocarpa [western balsam poplar]
ref|NP_001237471.1|  grr1 protein                                       281   7e-84    
gb|AEX34715.2|  f-box transcription factor                              269   9e-84    Populus nigra [black poplar]
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       279   1e-83    Brassica rapa
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    278   2e-83    Arabis alpina [alpine rockcress]
emb|CBI28209.3|  unnamed protein product                                276   3e-83    Vitis vinifera
ref|XP_003603398.1|  Ein3-binding f-box protein                         278   4e-83    
emb|CDX88173.1|  BnaA06g27640D                                          277   5e-83    
emb|CDX87090.1|  BnaC09g04050D                                          277   6e-83    
gb|AEX34714.2|  f-box transcription factor                              267   6e-83    Populus laurifolia
gb|AES73649.2|  EIN3-binding F-box-like protein                         277   8e-83    Medicago truncatula
emb|CDY19807.1|  BnaA09g04600D                                          276   9e-83    Brassica napus [oilseed rape]
gb|AEX34713.2|  f-box transcription factor                              266   1e-82    Populus deltoides
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             275   4e-82    Eutrema salsugineum [saltwater cress]
gb|AFZ84554.1|  f-box transcription factor                              264   7e-82    Populus maximowiczii
emb|CDX80503.1|  BnaC07g29410D                                          273   2e-81    
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       273   4e-81    Tarenaya hassleriana [spider flower]
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2            272   6e-81    Brassica rapa
gb|EPS63568.1|  ein3-binding f-box protein 3                            270   2e-80    Genlisea aurea
emb|CDY35358.1|  BnaA04g14890D                                          268   2e-79    Brassica napus [oilseed rape]
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like       268   4e-79    Tarenaya hassleriana [spider flower]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like       263   2e-77    Tarenaya hassleriana [spider flower]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1            260   1e-76    Brassica rapa
gb|ACB59221.1|  F-box protein                                           260   2e-76    Brassica oleracea
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like       257   5e-75    Brachypodium distachyon [annual false brome]
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...    256   2e-74    
dbj|BAJ88579.1|  predicted protein                                      256   2e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1          254   4e-74    
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                    255   1e-73    
emb|CDX76980.1|  BnaC04g37750D                                          251   3e-73    
dbj|BAD15849.1|  putative F-box protein                                 252   6e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EAY84905.1|  hypothetical protein OsI_06273                          249   4e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870          249   5e-72    Sorghum bicolor [broomcorn]
gb|EMT19526.1|  hypothetical protein F775_07091                         251   2e-71    
ref|XP_002874252.1|  ein3-binding F box protein 2                       244   6e-71    
gb|KEH32121.1|  EIN3-binding F-box-like protein                         241   1e-68    Medicago truncatula
gb|KEH32122.1|  EIN3-binding F-box-like protein                         240   2e-68    Medicago truncatula
ref|XP_003609344.1|  Ein3-binding f-box protein                         241   2e-68    
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like       235   6e-67    Setaria italica
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like       234   1e-66    Setaria italica
emb|CDP13516.1|  unnamed protein product                                232   2e-66    Coffea canephora [robusta coffee]
gb|EAZ01599.1|  hypothetical protein OsI_23635                          232   1e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1            231   2e-65    Brachypodium distachyon [annual false brome]
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                    228   3e-64    
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like       222   2e-62    
ref|NP_001147557.1|  LOC100281166                                       219   4e-61    Zea mays [maize]
ref|NP_001145991.1|  uncharacterized protein LOC100279520               216   2e-60    
gb|ACR35519.1|  unknown                                                 199   1e-54    Zea mays [maize]
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like       188   1e-49    Nelumbo nucifera [Indian lotus]
ref|XP_002986021.1|  hypothetical protein SELMODRAFT_123441             185   1e-48    
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861             183   4e-48    
ref|XP_002974778.1|  hypothetical protein SELMODRAFT_442539             184   4e-48    Selaginella moellendorffii
ref|XP_006849175.2|  PREDICTED: EIN3-binding F-box protein 1            180   9e-47    Amborella trichopoda
gb|ERN10756.1|  hypothetical protein AMTR_s00027p00189050               179   1e-46    Amborella trichopoda
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like       176   2e-45    Nelumbo nucifera [Indian lotus]
ref|XP_002963689.1|  hypothetical protein SELMODRAFT_62165              171   5e-44    
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like       167   2e-42    Oryza brachyantha
gb|ABK25485.1|  unknown                                                 163   4e-41    Picea sitchensis
ref|XP_001775242.1|  predicted protein                                  158   3e-39    
dbj|BAD35544.1|  putative F-box protein Fbl2                            155   3e-38    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001783097.1|  predicted protein                                  149   3e-36    
gb|ADW83728.1|  EIN3-binding F-box protein 1                            145   3e-35    Musa acuminata AAA Group [Cavendish banana]
ref|XP_006648432.1|  PREDICTED: EIN3-binding F-box protein 1-like       145   4e-35    
gb|EMS68820.1|  hypothetical protein TRIUR3_29831                       144   1e-34    Triticum urartu
ref|NP_001046222.1|  Os02g0200900                                       140   2e-33    
ref|XP_010908612.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   4e-33    Elaeis guineensis
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   4e-31    
gb|AAR88780.1|  putative F-box protein family                           122   3e-29    Musa acuminata AAA Group [Cavendish banana]
ref|XP_009414462.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   5e-29    
ref|XP_009386195.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   3e-26    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392099.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   3e-26    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ34438.1|  unnamed protein product                                101   3e-20    Eutrema halophilum
gb|KDO69901.1|  hypothetical protein CISIN_1g015721mg                 94.4    5e-18    Citrus sinensis [apfelsine]
ref|XP_006484494.1|  PREDICTED: F-box/LRR-repeat protein 4-like       93.6    1e-17    Citrus sinensis [apfelsine]
ref|XP_006847795.1|  PREDICTED: F-box/LRR-repeat protein 4            92.8    2e-17    Amborella trichopoda
emb|CDX88014.1|  BnaA06g26050D                                        92.0    4e-17    
ref|XP_009136697.1|  PREDICTED: F-box/LRR-repeat protein 4            93.2    4e-17    Brassica rapa
ref|XP_004296974.2|  PREDICTED: F-box/LRR-repeat protein 4            92.8    5e-17    Fragaria vesca subsp. vesca
ref|XP_009150869.1|  PREDICTED: F-box/LRR-repeat protein 2            91.3    7e-17    Brassica rapa
ref|XP_002526343.1|  grr1, plant, putative                            85.9    1e-16    
gb|KFK39198.1|  hypothetical protein AALP_AA3G212400                  90.5    1e-16    Arabis alpina [alpine rockcress]
ref|NP_197725.1|  RNI-like superfamily protein                        90.5    1e-16    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493455.1|  PREDICTED: F-box/LRR-repeat protein 2-like       90.5    1e-16    Camelina sativa [gold-of-pleasure]
ref|XP_006287878.1|  hypothetical protein CARUB_v10001105mg           90.1    2e-16    Capsella rubella
gb|KFM79859.1|  F-box/LRR-repeat protein 7                            85.5    2e-16    Stegodyphus mimosarum
ref|XP_002872053.1|  protein binding protein                          89.7    2e-16    Arabidopsis lyrata subsp. lyrata
ref|XP_010524501.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  90.9    3e-16    Tarenaya hassleriana [spider flower]
ref|XP_010454612.1|  PREDICTED: F-box/LRR-repeat protein 2-like       89.7    3e-16    Camelina sativa [gold-of-pleasure]
ref|XP_011090837.1|  PREDICTED: F-box/LRR-repeat protein 4            90.1    4e-16    Sesamum indicum [beniseed]
ref|XP_010524499.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  90.1    4e-16    Tarenaya hassleriana [spider flower]
gb|KHG11100.1|  F-box/LRR-repeat 4 -like protein                      89.0    5e-16    Gossypium arboreum [tree cotton]
gb|KDO74916.1|  hypothetical protein CISIN_1g007312mg                 89.7    6e-16    Citrus sinensis [apfelsine]
gb|EYU43854.1|  hypothetical protein MIMGU_mgv1a003235mg              89.7    6e-16    Erythranthe guttata [common monkey flower]
gb|EYU43856.1|  hypothetical protein MIMGU_mgv1a003265mg              89.4    6e-16    Erythranthe guttata [common monkey flower]
ref|XP_007222308.1|  hypothetical protein PRUPE_ppa003937mg           89.4    6e-16    
ref|XP_010424250.1|  PREDICTED: F-box/LRR-repeat protein 2-like       88.2    6e-16    Camelina sativa [gold-of-pleasure]
gb|KDP40070.1|  hypothetical protein JCGZ_02068                       89.0    7e-16    Jatropha curcas
ref|XP_010440303.1|  PREDICTED: F-box/LRR-repeat protein 4-like       89.4    7e-16    Camelina sativa [gold-of-pleasure]
emb|CDO98963.1|  unnamed protein product                              89.4    8e-16    Coffea canephora [robusta coffee]
ref|XP_012069471.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  89.4    8e-16    Jatropha curcas
ref|XP_010036070.1|  PREDICTED: F-box/LRR-repeat protein 4            89.0    9e-16    Eucalyptus grandis [rose gum]
ref|XP_010434975.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  89.0    9e-16    Camelina sativa [gold-of-pleasure]
emb|CDY45764.1|  BnaC02g42180D                                        89.0    1e-15    Brassica napus [oilseed rape]
gb|KDO74919.1|  hypothetical protein CISIN_1g007312mg                 88.6    1e-15    Citrus sinensis [apfelsine]
ref|XP_001630901.1|  predicted protein                                85.5    1e-15    Nematostella vectensis
ref|XP_008652978.1|  PREDICTED: EIN3-binding F-box protein 2-like     86.3    1e-15    
ref|XP_010279099.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  88.6    1e-15    Nelumbo nucifera [Indian lotus]
ref|XP_010279078.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  88.6    1e-15    Nelumbo nucifera [Indian lotus]
gb|AFK44520.1|  unknown                                               87.8    1e-15    Medicago truncatula
gb|KFK39475.1|  hypothetical protein AALP_AA3G249000                  88.2    2e-15    Arabis alpina [alpine rockcress]
ref|XP_010105692.1|  F-box/LRR-repeat protein 4                       88.2    2e-15    Morus notabilis
ref|XP_007142754.1|  hypothetical protein PHAVU_007G014200g           87.8    2e-15    Phaseolus vulgaris [French bean]
ref|XP_008340892.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  88.2    2e-15    
ref|XP_006283360.1|  hypothetical protein CARUB_v10004403mg           88.2    2e-15    Capsella rubella
ref|XP_006414504.1|  hypothetical protein EUTSA_v10024700mg           87.8    2e-15    
ref|XP_008340891.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  87.8    2e-15    
ref|XP_007154190.1|  hypothetical protein PHAVU_003G097600g           87.8    2e-15    Phaseolus vulgaris [French bean]
ref|XP_006414505.1|  hypothetical protein EUTSA_v10024700mg           87.8    2e-15    Eutrema salsugineum [saltwater cress]
ref|XP_009352145.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  87.8    2e-15    Pyrus x bretschneideri [bai li]
ref|XP_010434348.1|  PREDICTED: F-box/LRR-repeat protein 4            87.8    2e-15    Camelina sativa [gold-of-pleasure]
ref|XP_009352146.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  87.8    2e-15    Pyrus x bretschneideri [bai li]
ref|XP_006489225.1|  PREDICTED: F-box/LRR-repeat protein 4-like       87.8    2e-15    Citrus sinensis [apfelsine]
ref|XP_004497244.1|  PREDICTED: F-box/LRR-repeat protein 4-like       87.0    3e-15    Cicer arietinum [garbanzo]
gb|KJB49959.1|  hypothetical protein B456_008G147100                  87.0    3e-15    Gossypium raimondii
ref|XP_008223043.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  87.8    3e-15    Prunus mume [ume]
ref|XP_008223044.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  87.8    3e-15    Prunus mume [ume]
ref|XP_009592242.1|  PREDICTED: F-box/LRR-repeat protein 2            87.0    3e-15    Nicotiana tomentosiformis
ref|XP_006419761.1|  hypothetical protein CICLE_v100047052mg          87.0    3e-15    
ref|XP_006394600.1|  hypothetical protein EUTSA_v10004329mg           86.7    3e-15    Eutrema salsugineum [saltwater cress]
ref|XP_010921960.1|  PREDICTED: F-box/LRR-repeat protein 4            87.0    4e-15    Elaeis guineensis
ref|XP_002276047.1|  PREDICTED: F-box/LRR-repeat protein 20           86.3    4e-15    Vitis vinifera
ref|XP_004510720.1|  PREDICTED: F-box/LRR-repeat protein 12-like ...  85.9    5e-15    Cicer arietinum [garbanzo]
ref|XP_009401851.1|  PREDICTED: F-box/LRR-repeat protein 2-like       86.3    5e-15    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU33529.1|  hypothetical protein MIMGU_mgv1a007230mg              85.9    6e-15    Erythranthe guttata [common monkey flower]
ref|XP_008390798.1|  PREDICTED: F-box/LRR-repeat protein 4            86.7    6e-15    
ref|XP_002870235.1|  F-box family protein                             86.7    6e-15    
emb|CDY40798.1|  BnaC02g41670D                                        85.9    7e-15    
ref|XP_011022001.1|  PREDICTED: F-box/LRR-repeat protein 4            85.5    7e-15    
ref|XP_006356687.1|  PREDICTED: F-box/LRR-repeat protein 4-like       86.3    7e-15    
ref|XP_004241061.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  86.3    7e-15    
ref|XP_010322268.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  86.3    8e-15    
gb|EFX60588.1|  hypothetical protein DAPPUDRAFT_71291                 81.6    8e-15    
ref|XP_008812005.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  86.3    8e-15    
ref|XP_008812004.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  85.9    9e-15    
ref|XP_008812006.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  85.9    9e-15    
ref|NP_567467.1|  F-box/LRR-repeat protein 4                          85.9    1e-14    
ref|XP_009782053.1|  PREDICTED: F-box/LRR-repeat protein 4            85.9    1e-14    
ref|XP_011270125.1|  hypothetical protein CAOG_08543                  85.9    1e-14    
ref|XP_009623080.1|  PREDICTED: F-box/LRR-repeat protein 4            85.9    1e-14    
ref|XP_002983796.1|  hypothetical protein SELMODRAFT_118815           85.5    1e-14    
ref|XP_002516815.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...  85.5    1e-14    
ref|XP_010521976.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  85.5    1e-14    
ref|XP_007035362.1|  F-box/RNI-like superfamily protein isoform 1     85.5    2e-14    
ref|XP_007035364.1|  F-box/RNI-like superfamily protein isoform 3     85.1    2e-14    
ref|XP_006850831.1|  PREDICTED: F-box/LRR-repeat protein 4            85.1    2e-14    
ref|XP_010249138.1|  PREDICTED: F-box/LRR-repeat protein 4            84.3    2e-14    
ref|XP_003550089.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  85.1    2e-14    
ref|XP_007035363.1|  F-box/RNI-like superfamily protein isoform 2     84.7    2e-14    
gb|KHN03419.1|  F-box/LRR-repeat protein 4                            85.1    2e-14    
ref|XP_006600324.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  84.7    2e-14    
ref|XP_002989023.1|  hypothetical protein SELMODRAFT_184280           84.3    3e-14    
ref|XP_006437640.1|  hypothetical protein CICLE_v10033734mg           84.0    3e-14    
emb|CAN75354.1|  hypothetical protein VITISV_030455                   84.3    4e-14    
ref|XP_007043225.1|  RNI-like superfamily protein                     83.6    4e-14    
ref|XP_010649842.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  84.0    4e-14    
ref|XP_002279087.2|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  84.0    4e-14    
ref|XP_009413112.1|  PREDICTED: F-box/LRR-repeat protein 2-like       83.6    4e-14    
ref|XP_012069472.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  84.0    4e-14    
ref|XP_012069470.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  84.0    5e-14    
gb|KHN37544.1|  F-box/LRR-repeat protein 4                            84.0    5e-14    
ref|XP_006594443.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  84.0    5e-14    
ref|XP_003542901.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  83.6    6e-14    
gb|KDO74917.1|  hypothetical protein CISIN_1g007312mg                 83.2    6e-14    
ref|XP_004486096.1|  PREDICTED: F-box/LRR-repeat protein 4-like       83.6    7e-14    
emb|CDQ59062.1|  unnamed protein product                              83.2    7e-14    
ref|XP_008862817.1|  hypothetical protein H310_01483                  83.6    7e-14    
ref|XP_012068588.1|  PREDICTED: F-box/LRR-repeat protein 4            82.4    9e-14    
ref|XP_010866366.1|  PREDICTED: F-box/LRR-repeat protein 7-like       82.8    9e-14    
ref|XP_002513122.1|  glucose regulated repressor protein, putative    82.0    1e-13    
ref|XP_009821206.1|  hypothetical protein H257_00298                  83.2    1e-13    
ref|XP_003594073.1|  F-box/LRR-repeat protein                         82.8    1e-13    
gb|AAM60829.1|  F-box protein family, AtFBL4                          82.4    1e-13    
ref|XP_002981401.1|  hypothetical protein SELMODRAFT_420841           82.0    1e-13    
ref|XP_004144962.1|  PREDICTED: F-box/LRR-repeat protein 4            82.4    2e-13    
gb|KCW84336.1|  hypothetical protein EUGRSUZ_B01185                   81.6    2e-13    
ref|XP_008458533.1|  PREDICTED: F-box/LRR-repeat protein 4            82.0    2e-13    
emb|CDY46953.1|  BnaA02g32930D                                        81.6    2e-13    
ref|XP_002307150.1|  hypothetical protein POPTR_0005s09110g           81.6    2e-13    
ref|XP_010103606.1|  hypothetical protein L484_023103                 81.3    2e-13    
ref|XP_010918416.1|  PREDICTED: F-box/LRR-repeat protein 4            81.3    2e-13    
gb|ABI64127.1|  putative F-box and leucine-rich repeat protein        81.3    2e-13    
ref|XP_010067019.1|  PREDICTED: F-box/LRR-repeat protein 4            80.9    3e-13    
ref|XP_004081213.1|  PREDICTED: F-box/LRR-repeat protein 7            80.9    3e-13    
ref|XP_003978719.1|  PREDICTED: F-box/LRR-repeat protein 7            80.9    3e-13    
ref|XP_007142753.1|  hypothetical protein PHAVU_007G014200g           80.9    4e-13    
ref|XP_007147820.1|  hypothetical protein PHAVU_006G157700g           80.9    4e-13    
ref|XP_010765913.1|  PREDICTED: F-box/LRR-repeat protein 7            80.9    4e-13    
ref|XP_002969928.1|  hypothetical protein SELMODRAFT_410553           80.5    4e-13    
emb|CBN82132.1|  F-box/LRR-repeat protein 7                           80.9    4e-13    
ref|XP_002441690.1|  hypothetical protein SORBIDRAFT_08g000800        80.9    5e-13    
gb|KJB38461.1|  hypothetical protein B456_006G255600                  80.9    5e-13    
ref|XP_005805781.1|  PREDICTED: F-box/LRR-repeat protein 7-like       80.5    5e-13    
ref|XP_010747620.1|  PREDICTED: F-box/LRR-repeat protein 7            80.5    5e-13    
ref|XP_007566025.1|  PREDICTED: F-box/LRR-repeat protein 7            80.5    5e-13    
ref|XP_008394768.1|  PREDICTED: F-box/LRR-repeat protein 7            80.5    5e-13    
ref|XP_008797210.1|  PREDICTED: F-box/LRR-repeat protein 20           80.1    5e-13    
gb|KJB38463.1|  hypothetical protein B456_006G255600                  80.5    5e-13    
gb|KJB38464.1|  hypothetical protein B456_006G255600                  80.9    5e-13    
ref|XP_008292199.1|  PREDICTED: F-box/LRR-repeat protein 7            80.5    5e-13    
ref|XP_004980134.1|  PREDICTED: F-box/LRR-repeat protein 3-like       80.5    6e-13    
ref|XP_006795208.1|  PREDICTED: F-box/LRR-repeat protein 7-like       79.7    6e-13    
ref|XP_004551974.1|  PREDICTED: F-box/LRR-repeat protein 7-like       80.1    6e-13    
ref|XP_003439319.1|  PREDICTED: F-box/LRR-repeat protein 7-like       80.1    6e-13    
ref|XP_005922659.1|  PREDICTED: F-box/LRR-repeat protein 7-like       80.1    6e-13    
gb|KJB38462.1|  hypothetical protein B456_006G255600                  80.1    7e-13    
ref|XP_008306391.1|  PREDICTED: F-box/LRR-repeat protein 7            80.1    7e-13    
gb|KDO28250.1|  hypothetical protein SPRG_06300                       80.5    8e-13    
gb|KFO04049.1|  F-box/LRR-repeat protein 7                            77.4    8e-13    
ref|XP_009926758.1|  PREDICTED: F-box/LRR-repeat protein 7            77.4    9e-13    
emb|CAG05490.1|  unnamed protein product                              79.7    9e-13    
ref|XP_009936860.1|  PREDICTED: F-box/LRR-repeat protein 7-like       77.4    9e-13    
gb|KFP91090.1|  F-box/LRR-repeat protein 7                            77.4    9e-13    
ref|XP_009872260.1|  PREDICTED: F-box/LRR-repeat protein 7            77.4    9e-13    
ref|XP_006359273.1|  PREDICTED: F-box/LRR-repeat protein 2-like       79.3    1e-12    
ref|XP_002448875.1|  hypothetical protein SORBIDRAFT_05g000740        79.3    1e-12    
ref|XP_008619390.1|  hypothetical protein SDRG_15005                  79.7    1e-12    
gb|EPS72317.1|  hypothetical protein M569_02441                       78.6    1e-12    
ref|XP_002097674.1|  GE24351                                          79.3    2e-12    
ref|XP_001980121.1|  GG16963                                          79.3    2e-12    
ref|NP_650512.1|  CG4221                                              79.3    2e-12    
ref|XP_001954994.1|  GF18550                                          79.3    2e-12    
ref|XP_002103250.1|  GD19058                                          79.3    2e-12    
ref|XP_002030997.1|  GM24270                                          79.3    2e-12    
gb|AIE39588.1|  F-box/LRR repeat protein                              74.7    2e-12    
ref|XP_002933169.1|  PREDICTED: F-box/LRR-repeat protein 7            78.6    2e-12    
gb|KFK24639.1|  hypothetical protein AALP_AA8G005800                  79.0    2e-12    
ref|XP_004236856.1|  PREDICTED: F-box/LRR-repeat protein 2            78.2    2e-12    
gb|KEH36733.1|  F-box/LRR protein                                     78.6    2e-12    
gb|KFK24640.1|  hypothetical protein AALP_AA8G005800                  78.6    2e-12    
ref|XP_004978385.1|  PREDICTED: F-box/LRR-repeat protein 3-like       78.6    2e-12    
ref|XP_003569947.1|  PREDICTED: uncharacterized F-box/LRR-repeat ...  78.2    3e-12    
ref|NP_001067651.1|  Os11g0264200                                     77.8    3e-12    
ref|XP_008675562.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  78.6    3e-12    
ref|XP_007238723.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  78.2    3e-12    
tpg|DAA59160.1|  TPA: hypothetical protein ZEAMMB73_277196            78.2    3e-12    
gb|EAY80544.1|  hypothetical protein OsI_35725                        77.4    3e-12    
gb|KHG30599.1|  F-box/LRR-repeat 4 -like protein                      78.2    3e-12    
emb|CDY09760.1|  BnaC07g33010D                                        78.2    4e-12    
ref|XP_008366959.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  77.4    4e-12    
ref|XP_007119720.1|  PREDICTED: F-box/LRR-repeat protein 7-like       75.1    5e-12    
ref|XP_008328194.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  77.4    5e-12    
ref|XP_010893884.1|  PREDICTED: F-box/LRR-repeat protein 7            77.4    5e-12    
ref|XP_004761267.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  77.4    5e-12    
ref|XP_009130116.1|  PREDICTED: F-box/LRR-repeat protein 4-like       77.0    5e-12    
gb|KDO74918.1|  hypothetical protein CISIN_1g007312mg                 77.0    5e-12    
ref|XP_004761266.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  77.0    6e-12    
ref|XP_008366958.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  77.0    6e-12    
ref|WP_032113191.1|  hypothetical protein                             73.9    6e-12    
ref|XP_009130629.1|  PREDICTED: F-box/LRR-repeat protein 3            77.4    7e-12    
ref|XP_010923015.1|  PREDICTED: uncharacterized protein LOC105046191  77.8    7e-12    
emb|CDY11182.1|  BnaA03g00180D                                        77.4    7e-12    
emb|CDX90588.1|  BnaA03g41930D                                        77.0    7e-12    
ref|XP_003536746.1|  PREDICTED: F-box/LRR-repeat protein 7-like       76.6    8e-12    
gb|EAY86821.1|  hypothetical protein OsI_08201                        77.4    8e-12    
gb|EFB20278.1|  hypothetical protein PANDA_005897                     76.6    8e-12    
emb|CAB82288.1|  putative protein                                     77.0    9e-12    
ref|XP_004296043.2|  PREDICTED: F-box/LRR-repeat protein 3-like i...  77.0    9e-12    
ref|XP_011221101.1|  PREDICTED: F-box/LRR-repeat protein 7            76.6    9e-12    
gb|EMC86979.1|  F-box/LRR-repeat protein 7                            76.3    9e-12    
ref|XP_004297718.1|  PREDICTED: F-box/LRR-repeat protein 4            76.3    9e-12    
ref|XP_011461441.1|  PREDICTED: F-box/LRR-repeat protein 3-like i...  77.0    9e-12    
ref|XP_008669944.1|  PREDICTED: F-box/LRR-repeat protein 3-like i...  77.0    1e-11    
ref|XP_004953211.1|  PREDICTED: F-box/LRR-repeat protein 4-like       76.3    1e-11    
emb|CDX80753.1|  BnaC03g00070D                                        76.6    1e-11    
ref|XP_010195061.1|  PREDICTED: F-box/LRR-repeat protein 7            76.3    1e-11    
emb|CAB10325.1|  hypothetical protein                                 76.6    1e-11    
ref|XP_004605672.1|  PREDICTED: F-box/LRR-repeat protein 7            76.3    1e-11    
ref|NP_568094.2|  F-box/LRR-repeat protein 3                          76.6    1e-11    
gb|KGL72338.1|  F-box/LRR-repeat protein 7                            76.3    1e-11    
ref|XP_003789589.1|  PREDICTED: F-box/LRR-repeat protein 7            76.3    1e-11    
ref|WP_032112559.1|  hypothetical protein                             73.9    1e-11    
dbj|BAJ92833.1|  predicted protein                                    76.6    1e-11    
ref|XP_009778014.1|  PREDICTED: F-box/LRR-repeat protein 2            75.9    1e-11    
ref|XP_007222700.1|  hypothetical protein PRUPE_ppa006391mg           75.9    1e-11    
ref|XP_006398589.1|  hypothetical protein EUTSA_v10012898mg           76.6    1e-11    
gb|KFP29659.1|  F-box/LRR-repeat protein 7                            76.3    1e-11    
gb|EMP30899.1|  F-box/LRR-repeat protein 7                            75.9    1e-11    
gb|AFW63119.1|  hypothetical protein ZEAMMB73_650145                  75.9    1e-11    
ref|XP_008107061.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  76.3    1e-11    
ref|XP_010225575.1|  PREDICTED: F-box/LRR-repeat protein 7            75.9    1e-11    
ref|XP_008669943.1|  PREDICTED: F-box/LRR-repeat protein 3-like i...  76.6    1e-11    
ref|XP_006117147.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  76.3    1e-11    
ref|XP_010706792.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  76.3    1e-11    
ref|XP_004935160.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  76.3    1e-11    
ref|XP_426048.3|  PREDICTED: F-box/LRR-repeat protein 7 isoform X4    76.3    1e-11    
ref|XP_010569759.1|  PREDICTED: F-box/LRR-repeat protein 7            75.9    1e-11    
gb|EOB07802.1|  F-box/LRR-repeat protein 7                            75.9    1e-11    
gb|KFZ62696.1|  F-box/LRR-repeat protein 7                            75.9    1e-11    
ref|XP_005301166.1|  PREDICTED: F-box/LRR-repeat protein 7            75.9    1e-11    
gb|KGL92233.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
gb|KFW01394.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
gb|KFV84095.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
gb|KFO90582.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
ref|XP_009678681.1|  PREDICTED: F-box/LRR-repeat protein 7            75.9    2e-11    
gb|KFO61818.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
ref|XP_785847.3|  PREDICTED: F-box/LRR-repeat protein 7 isoform X1    75.9    2e-11    
ref|XP_005484356.1|  PREDICTED: F-box/LRR-repeat protein 7            75.9    2e-11    
gb|KFO70707.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
ref|XP_006117148.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  75.9    2e-11    
gb|KFV76563.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
ref|XP_005010776.1|  PREDICTED: F-box/LRR-repeat protein 7            75.9    2e-11    
ref|NP_567849.1|  RNI-like superfamily protein                        74.3    2e-11    
gb|KFQ60755.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
gb|KFP58344.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
ref|XP_006261022.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  75.9    2e-11    
ref|XP_010170806.1|  PREDICTED: F-box/LRR-repeat protein 7            75.9    2e-11    
ref|XP_010135828.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_005530938.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
gb|KFR04939.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
gb|KFP77813.1|  F-box/LRR-repeat protein 7                            75.9    2e-11    
ref|XP_010706793.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  75.5    2e-11    
ref|XP_009882041.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
gb|KFP53526.1|  F-box/LRR-repeat protein 7                            75.5    2e-11    
gb|KFM01625.1|  F-box/LRR-repeat protein 7                            75.5    2e-11    
ref|XP_010145823.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_008635411.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_009470315.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_009698447.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_009568576.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
gb|KFO96098.1|  F-box/LRR-repeat protein 7                            75.5    2e-11    
ref|XP_005153415.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_004935159.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  75.9    2e-11    
ref|NP_001102015.1|  F-box/LRR-repeat protein 7                       75.9    2e-11    
ref|XP_009970093.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
gb|KFP35545.1|  F-box/LRR-repeat protein 7                            75.5    2e-11    
ref|XP_009936854.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_009480179.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_009286270.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
gb|KFV42986.1|  F-box/LRR-repeat protein 7                            75.5    2e-11    
ref|XP_009907486.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_008221080.1|  PREDICTED: F-box/LRR-repeat protein 20           75.5    2e-11    
ref|XP_011660908.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  75.9    2e-11    
dbj|BAC98037.1|  mKIAA0840 protein                                    75.9    2e-11    
ref|NP_795933.2|  F-box/LRR-repeat protein 7                          75.5    2e-11    
gb|EKC26111.1|  F-box/LRR-repeat protein 20                           75.5    2e-11    
ref|XP_010115397.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
gb|KFW83758.1|  F-box/LRR-repeat protein 7                            75.5    2e-11    
ref|XP_005081362.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
gb|EDL08903.1|  F-box and leucine-rich repeat protein 7               75.5    2e-11    
gb|KFQ65474.1|  F-box/LRR-repeat protein 7                            75.5    2e-11    
ref|XP_008496222.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_011422240.1|  PREDICTED: F-box/LRR-repeat protein 2-like       75.5    2e-11    
ref|XP_008688115.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_006027688.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-11    
ref|XP_010706790.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  75.5    2e-11    



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   484 bits (1246),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 252/316 (80%), Positives = 279/316 (88%), Gaps = 5/316 (2%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             MPTLVNYSGDD+F +G SLCSADLGLMLSLGHA VYCP RK+ARI+GPFVVE + K PSI
Sbjct  1     MPTLVNYSGDDEFYSGGSLCSADLGLMLSLGHAQVYCPLRKKARISGPFVVEERTKNPSI  60

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E LPDECLFEIFRRL GGRERS+AACVSKRWLML S+VRNSEI   +SH D+S+A+  NG
Sbjct  61    EILPDECLFEIFRRLQGGRERSAAACVSKRWLMLSSNVRNSEI---QSHTDISVAN--NG  115

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
              S+D +M  ADED+EVECDGYL+R +EGKKATD+RLAAIAVGTSSRGGLGKL VRGSNS 
Sbjct  116   DSSDGKMVSADEDVEVECDGYLTRCLEGKKATDIRLAAIAVGTSSRGGLGKLSVRGSNSV  175

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG+SA+  GCPSL+VLSLWNVP VGDEGL+EIAR C SLEKLDL QCPSISNKGL
Sbjct  176   RGITNVGLSAVAHGCPSLRVLSLWNVPYVGDEGLVEIARGCHSLEKLDLSQCPSISNKGL  235

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSLTIESC NIGNEGL+AIGR CTKLQ LTIKDCPLVGDQGVASLLSS +
Sbjct  236   VAIAENCPSLTSLTIESCRNIGNEGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGA  295

Query  1143  avlTKVKLHALNITDF  1190
              +L KVKL++LNITDF
Sbjct  296   TMLKKVKLNSLNITDF  311


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 76/180 (42%), Gaps = 37/180 (21%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    S +G        GL  L        RG+T+V + A+G+GC +LK
Sbjct  320   GKVITDLNLGSLR-NVSQKGFWVMGNARGLQSLASLSITLCRGVTDVSLEAVGKGCSNLK  378

Query  840   VLSLWNVPNVGDEGLLEIARECP-SLEKLDLCQCPSISNKGLV-----------------  965
              + L     V D GL+  AR    SLE L L +C  I+  G++                 
Sbjct  379   HMCLRKCCFVSDGGLVAFARAATGSLESLLLEECNRITQAGILNAVSNFGKLKSLSLVKC  438

Query  966   ----------AIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                       ++   C +L SL+I SCP  G+  L  +G  C +L  L +     + D G
Sbjct  439   MGVKDLPLQASLLSPCESLRSLSIRSCPGFGSTSLAMVGMLCPQLHHLDLSGLTGITDAG  498



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   482 bits (1240),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 250/316 (79%), Positives = 276/316 (87%), Gaps = 6/316 (2%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             MPTLVNYSGDD+F +G SLCSADLGLMLSLGHA VYCP RKRARI+GPF++E + K PSI
Sbjct  1     MPTLVNYSGDDEFYSGGSLCSADLGLMLSLGHAQVYCPLRKRARISGPFIIEERTKNPSI  60

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E LPDECLFEIFRRL GGR+RS+AACVSKRWLML S+VR+SEI     H DLS+AD  NG
Sbjct  61    EILPDECLFEIFRRLQGGRQRSAAACVSKRWLMLSSNVRSSEI----CHTDLSVAD--NG  114

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
              S+D +M  ADED+EVECDGYL+R +EGKKATD+RLAAIAVGTSSRGGLGKL VRGSNS 
Sbjct  115   TSSDAKMVSADEDVEVECDGYLTRCLEGKKATDIRLAAIAVGTSSRGGLGKLSVRGSNSV  174

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG+SAI  GCPSL+VLSLWNVP VGDEGL+EIAR C SLEKLDL QCPSISNKGL
Sbjct  175   RGITNVGLSAIAHGCPSLRVLSLWNVPYVGDEGLVEIARGCHSLEKLDLSQCPSISNKGL  234

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSL IESC NIGNEGL+AIGR CTKLQ LTIKDCPLVGDQGVASLLSS +
Sbjct  235   VAIAENCPSLTSLAIESCRNIGNEGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGA  294

Query  1143  avlTKVKLHALNITDF  1190
              +L KVKL++LNITDF
Sbjct  295   TMLKKVKLNSLNITDF  310


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 86/204 (42%), Gaps = 41/204 (20%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L+++    S +G        GL  L        RG T+V + A+G+GC +LK
Sbjct  319   GKAITDLNLSSLR-NVSQKGFWVMGNARGLQSLASLSITLCRGATDVSVEAVGKGCSNLK  377

Query  840   VLSLWNVPNVGDEGLLEIARECP-SLEKLDLCQCPSISNKGLV-----------------  965
              + L     V D GL+  AR    SLE L L +C  I+  G++                 
Sbjct  378   HMCLRKCCFVSDGGLVAFARAATGSLESLLLEECNRITQAGILNAVSNFGKLKSLSLVKC  437

Query  966   ----------AIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                       ++   C +L SL+I SCP  G+  L  +G  C +L  L +     + D G
Sbjct  438   MGVKDLPLQASLLSPCESLRSLSIRSCPGFGSTSLAMVGTLCPQLHHLDLSGLTGITDAG  497

Query  1116  vasllssasavlTKVKLHALNITD  1187
                 L     + +K  L  +N+TD
Sbjct  498   ----LLPLLEMSSKAGLVKVNLTD  517



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   481 bits (1239),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 245/316 (78%), Positives = 273/316 (86%), Gaps = 10/316 (3%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             MPTLVNYSGDD+F +G S CSADLGLMLSLGHADVYCP RKRARI+GPFVVE + K PS+
Sbjct  1     MPTLVNYSGDDEFYSGGSFCSADLGLMLSLGHADVYCPPRKRARISGPFVVEDRSKDPSL  60

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E LPDECLFEI RRL GGRER +AACVSKRWL ++SSV+NSEI RSKS+ +L        
Sbjct  61    EVLPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVKNSEICRSKSYNNL--------  112

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
               ND  M   DEDLEVECDGYL+R VEGKKATD+RLAAIAVGTS+RGGLGKL +RGSNS 
Sbjct  113   --NDAIMISKDEDLEVECDGYLTRCVEGKKATDIRLAAIAVGTSTRGGLGKLSIRGSNSV  170

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG+SA+  GCPSL+VLSLWNVP++GDEGLLE+AREC SLEKLDL  C SISNKGL
Sbjct  171   RGITNVGLSAVAHGCPSLRVLSLWNVPSIGDEGLLEVARECHSLEKLDLSHCRSISNKGL  230

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSLTIESCPNIGNEGL+A+G+YCTKLQ LTIKDCPLVGDQGVASLLSS +
Sbjct  231   VAIAENCPSLTSLTIESCPNIGNEGLQAVGKYCTKLQSLTIKDCPLVGDQGVASLLSSGA  290

Query  1143  avlTKVKLHALNITDF  1190
             ++LTKVKLH LNITDF
Sbjct  291   SMLTKVKLHGLNITDF  306


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 62/109 (57%), Gaps = 1/109 (1%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             +G T+VG+ A+G+GCP+LK + +     V D GL+  A+E  SLE L L +C  I+  G+
Sbjct  355   QGATDVGLEAVGKGCPNLKYMCIRKCCFVSDGGLVAFAKEAGSLESLILEECNRITQVGI  414

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCPLVG  1106
             +     C  L SL++  C  I +  L+ ++   C  L+ L+I+ CP  G
Sbjct  415   LNAVSNCRKLKSLSLVKCMGIKDLALQTSMLSPCESLRSLSIRSCPGFG  463



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   475 bits (1223),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 247/316 (78%), Positives = 271/316 (86%), Gaps = 10/316 (3%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             MPTLVNYSGDD+F +G S CSADLGLMLSLGHADVYCP RKRARI+GPFVVE + K PS+
Sbjct  1     MPTLVNYSGDDEFYSGGSFCSADLGLMLSLGHADVYCPPRKRARISGPFVVEDRSKDPSL  60

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E LPDECLFEI RRL GGRER +AACVSKRWL ++SSVRNSEI RSKS+ +L        
Sbjct  61    EILPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVRNSEICRSKSYNNL--------  112

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
               ND  M   DEDLEVECDGYL+R VEGKKATDVRLAAIAVGTS+RGGLGKL +RGSNS 
Sbjct  113   --NDAIMISKDEDLEVECDGYLTRCVEGKKATDVRLAAIAVGTSTRGGLGKLSIRGSNSV  170

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG+SAI  GCPSL+VLSLWNVP++GDEGLLE+AREC SLEKLDL  C SISNKGL
Sbjct  171   RGITNVGLSAIAHGCPSLRVLSLWNVPSIGDEGLLEVARECRSLEKLDLSHCRSISNKGL  230

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSLTIESCP IGNEGL+AIGR CTKLQ LTIKDCPLVGDQGVASLLSS +
Sbjct  231   VAIAENCPSLTSLTIESCPKIGNEGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGA  290

Query  1143  avlTKVKLHALNITDF  1190
             ++L+KVKLH LNITDF
Sbjct  291   SMLSKVKLHGLNITDF  306


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 62/109 (57%), Gaps = 1/109 (1%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             +G T+VG+ A+G+GCP+LK + +     V D GL+  A+E  SLE L L +C  I+  G+
Sbjct  355   QGATDVGLEAVGKGCPNLKHMCIRKCCFVSDGGLVAFAKEAGSLESLILEECNRITQVGI  414

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCPLVG  1106
             +     C  L SL++  C  I +  L+ ++   C  L+ L+I+ CP  G
Sbjct  415   LNAVSNCRKLKSLSLVKCMGIKDLALQTSMLSPCESLRSLSIRSCPGFG  463



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   467 bits (1202),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 245/316 (78%), Positives = 266/316 (84%), Gaps = 11/316 (3%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             MPTLVNYSGDD+F +G   CSA+           VYCP RKR RI+GPFVVE + K PS+
Sbjct  1     MPTLVNYSGDDEFYSGGPFCSAE-----------VYCPPRKRVRISGPFVVEDRSKDPSL  49

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E LPDECLFEI RRL GGRERS+AACVSKRWLML+SSVRNSEI RSKS  +LS  ++VNG
Sbjct  50    EILPDECLFEILRRLPGGRERSAAACVSKRWLMLLSSVRNSEICRSKSQNNLSSVEEVNG  109

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
              SND  M   DEDLEVECDGYL+R VEGKKATDVRLAAIAVGTSSRGGLGKL VRGSNS 
Sbjct  110   DSNDTTMIYKDEDLEVECDGYLTRCVEGKKATDVRLAAIAVGTSSRGGLGKLSVRGSNSV  169

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG+SAI  GCPSL+VLSLWNVP++GDEGL EIAREC SLEKLDL QCPSISNKGL
Sbjct  170   RGITNVGLSAIAHGCPSLRVLSLWNVPSIGDEGLFEIARECNSLEKLDLSQCPSISNKGL  229

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSLTIESC +IGNEGL+AIGR CTKLQ LTIKDCPLVGDQGVASLLSS +
Sbjct  230   VAIAENCLSLTSLTIESCASIGNEGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGA  289

Query  1143  avlTKVKLHALNITDF  1190
              +LTKVKLH LNITDF
Sbjct  290   TMLTKVKLHGLNITDF  305


 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 1/109 (1%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             +G T+VG+ A+G GCP+LK + +     V D GL+  A+   S E L L +C  I+  G+
Sbjct  354   KGATDVGLEAVGNGCPNLKHMCIRKCCFVSDGGLVAFAKASGSFESLHLEECNRITQTGI  413

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRY-CTKLQCLTIKDCPLVG  1106
             +     C  L SL++  C  I +  L+   R  C  L+ L+I+ CP  G
Sbjct  414   LNTVSNCRKLKSLSLVKCMGIKDLALQTSLRLPCESLRSLSIRSCPGFG  462



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   465 bits (1196),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 239/316 (76%), Positives = 273/316 (86%), Gaps = 7/316 (2%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             M TLVNYSGD++F +G SLCSADLGLML+LGHAD+YCP  KRARI+GPFVVE + K PSI
Sbjct  1     MSTLVNYSGDNEFYSGGSLCSADLGLMLALGHADIYCPVSKRARISGPFVVEERTKNPSI  60

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E LP+ECLFEIFRRL GGRERS+AACVSKRWLML+S++R+S+I     H +LS A   NG
Sbjct  61    EVLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI----RHTNLSAA---NG  113

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
             AS+D +M+ ADEDLEVECDGYL+R +EGKKATD+RL+A+AVGTSSRGGLGKL VRGSN  
Sbjct  114   ASDDTKMASADEDLEVECDGYLTRCLEGKKATDIRLSAMAVGTSSRGGLGKLSVRGSNPV  173

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG+SAI  GCPSL+VLSLW+V +VGDEGL+EIAR C SLEKLDL +CPSISNKGL
Sbjct  174   RGITNVGLSAIAHGCPSLRVLSLWDVQDVGDEGLMEIARGCHSLEKLDLTKCPSISNKGL  233

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSLTIESC NIGNEGL+AIGR CTKL+ LTIKDCPLVGDQ V SLLSS +
Sbjct  234   VAIAENCPSLTSLTIESCKNIGNEGLQAIGRCCTKLESLTIKDCPLVGDQAVVSLLSSGN  293

Query  1143  avlTKVKLHALNITDF  1190
               L KVKLH+LNITDF
Sbjct  294   TRLKKVKLHSLNITDF  309


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 80/176 (45%), Gaps = 28/176 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL  L      S  G+TN  + A+G+GC ++K + L     V D GL+  A+   SLE L
Sbjct  345   GLQSLASLTVTSCIGLTNPSLEAVGKGCTNIKSMCLRECERVTDSGLVAFAQAAGSLEYL  404

Query  924   DLCQCPSISNKGLV---------------------------AIAERCTNLTSLTIESCPN  1022
              L +C  I+  G++                           ++   C +L SL+I SC  
Sbjct  405   LLEECDKITQTGILNAVSICSKLKSLSLVKCSGVRDLPPQASLLSPCDSLRSLSIRSCAG  464

Query  1023  IGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKL-HALNITD  1187
              G+  L  +G+ C +L  L +     + D G+  LL S+ A L KV L H LN+TD
Sbjct  465   FGSRSLAMVGKLCPQLHHLDLSGLTRITDAGLLPLLESSKAGLVKVNLTHCLNVTD  520



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   464 bits (1194),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 239/316 (76%), Positives = 269/316 (85%), Gaps = 10/316 (3%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             MP LVNYSGDD+  +G S CSADLGLMLSLGHA+VYCP RKR+RI+GPFVVE + K PS+
Sbjct  1     MPALVNYSGDDELYSGGSFCSADLGLMLSLGHAEVYCPPRKRSRISGPFVVEDRSKGPSL  60

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             + LPDECLFEI RRL GGRER +A+C+SKRWLML+SSVR+SEI RSKS+ +L        
Sbjct  61    DDLPDECLFEILRRLPGGRERGAASCLSKRWLMLLSSVRSSEICRSKSYTNL--------  112

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
               ND  M   DEDLEVECDGYL+R VEGKKATDVRLAAIAVGTS+RGGLGKL VRGSNS 
Sbjct  113   --NDSTMISKDEDLEVECDGYLTRCVEGKKATDVRLAAIAVGTSTRGGLGKLSVRGSNSV  170

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG+SAI  GCPSL+ LSLWNVP +GDEGLLE+AREC SLEKLDL  CPSISN+GL
Sbjct  171   RGITNVGLSAIAHGCPSLRALSLWNVPCIGDEGLLEVARECRSLEKLDLSHCPSISNRGL  230

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSLTIESCPNIGNEGL+AIGR C KLQ LTIKDCPLVGDQG+AS+LSS +
Sbjct  231   VAIAENCPSLTSLTIESCPNIGNEGLQAIGRCCNKLQSLTIKDCPLVGDQGIASILSSGA  290

Query  1143  avlTKVKLHALNITDF  1190
             ++LTKV+LH LNITDF
Sbjct  291   SMLTKVELHCLNITDF  306


 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  786   GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV  965
             G T+VG+ A+G+GCP+LK + +     V D G++  A+E  SLE L+L +C  I+  G++
Sbjct  356   GATDVGLEAVGKGCPNLKRMCIRKCCIVSDCGVVAFAKEAGSLECLNLEECNRITQIGIL  415

Query  966   AIAERCTNLTSLTIESCPNIGNEGLRAIGRY-CTKLQCLTIKDCPLVG  1106
                  C  L SL++  C  I +  L+    Y C  L+ L+I+ CP  G
Sbjct  416   NAVSNCRRLKSLSLVKCMGIKDLALQTSLLYPCESLRSLSIRSCPGFG  463



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   458 bits (1178),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 240/316 (76%), Positives = 262/316 (83%), Gaps = 11/316 (3%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             MPTLVN+SGDD+F +G   CSA+           VYCP RKR RI+ PFVVE + K PS+
Sbjct  1     MPTLVNHSGDDEFYSGGPFCSAE-----------VYCPPRKRVRISSPFVVEDRSKDPSL  49

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E LPDECLFEI RRLSGGRERS+AACVSK WLML+SSVR SEI RSKSH +LS  ++V G
Sbjct  50    EILPDECLFEILRRLSGGRERSAAACVSKHWLMLLSSVRTSEICRSKSHNNLSSVEEVKG  109

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
              SND  M   DEDLEVECDGYL+R VEGKKATDVRLAAIAVGTSSRGGLGKL V GSN+ 
Sbjct  110   NSNDTTMISKDEDLEVECDGYLTRCVEGKKATDVRLAAIAVGTSSRGGLGKLSVCGSNAV  169

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG+SAI  GCPSL+VLSLWNVP++GDEGL  IAREC SLEKLDL QCPSISNKGL
Sbjct  170   RGITNVGLSAIAHGCPSLRVLSLWNVPSIGDEGLFAIARECNSLEKLDLSQCPSISNKGL  229

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSLTIESC NIGNEGL+AIGR CTKLQ LTIKDCPLVGDQGVASLLSS +
Sbjct  230   VAIAENCPSLTSLTIESCANIGNEGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGA  289

Query  1143  avlTKVKLHALNITDF  1190
              +LTKVKLH LNITDF
Sbjct  290   TMLTKVKLHGLNITDF  305


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (56%), Gaps = 1/109 (1%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RG T+VG+ A+G+GC +LK + +     + D GL+  A+   SLE + L +C  I+  G+
Sbjct  354   RGATDVGLEAVGKGCLNLKHMCIRKCCFISDGGLVAFAKAAGSLESVHLEECNRITQTGI  413

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCPLVG  1106
             + +   C  L SL++  C  I +  L+ ++   C  L+ L+I+ CP  G
Sbjct  414   LNVVSNCRKLKSLSLVKCMGIKDLALQTSLLSPCESLRSLSIRSCPGFG  462



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   450 bits (1158),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 272/316 (86%), Gaps = 8/316 (3%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  422
             M TLVNYSGD++F +G SLCSADLGL+L+LGHAD+YCP  KRARI+GPF+VE + K PSI
Sbjct  1     MSTLVNYSGDNEFYSGGSLCSADLGLILALGHADIYCPVSKRARISGPFIVEERTKNPSI  60

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E LP+ECLFEIFRRL GGRERS+AACVSKRWLML+S++R+S+I     H +LS A   NG
Sbjct  61    ELLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI----RHTNLSAA---NG  113

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
             AS+D +M+ +DED +VECDGYL+R +EGKKATD+RL+A+AVGTSSRGGLGKL VRGSN  
Sbjct  114   ASDDTKMASSDED-QVECDGYLTRCLEGKKATDIRLSAMAVGTSSRGGLGKLSVRGSNPV  172

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             RGITNVG++AI  GCPSL+VLSLW+V +VGDEGL+EIAR C SLEKLDL +CPS+SNKGL
Sbjct  173   RGITNVGLTAIAHGCPSLRVLSLWDVQDVGDEGLMEIARGCHSLEKLDLTKCPSVSNKGL  232

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             VAIAE C +LTSLTIESC +IGNEGL+AIGR CTKL+ LTIKDCPLVGDQ V SLLSS +
Sbjct  233   VAIAENCPSLTSLTIESCKHIGNEGLQAIGRCCTKLESLTIKDCPLVGDQAVVSLLSSDN  292

Query  1143  avlTKVKLHALNITDF  1190
               L KVKLH+LNITDF
Sbjct  293   TRLRKVKLHSLNITDF  308


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 90/204 (44%), Gaps = 37/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S RG        GL  L      S  G+ +  +  +G+GC ++K
Sbjct  317   GKAITDLNLCKLE-HVSPRGFWVMGAAHGLQSLASLTVTSCIGLADESLEEVGKGCTNMK  375

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL---VAIAER----------  980
              +      +V D GL+  A+   SLE L L QC  I+  G+   V+I  +          
Sbjct  376   SMCFRECKHVTDSGLVAFAQAAGSLEHLLLEQCDKITQTGILNAVSICSKLKSLSLVKCL  435

Query  981   --------------CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
                           C +L SL+I SCP  G+  L  +G+ C +L  L +     + D G+
Sbjct  436   GVRDLPPQASSLSPCDSLRSLSIRSCPGFGSTSLAMVGKLCPQLHHLDLSGLTRITDAGL  495

Query  1119  asllssasavlTKVKL-HALNITD  1187
               LL S+ A L KV L H +N+TD
Sbjct  496   LPLLESSKAGLVKVNLTHCMNVTD  519



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   436 bits (1121),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 222/320 (69%), Positives = 260/320 (81%), Gaps = 6/320 (2%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEV----QEK  410
             MP LVNY GDDDF  G S+CSAD GL+LS+  ADVYCP RKR+R++ P+ V+     +E+
Sbjct  1     MPALVNYGGDDDFYTGRSICSADSGLVLSI--ADVYCPPRKRSRVSAPYAVDSRLFNKER  58

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
              PSIE LPDECLFEIFRRL G +ERS++ACVSKRWLML+SSVRNSE  RS S Q+     
Sbjct  59    NPSIETLPDECLFEIFRRLPGAQERSASACVSKRWLMLLSSVRNSEFCRSNSPQEQLATK  118

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             +V    +DVEM+ AD D+E++C+GYL+RS+EGKKATDVRLAAIAVGT+ RGGLGKL VRG
Sbjct  119   EVKKTESDVEMNSADGDMEIQCNGYLTRSLEGKKATDVRLAAIAVGTACRGGLGKLSVRG  178

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
              NS RG+TN G+SAI  GCPSL+ LSLWNVP +GDEGL EIAREC SLEKLDLCQCPSIS
Sbjct  179   CNSVRGVTNNGLSAIAHGCPSLRALSLWNVPAIGDEGLFEIARECHSLEKLDLCQCPSIS  238

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGL A+A+ C NL++LTIESC NIGNE L+AIG YC KLQ +TIKDCPL+GDQGVA LL
Sbjct  239   DKGLAAVAKNCPNLSALTIESCSNIGNESLQAIGSYCPKLQSITIKDCPLIGDQGVAGLL  298

Query  1131  ssasavlTKVKLHALNITDF  1190
             SSAS  LTKVK   LNI+DF
Sbjct  299   SSASVALTKVKFQVLNISDF  318


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL  L      S RG +++ + A+G+GCP+L+ + L     V D GL+  A+   SLE L
Sbjct  354   GLQMLSSLTITSCRGTSDLSLEALGKGCPNLRQMCLRKCCFVSDNGLVAFAKAAGSLECL  413

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLRAIGRY-CTKLQCLTIKDCP  1097
              L +C  I+  G++     C + L SL+I  C  I +          C  L+ L+I+ CP
Sbjct  414   QLEECNRITETGILNALSNCNSKLKSLSIVKCMGIKSMPSETPALSPCESLRSLSIRSCP  473



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   419 bits (1076),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 220/321 (69%), Positives = 259/321 (81%), Gaps = 13/321 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQE  407
             MP LVN  GDDDF + G SLCS D G++ S+  H ++YCP RKR+RI+GP++V     ++
Sbjct  1     MPALVNIRGDDDFYSEGGSLCSGDSGVVFSISSHVEIYCPPRKRSRISGPYIVSRNLFED  60

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             K+PSI+ LPDECLFEIFRRL GGRERS++ACVSKRWL ++SSVR+SE  RSK  Q     
Sbjct  61    KRPSIDVLPDECLFEIFRRLPGGRERSASACVSKRWLTVLSSVRSSEFNRSKIPQGQPKT  120

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
               +  A N+ E        ++ECDGYL+R VEGKKATDVRLAAIAVGTSSRGGLGKL +R
Sbjct  121   ISIEKAVNNTE--------DIECDGYLTRCVEGKKATDVRLAAIAVGTSSRGGLGKLSIR  172

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GSN+ RGI+N G+SAI RGCPSL+VLSLWNVP++GDEG+ EIAREC SLEKLDLCQCPSI
Sbjct  173   GSNALRGISNFGLSAIARGCPSLRVLSLWNVPSIGDEGIFEIARECHSLEKLDLCQCPSI  232

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             SN GL AIAE C NLTSLTIESCPNIGNE L+AI ++C KLQ +TIKDC LVGDQG+ASL
Sbjct  233   SNSGLAAIAESCPNLTSLTIESCPNIGNESLQAIAKFCPKLQSITIKDCALVGDQGIASL  292

Query  1128  lssasavlTKVKLHALNITDF  1190
             LSSAS VLTK+KL ALNITD+
Sbjct  293   LSSASTVLTKLKLQALNITDY  313


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 63/123 (51%), Gaps = 2/123 (2%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL  L      S +G+T++ + A+GRGCP+LK + L     V D GL+  A+   SLE L
Sbjct  349   GLQTLSSLTITSCKGVTDLSLEAVGRGCPNLKHMCLRKCCFVSDNGLVAFAKAAGSLESL  408

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCP  1097
              L +   I+  G++     C + L S+++  C  I +      +   C  L+CL+I+ CP
Sbjct  409   QLEEVNRITQLGILTALSSCISKLKSVSLVKCMGIKDLSTEFPMLSPCESLRCLSIRSCP  468

Query  1098  LVG  1106
               G
Sbjct  469   GFG  471



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   397 bits (1021),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 213/321 (66%), Positives = 253/321 (79%), Gaps = 18/321 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVE----VQEK  410
             MPTLVNYSGDD+F +G S     +       H D+YCP  KRARI+ PF +E     Q +
Sbjct  1     MPTLVNYSGDDEFYSGGSCSPYSIA-----SHVDLYCPPSKRARISAPFALEGSFFEQAE  55

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             KPSI+ LPDECLFEI R + GG+ER S+ACVSKRWLMLMSS+R +E+  SKS  +L    
Sbjct  56    KPSIDVLPDECLFEILRHVQGGKERISSACVSKRWLMLMSSIRRTEM-PSKSENELV---  111

Query  591   KVNGASNDVEMSPADEDLEVECD-GYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
                 +S DVEM   D+D E+  D GYL+RS+EGKKATD+RLAAI++GTSSRGGLGKL +R
Sbjct  112   ----SSGDVEMVAFDQDQELNGDDGYLTRSLEGKKATDIRLAAISIGTSSRGGLGKLSIR  167

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GSNS RG+TN+G+SAI RGCPSLK LSLWNVP VGDEGL EIA+ CP LEKLDLC CPSI
Sbjct  168   GSNSIRGVTNLGLSAISRGCPSLKALSLWNVPFVGDEGLFEIAKGCPLLEKLDLCHCPSI  227

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             SNKGL+AIAE C NLT+L++ESC  IGNEGL+AIG+ C+KLQ ++I+DCPLVGD GV+SL
Sbjct  228   SNKGLIAIAESCPNLTALSVESCSKIGNEGLQAIGKLCSKLQSVSIRDCPLVGDHGVSSL  287

Query  1128  lssasavlTKVKLHALNITDF  1190
             LSSAS+VLTKVKL ALNITDF
Sbjct  288   LSSASSVLTKVKLQALNITDF  308


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 77/153 (50%), Gaps = 15/153 (10%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S +G        GL KL      S RG T++ + A+GRGC +LK
Sbjct  317   GKNITNLTLSGLQ-NVSEKGFWVMGNAQGLQKLVSLTITSCRGATDLSLEAMGRGCANLK  375

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
              + L     V D GL+ +A+   SLE L L +C  ++  G+V     C   L SLT+  C
Sbjct  376   QMCLRKCCLVSDNGLVALAKTAASLEGLQLEECNRVTQAGIVGALSNCGEKLKSLTLVKC  435

Query  1017  PNIGNEGLRA---IGRYCTKLQCLTIKDCPLVG  1106
               +G +G+     +   C  L+ L+I++CP  G
Sbjct  436   --LGIKGIACGVPMLSPCRSLRSLSIRNCPGFG  466



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 217/325 (67%), Positives = 255/325 (78%), Gaps = 13/325 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             MP LVNYSGDD+  +G S    S+DLG + S+G   DVY P+ KRARI+ PF+       
Sbjct  1     MPALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q  +PSIE LPDECLFEIFRR+  G+ERSS ACVSK+WLML+SS+R +E   S +  +  
Sbjct  61    QNTRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCNSSAAAE--  118

Query  582   IADKVNGAS--NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
               +K  GA   NDVEM   +E+ EVE DGYL+RS+EGKKATDVRLAAIAVGTSSRGGLGK
Sbjct  119   --EKGTGAPVRNDVEMVSCEENREVESDGYLTRSLEGKKATDVRLAAIAVGTSSRGGLGK  176

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RGSNSARG+TN+G+S I RGCPSL+ LSLWNVP VGDEGL EIA+EC SLEKLDL  
Sbjct  177   LLIRGSNSARGVTNLGLSTIARGCPSLRALSLWNVPFVGDEGLFEIAKECHSLEKLDLTN  236

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CPSISNKGLVA+AE C NL+SL IESC  IGNEGL+ IG+ C +LQ ++IKDCPLVGD G
Sbjct  237   CPSISNKGLVAVAENCPNLSSLNIESCSKIGNEGLQTIGKLCPRLQSISIKDCPLVGDHG  296

Query  1116  vasllssasavlTKVKLHALNITDF  1190
             V+SLLSSAS+VLT+VKL ALNITDF
Sbjct  297   VSSLLSSASSVLTRVKLQALNITDF  321


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 81/177 (46%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S RGIT+V + AI +G  +LK + L     V D GL+  A+   SLE L
Sbjct  357   GLQKLMSLTITSCRGITDVSLEAIAKGSVNLKQMCLRKCCFVSDNGLVAFAKAAGSLESL  416

Query  924   DLCQCPSISNKGLV----------------------------AIAERCTNLTSLTIESCP  1019
              L +C  IS  G+V                            + +  C++L  L+I +CP
Sbjct  417   QLEECNRISQSGIVGAFSNCGAKLKALSLVKCMGIKDMAFGMSASSPCSSLRYLSIRNCP  476

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               G+  +  IG+ C +LQ + +     + D G+  LL S  A L KV L   L++TD
Sbjct  477   GFGSASMAMIGKLCPQLQHVDLSGLCGITDAGLLPLLESCEAGLVKVNLSGCLSLTD  533



>ref|XP_012078802.1| PREDICTED: EIN3-binding F-box protein 1-like [Jatropha curcas]
 gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   395 bits (1014),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 212/323 (66%), Positives = 254/323 (79%), Gaps = 13/323 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----QE  407
             MPTLVNYSGDD+F AG SLC+  +  + S+G   D+Y P  KRAR + PF+       Q 
Sbjct  1     MPTLVNYSGDDEFYAGGSLCTNSM--LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFEQN  58

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             K+PSI+ LPDECLFEIFRR+ GG+ERSS ACVSKRWL+L+SS++ +EI  SK+     +A
Sbjct  59    KQPSIDVLPDECLFEIFRRIPGGKERSSCACVSKRWLLLLSSIKRAEICESKTL----VA  114

Query  588   DK--VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             D       SNDVEM  +DE+ ++E DGYL+RS+EGKKATD RLAAIAVGTS  GGLGKL 
Sbjct  115   DNEVTVSVSNDVEMISSDENGKIESDGYLTRSLEGKKATDTRLAAIAVGTSGHGGLGKLM  174

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS RG+T++G+SAI  GCPSL+ LSLW+VP+VGDEGL +IA+EC  LEKLDLC C 
Sbjct  175   IRGSNSVRGVTDLGLSAIAHGCPSLRALSLWDVPSVGDEGLFKIAKECHLLEKLDLCNCR  234

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             SISNKGL+AIAE C NL +L IESCP IGNEGL+AIG++CT LQ L+IKDCPLVGD GV+
Sbjct  235   SISNKGLIAIAENCPNLIALNIESCPKIGNEGLQAIGKFCTNLQSLSIKDCPLVGDHGVS  294

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSSAS  LTKVKL ALNITDF
Sbjct  295   SLLSSASGGLTKVKLQALNITDF  317


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 68/124 (55%), Gaps = 4/124 (3%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL     +S RGITNV I AI +GC +LK + L     V D GL+  AR   SLE L
Sbjct  353   GLQKLMSLTISSCRGITNVSIEAIAKGCTNLKQMCLRKCCFVSDNGLISFARAAGSLESL  412

Query  924   DLCQCPSISNKGLV-AIAERCTNLTSLTIESCPNI--GNEGLRAIGRYCTKLQCLTIKDC  1094
              L +C  ++  G+V AI+   T L +L +  C  I  G  G+  +   C+ L+ L+I++C
Sbjct  413   QLEECNRVTQSGIVGAISNSGTKLKALNLVKCMGIRDGTSGMPLLSP-CSSLRSLSIRNC  471

Query  1095  PLVG  1106
             P  G
Sbjct  472   PGFG  475



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score =   393 bits (1010),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 209/322 (65%), Positives = 244/322 (76%), Gaps = 26/322 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGP----FVVEVQE  407
             MP LVNY GDDDF +  S CS D GL+ S+G HA+VYCP RKR+RI GP      +   +
Sbjct  1     MPALVNYRGDDDFNSIRSSCSGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADD  60

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             K PSI+ LPDECLFEIF  LS GRERS++ACVSKRWL ++SSVR SE  R K+       
Sbjct  61    KTPSIDTLPDECLFEIFTHLSNGRERSTSACVSKRWLSVLSSVRCSEFHRIKT-------  113

Query  588   DKVNGASNDVEMSPADEDLEVE-CDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
                          P + D+E+E CDGYL+R VEGKKATD+RLAAIAVGTSSRGGLGKL +
Sbjct  114   -------------PQESDIEMESCDGYLTRCVEGKKATDIRLAAIAVGTSSRGGLGKLSI  160

Query  765   RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPS  944
             RGSNS+RG+TN G+S I RGCPSL+ LSLWNVP+VGDEGL EIAREC SLEKLDLCQCP 
Sbjct  161   RGSNSSRGVTNHGLSVIARGCPSLRALSLWNVPSVGDEGLFEIARECHSLEKLDLCQCPL  220

Query  945   ISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
             I+NKGL AIAE C NLTSLTIESC NIGNEG+++I ++C KL  + IKDCP +GD+G+AS
Sbjct  221   ITNKGLSAIAENCPNLTSLTIESCINIGNEGIQSIAKFCPKLNSIAIKDCPFIGDKGIAS  280

Query  1125  llssasavlTKVKLHALNITDF  1190
             LLSS S  LTKVKL  LNITD+
Sbjct  281   LLSSTSDALTKVKLQNLNITDY  302


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 91/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S +G        GL  L      S +GIT++ I ++G+GCP+LK
Sbjct  311   GKSVTNLILSGLQ-NVSQKGFWVMGQAKGLKMLSSLTITSCKGITDLSIESLGKGCPNLK  369

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-----------  986
              + L     V D+GL+  A+   SLE L L +C  I+  G++     C            
Sbjct  370   HVCLRKCYFVSDKGLVAFAKGVTSLESLQLEECNRITQIGILNALSSCVSKLKSVSLVKC  429

Query  987   -----------------NLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                              +L SL+I++CP  G+  L  +G+ C  L  L +     + D G
Sbjct  430   MGIKDLATEIPSLSPCESLRSLSIKNCPGFGSTSLAMVGKLCPNLHHLDLSGLCGITDGG  489

Query  1116  vasllssasavlTKVKL-HALNITD  1187
             +  LL S    L +V L H  N+T+
Sbjct  490   LLPLLESCQTGLARVNLSHCSNLTE  514



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   392 bits (1007),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 207/324 (64%), Positives = 252/324 (78%), Gaps = 18/324 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             MP LVNYSGDD+F +G SLC+   DLG   S+G H D Y P  KRARI+ PF+       
Sbjct  1     MPALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q K+PSI+ LPDECLFEIFRR+ GG+ERS+ ACVSKRWL L+SS+R +E+          
Sbjct  61    QNKQPSIDVLPDECLFEIFRRIPGGKERSACACVSKRWLTLLSSIRRAELCN--------  112

Query  582   IADKVNGASNDVEM-SPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
               +++    NDVEM S  DE+ E+E DGYL+RS+EGKKATD+RLAAIAVGTS  GGLGKL
Sbjct  113   --ERIVPGCNDVEMASSCDENGEIESDGYLTRSLEGKKATDMRLAAIAVGTSGHGGLGKL  170

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RGSNS RG+TN+G+ AI RGCPSL+ LSLW+VP+V DEGL E+A+EC  LEKLDLC C
Sbjct  171   LIRGSNSIRGVTNLGLMAIARGCPSLRSLSLWDVPSVADEGLFEVAKECHLLEKLDLCNC  230

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             PSI+NKGL+AIAE C+NL SL IESCP IGNEG++AIG++C KLQ ++IKDC LVGD GV
Sbjct  231   PSITNKGLIAIAENCSNLISLNIESCPKIGNEGIQAIGKFCNKLQSISIKDCRLVGDHGV  290

Query  1119  asllssasavlTKVKLHALNITDF  1190
             +SLLSSA+ VL+KVKL ALN+TDF
Sbjct  291   SSLLSSATNVLSKVKLQALNVTDF  314


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 85/177 (48%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL     +S RGIT+V I AI +GC +LK + L     V D GL+  AR   SLE L
Sbjct  350   GLQKLMSLTISSCRGITDVSIEAIAKGCTNLKQMCLRKCCFVSDNGLVSFARAAGSLESL  409

Query  924   DLCQCPSISNKGLV----------------------------AIAERCTNLTSLTIESCP  1019
              L +C  ++  G+V                             ++  C++L SL+I +CP
Sbjct  410   QLEECNRVTQSGIVGAISNCGTKLKALSLVKCMGIRDVASQMVVSSPCSSLRSLSIRNCP  469

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               G+  L  +G+ C +LQ + +     + D G+  LL S+ A L KV L   +N+TD
Sbjct  470   GFGSASLALVGKLCPQLQHVDLSGLCAITDSGLLPLLESSEAGLVKVNLSGCMNLTD  526



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   384 bits (987),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 248/323 (77%), Gaps = 17/323 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             MP LVN SGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  +        
Sbjct  1     MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q K PSI  LPDECLFEIFRRL GG+ERSS A VSK+WLML+SS+R  ++ +S       
Sbjct  61    QVKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLLSSIRKVDLCKSP------  114

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             + D     SND EM   DED E E DG+L+R +EGKKATD+RLAAIAVGTSSRGGLGKL 
Sbjct  115   VVDN----SNDAEMITGDEDQEQENDGFLTRCLEGKKATDIRLAAIAVGTSSRGGLGKLS  170

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS RG+TN+G+SA+ +GCP LK LSLWN+ +VGDEGL+EIA+ CP LEKLDLCQCP
Sbjct  171   IRGSNSFRGVTNLGLSAVAQGCPFLKSLSLWNISSVGDEGLIEIAKGCPLLEKLDLCQCP  230

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             SISNKGL+AIAE+C NL SL IESC  IGNEGL+AIG+ C+KLQ ++++DC LVGD GV+
Sbjct  231   SISNKGLIAIAEKCPNLNSLNIESCSRIGNEGLQAIGKSCSKLQSVSVRDCVLVGDHGVS  290

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSSAS+VL K+KL ALNITDF
Sbjct  291   SLLSSASSVLMKLKLQALNITDF  313


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 75/166 (45%), Gaps = 29/166 (17%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S RG T+V + AIG+GC SLK + L     V D GL+  A+   SLE L L +C  ++  
Sbjct  360   SCRGTTDVSLEAIGKGCTSLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRVTQS  419

Query  957   GLVAIAERC-TNLTSLT---------------------------IESCPNIGNEGLRAIG  1052
             G++     C   L SLT                           I +CP  G+  L  +G
Sbjct  420   GIIYALTNCGEKLRSLTLVKCMGIKDVSLAVPMTSSCRSLRSLSIRNCPGFGSASLAMVG  479

Query  1053  RYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             R C +L  + +     + D G+ SLL S    L KV L+  LN+TD
Sbjct  480   RLCPQLHNIDLSGLYGMTDAGILSLLESLEEGLVKVNLNGCLNLTD  525



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   383 bits (983),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 212/325 (65%), Positives = 253/325 (78%), Gaps = 12/325 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVVEV----  401
             MPTLVNYSGDD+  +G S  +  +DLG + S+  + DVY P+ KRARI+ PF+ E     
Sbjct  1     MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--SHQD  575
             Q K+PSIE LPDECLFEIFRR+  G+ERSS A VSK+WLML+SS+R SE   S   + ++
Sbjct  61    QNKRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCYSNPVAEEE  120

Query  576   LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
                A  V    NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTSSRGGLGK
Sbjct  121   KETAAPV---CNDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSSRGGLGK  177

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RGSNS RG+TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  
Sbjct  178   LLIRGSNSVRGVTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLAN  237

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CPSISNKGL+AIAE C NL+SL IESC  IGNEGL+AIG+ C +L  ++IKDCPL+GD G
Sbjct  238   CPSISNKGLIAIAENCPNLSSLNIESCSKIGNEGLQAIGKLCPRLYSISIKDCPLLGDHG  297

Query  1116  vasllssasavlTKVKLHALNITDF  1190
             V+SLLSSAS+VLT+VKL  LNITDF
Sbjct  298   VSSLLSSASSVLTRVKLQGLNITDF  322


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 75/151 (50%), Gaps = 11/151 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S RG        GL KL      S RGIT+V + AI +G  +LK
Sbjct  331   GKAVTNLSLSVLQ-HVSERGFWVMGNAQGLQKLMSLTITSCRGITDVSLEAIAKGSLNLK  389

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
              + L     V D GL+  A+   SLE L L +C  I+  G+V     C T L +L++  C
Sbjct  390   QMCLRKCCFVSDNGLIAFAKAAGSLESLQLEECNRITQSGIVGALSNCGTKLKALSLVKC  449

Query  1017  PNIGNEGL-RAIGRYCTKLQCLTIKDCPLVG  1106
               I +  L   +   C+ L+ L+I++CP  G
Sbjct  450   MGIKDMSLGMPVPSPCSYLRYLSIRNCPGFG  480



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   382 bits (982),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 211/325 (65%), Positives = 252/325 (78%), Gaps = 12/325 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVVEV----  401
             MPTLVNYSGDD+  +G S  +  +DLG + S+  + DVY P+ KRARI+ PF+ E     
Sbjct  1     MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--SHQD  575
             Q  +PSIE LPDECLFEIFRR+  G+ERSS A VSK+WLML+SS+R SE   S   + ++
Sbjct  61    QNMRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCNSNPVAEEE  120

Query  576   LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
                A  V    NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTSSRGGLGK
Sbjct  121   KETAAPV---CNDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSSRGGLGK  177

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RGSNS RG+TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  
Sbjct  178   LLIRGSNSVRGVTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSN  237

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CPSISNKGL+AIAE C NL+SL IESC  IGNEGL+AIG+ C +L  ++IKDCPL+GD G
Sbjct  238   CPSISNKGLIAIAENCPNLSSLNIESCSKIGNEGLQAIGKLCPRLHSISIKDCPLLGDHG  297

Query  1116  vasllssasavlTKVKLHALNITDF  1190
             V+SLLSSAS+VLT+VKL  LNITDF
Sbjct  298   VSSLLSSASSVLTRVKLQGLNITDF  322


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 75/151 (50%), Gaps = 11/151 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S RG        GL KL      S RGIT+V + AI +G  +LK
Sbjct  331   GKAVTNLSLSVLQ-HVSERGFWVMGNAQGLQKLMSLTITSCRGITDVSLEAIAKGSLNLK  389

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
              + L     V D GL+  A+   SLE L L +C  I+  G+V     C T L +L++  C
Sbjct  390   QMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRITQSGIVGALSNCGTKLKALSLVKC  449

Query  1017  PNIGNEGL-RAIGRYCTKLQCLTIKDCPLVG  1106
               I +  L   +   C+ L+ L+I++CP  G
Sbjct  450   MGIKDMALGMPVPSPCSYLRYLSIRNCPGFG  480



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   382 bits (981),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 202/328 (62%), Positives = 248/328 (76%), Gaps = 12/328 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGL---MLSLGHADVYCPSRKRARITGPFVVE----V  401
             MP LVNY GDD++  G S  S+ + L   + +  H D+Y    KRARI  P V       
Sbjct  1     MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS-----  566
             QE  PSIEALPDECLFEIFR L   RERSS A VSKRWLML+S++R +EI +S+S     
Sbjct  61    QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRSTCISQ  120

Query  567   HQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGG  746
               + S  ++    S+++ +   DED E E +G+L+R +EGKKATDVRLAAIAVGTS RGG
Sbjct  121   MVESSNVEQQKTESDEISVVNCDEDQEDESNGFLTRCLEGKKATDVRLAAIAVGTSGRGG  180

Query  747   LGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLD  926
             LGKL +RGSNS RG+TN+G+SAI  GCPSL++LSLWNVP+VGDEGL EIAREC  LEKLD
Sbjct  181   LGKLSIRGSNSTRGVTNLGLSAIAHGCPSLRILSLWNVPSVGDEGLFEIARECHLLEKLD  240

Query  927   LCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVG  1106
             LC CPSIS+KGL+AIAE+CTNLTSL+IESCP IGNEGL+AIG+ C+KLQ ++I+DCP VG
Sbjct  241   LCHCPSISDKGLIAIAEQCTNLTSLSIESCPKIGNEGLQAIGKLCSKLQTISIRDCPRVG  300

Query  1107  DQGvasllssasavlTKVKLHALNITDF  1190
             DQGV+SL +S+S  + KVK+ ALNITDF
Sbjct  301   DQGVSSLFASSSCAIMKVKIQALNITDF  328


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 66/141 (47%), Gaps = 28/141 (20%)
 Frame = +3

Query  735   SRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSL  914
             S  GL KL +    S RG+T+V + A+G+G  +LK + +     V D GL+  A+   SL
Sbjct  361   SAQGLKKLTLLMIASCRGMTDVSLEAMGKGIANLKQMCIQKCCFVSDNGLIAFAKAAGSL  420

Query  915   EKLDLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIE  1010
             E L L +C  I+  G+                            V +   CT+L SL+I+
Sbjct  421   EMLQLEECNRITLLGIGGALSNHIRNLKSLTVVKCLGIKDIAQEVTLPSLCTSLRSLSIQ  480

Query  1011  SCPNIGNEGLRAIGRYCTKLQ  1073
             +CP  G+  L  +G+ C +LQ
Sbjct  481   NCPGFGSASLSMVGKLCPQLQ  501



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   382 bits (980),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 251/323 (78%), Gaps = 17/323 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             MP LVNY GDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  F        
Sbjct  1     MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q KKPSI+ LPDECLFEIFRRL+GG+ERSS A VSK+WLML+SS+R  ++ ++       
Sbjct  61    QVKKPSIDDLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSIRKVDLCKNP------  114

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             +AD     S+D EM+  DED E E DG+L+R +EGKKATD+RLAAIAVGTSSRGGLGKL 
Sbjct  115   VADN----SDDTEMTNGDEDREQENDGFLTRCLEGKKATDIRLAAIAVGTSSRGGLGKLS  170

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS RG+TN+G+SA+ +GCPSLK L+LW++ +VGDEGL+EIA+ CP L KLDL QCP
Sbjct  171   IRGSNSFRGVTNLGLSAVAQGCPSLKSLALWDISSVGDEGLIEIAKGCPLLAKLDLFQCP  230

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             SISNKGL+AIAE C NLTSL IESC  IGNEGL+AIGR C+KLQ ++I+DC LVGD GV+
Sbjct  231   SISNKGLIAIAENCPNLTSLNIESCSRIGNEGLQAIGRSCSKLQSISIRDCVLVGDHGVS  290

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSS S+VL KV+L ALNITDF
Sbjct  291   SLLSSGSSVLMKVRLQALNITDF  313


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 75/166 (45%), Gaps = 29/166 (17%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S RG T+V + AIG+GC +LK + L     V D GL   A+   SLE + L +C  ++  
Sbjct  360   SCRGTTDVSLEAIGKGCTNLKQMCLRKCCFVSDNGLAAFAKAAGSLESVQLEECNRVTQS  419

Query  957   GLVAIAERC-TNLTSLT---------------------------IESCPNIGNEGLRAIG  1052
             G+++    C   L SLT                           I +CP  G+  L  +G
Sbjct  420   GIISALSNCGEKLRSLTLVKCMGIKDADAAVPIPSSCRSLRSLSIRNCPGFGSASLAMVG  479

Query  1053  RYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             R C +L  + +     + D GV SLL S    L KV L+  LN+TD
Sbjct  480   RLCPQLHNVDMSGLYGMTDAGVLSLLGSLEEGLVKVNLNGCLNLTD  525



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   380 bits (976),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 209/323 (65%), Positives = 247/323 (76%), Gaps = 17/323 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             MP LVNYSGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  +        
Sbjct  1     MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q K PSI  LPDECLFEIFRRL GG+ERSS A VSK+WLML+SS+   ++ +      + 
Sbjct  61    QIKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLISSIWKVDLCK------IP  114

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             + D     S+D EM   DED E E DG+L+R +EGKKATD+RLAAIAVGTSSRGGLGKL 
Sbjct  115   VVDN----SDDAEMITGDEDQEQENDGFLTRCLEGKKATDIRLAAIAVGTSSRGGLGKLS  170

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS RG+TN+G+SA+ +GCPSLK LSLWN+ +VGDEGL+EIA+ CP LEKLDLC CP
Sbjct  171   IRGSNSFRGVTNLGLSAVAQGCPSLKSLSLWNISSVGDEGLIEIAKGCPLLEKLDLCGCP  230

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             SISNKGL+AIAE C NL SL IESC  IGNEGL+AIG+ C+KLQ ++I+DC LVGD GV+
Sbjct  231   SISNKGLIAIAENCPNLNSLNIESCSRIGNEGLQAIGKSCSKLQSVSIRDCVLVGDHGVS  290

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSSAS+VL K+KL ALNITDF
Sbjct  291   SLLSSASSVLMKLKLQALNITDF  313


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 76/166 (46%), Gaps = 29/166 (17%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S RG T+V + AIG+GC SLK + L     V D GL+  A+   SLE L L +C  ++  
Sbjct  360   SCRGTTDVSLEAIGKGCTSLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRVTQS  419

Query  957   GLVAIAERC-TNLTSLTI---------------------------ESCPNIGNEGLRAIG  1052
             G++     C   L SLT+                            +CP  G+  L  +G
Sbjct  420   GIIYALTXCGEKLRSLTLVKCMGIKDVSLAVPMTSSCRSLRSLSXRNCPGFGSASLAMVG  479

Query  1053  RYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             R C +L  + +     + D G+ SLL S+   L KV L+  LN+TD
Sbjct  480   RLCPQLHNIDLSGLYGMTDAGILSLLESSEEGLVKVNLNGCLNLTD  525



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   380 bits (975),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 210/336 (63%), Positives = 253/336 (75%), Gaps = 21/336 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             M TLVNY+GD+DF +G SL +   D  L+LSLG H DVYCP RKR+RIT PFV       
Sbjct  1     MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF-----RSKS  566
             Q+K+ SIE LPDECLFEIFRRL GG+ERS  ACVSKRWL L+SS+R +E++     +   
Sbjct  61    QKKQSSIEVLPDECLFEIFRRLPGGQERSICACVSKRWLFLLSSIRRTEVYGIETTQPAK  120

Query  567   HQDLSIADKVNGASNDVEMSPAD---------EDLEVECDGYLSRSVEGKKATDVRLAAI  719
             H+   ++DK +  S  V+  PA          EDLEVE +GY +RS+ GKKATD+RLAAI
Sbjct  121   HEGELVSDKTDEFSKLVKEEPASVSSDVASVGEDLEVESEGYFTRSLGGKKATDIRLAAI  180

Query  720   AVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIAR  899
             AVGT SRGGLGKL +RGSNS RG+T+ G++AI RGCPSL+VLSLWNV +VGD+GL +IA 
Sbjct  181   AVGTGSRGGLGKLLIRGSNSIRGVTDNGLTAIARGCPSLRVLSLWNVSSVGDKGLSDIAS  240

Query  900   ECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCL  1079
              C  LEKLDLCQC SIS+KGL+AIAE C NL +LTIE C  IGN  L+AIG+YC  LQ +
Sbjct  241   GCHMLEKLDLCQCSSISDKGLMAIAENCPNLAALTIECCSKIGNGTLQAIGQYCPNLQSI  300

Query  1080  TIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             +IKDCPL+GDQG+A+LLSSAS VLTKVKL ALNITD
Sbjct  301   SIKDCPLIGDQGIANLLSSASHVLTKVKLQALNITD  336


 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 94/205 (46%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L  +    S RG        GL KL     +S RG+T++G+ A+G+GCP LK
Sbjct  346   GKAVTELVLTGLQ-NVSERGFWVMGNTHGLLKLKSITISSCRGVTDLGLQAVGKGCPDLK  404

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA-----------------  968
              L L     V D GL++ AR   SLE L L +C  I+  G++                  
Sbjct  405   QLILRKCSFVSDNGLVDFARAAASLENLQLEECNRITQSGVLGAISNCGSKLKALAFVKC  464

Query  969   -----------IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                        +   C +L SL+I +CP  G+  L  +G+ C +LQ + +     + D G
Sbjct  465   MGIKDMVLELPMLSPCDSLRSLSIRNCPGFGSSSLAVVGKLCPRLQNIELSGLCGITDAG  524

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  L+ +    L KV L   LN+TD
Sbjct  525   LLPLVENCEPGLVKVNLSGCLNLTD  549



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   379 bits (974),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 251/328 (77%), Gaps = 13/328 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ---  404
             M TLVNYSGDDDF  G S      D GL++S+G   DVYCP RKR+RIT P++       
Sbjct  3     MSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLE  62

Query  405   -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
              EK+PSI+ LPDECLFEI RRL GG+ERSS A VSKRWLML+SS+R +EI   KS Q L+
Sbjct  63    LEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLN  122

Query  582   IADKVNG-----ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGG  746
              + K++        +D+EM  A ED E+  DGYL+R +EGKKATD+ LAAIAVGTSSRGG
Sbjct  123   ESSKLDKELTIPVPDDIEMISA-EDRELGSDGYLTRCLEGKKATDISLAAIAVGTSSRGG  181

Query  747   LGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLD  926
             LGKL +R S+S+RG+TN+G+S I  GCPSL+VLSLWNV  VGDEGL EI   C  LEKLD
Sbjct  182   LGKLSIRESSSSRGVTNLGLSKIAHGCPSLRVLSLWNVSAVGDEGLFEIGNGCHMLEKLD  241

Query  927   LCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVG  1106
             LCQCP IS+KGL+AIA+ C NLT+LTIESC NIGNE L+AIG  C KLQ ++IKDCPLVG
Sbjct  242   LCQCPLISDKGLIAIAKNCPNLTALTIESCANIGNESLQAIGSLCPKLQSISIKDCPLVG  301

Query  1107  DQGvasllssasavlTKVKLHALNITDF  1190
             DQGVA LLSSA+++L++VKL +LNITDF
Sbjct  302   DQGVAGLLSSATSILSRVKLQSLNITDF  329


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 81/177 (46%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL  L      S RGIT+V + A+G+GCP+LK + L     V D GL+  A+   SLE L
Sbjct  365   GLQTLISLTITSCRGITDVSLEAMGKGCPNLKQMCLRKCCFVSDNGLIAFAKAAGSLEGL  424

Query  924   DLCQCPSISNKGLVA----------------------------IAERCTNLTSLTIESCP  1019
              L +C  ++  G++                             +   C +L SL+I +CP
Sbjct  425   QLEECNRVTQLGVIGSLSNCGSKLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCP  484

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               G+  L  +G+ C +L  + +     + D G+  LL S  A L KV L   LN+TD
Sbjct  485   GFGSASLAMVGKLCPQLHHVDLSGLDGMTDAGLLPLLESCEAGLAKVNLSGCLNLTD  541



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   377 bits (969),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 243/323 (75%), Gaps = 32/323 (10%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             MP LVNYSGDD+  +G SL   S+DLG + S+G   DVY P+ KRARI+ PF+       
Sbjct  1     MPALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q K+PSIE LPDECLFEIFRR+  G+ERSS ACVSK+WLML+SS+R +E   SK+     
Sbjct  61    QNKRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCSSKNR----  116

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                                  EVE DGYL+RS+EGKKATD+RLAAIAVGTSSRGGLGKL 
Sbjct  117   ---------------------EVESDGYLTRSLEGKKATDMRLAAIAVGTSSRGGLGKLL  155

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS RG+TN+G+S I RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CP
Sbjct  156   IRGSNSVRGVTNLGLSTIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLTNCP  215

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             SISNKGL+A+AE C NL+SL IESC  IGNEGL+ IG+ C KLQ ++IKDCPLVGD GV+
Sbjct  216   SISNKGLIAVAENCPNLSSLNIESCSKIGNEGLQTIGKLCPKLQSISIKDCPLVGDHGVS  275

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSSAS+VLT+VKL ALNITDF
Sbjct  276   SLLSSASSVLTRVKLQALNITDF  298


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 2/123 (2%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S RGIT+V + AI +G  +LK + L     V D GL+  A+   SLE L
Sbjct  334   GLQKLMSLTITSCRGITDVSLEAIAKGSVNLKQMCLRKCCFVSDNGLVAFAKAAGSLESL  393

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCP  1097
              L +C  +S  G+V     C   L +L++  C  I +   R ++   C+ L+ L+I++CP
Sbjct  394   QLEECNRVSQSGIVGSLSNCGAKLKALSLVKCMGIKDMAFRMSVSSPCSSLRYLSIRNCP  453

Query  1098  LVG  1106
               G
Sbjct  454   GFG  456



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   377 bits (969),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 201/324 (62%), Positives = 243/324 (75%), Gaps = 8/324 (2%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGL---MLSLGHADVYCPSRKRARITGPFVVE----V  401
             MP LVNY GDD++  G S  S+ + L   + +  H D+Y    KRARI  P V       
Sbjct  1     MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             QE  PSIEALPDECLFEIFR L   RERSS A VSKRWLML+S++R +EI +S+S     
Sbjct  61    QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRSTCISQ  120

Query  582   IADKVN-GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
               +  N      + +   DED E E +G+L+R +EGKKATDVRLAAIAVGTS RGGLGKL
Sbjct  121   TVECSNVEQQKTISVVNCDEDQEDESNGFLTRCLEGKKATDVRLAAIAVGTSGRGGLGKL  180

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RGSNS RG+TN+G+SAI  GCPSL++LSLWNVP+VGDEGL EIAREC  LEKLDLC C
Sbjct  181   SIRGSNSTRGVTNLGLSAIAHGCPSLRMLSLWNVPSVGDEGLFEIARECHLLEKLDLCHC  240

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             PSIS+KGL+AIAE+CTNLTSL+IESCP IGNEGL+AIG+ C+KLQ ++I+DCP VGDQGV
Sbjct  241   PSISDKGLIAIAEQCTNLTSLSIESCPKIGNEGLQAIGKLCSKLQTISIRDCPRVGDQGV  300

Query  1119  asllssasavlTKVKLHALNITDF  1190
             +SL +S+S  + KVK+ ALNITDF
Sbjct  301   SSLFASSSCAIMKVKIQALNITDF  324


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 66/141 (47%), Gaps = 28/141 (20%)
 Frame = +3

Query  735   SRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSL  914
             S  GL KL +    S RG+T+V + A+G+G  +LK + +     V D GL+  A+   SL
Sbjct  357   SAQGLKKLTMMTIASCRGMTDVSLEAMGKGIANLKQMCIQKCCFVSDNGLIAFAKAAGSL  416

Query  915   EKLDLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIE  1010
             E L L +C  I+  G+                            V +   CT+L SL+++
Sbjct  417   EMLQLEECNRITLLGIGGALSNHIRNLKSLTVVKCLGIKDIAQEVTLPSLCTSLRSLSVQ  476

Query  1011  SCPNIGNEGLRAIGRYCTKLQ  1073
             +CP  G+  L  +G+ C +LQ
Sbjct  477   NCPGFGSASLSMVGKLCPQLQ  497



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   377 bits (969),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 213/338 (63%), Positives = 253/338 (75%), Gaps = 23/338 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             MPTLVNY+GD+DF +G SL +   D  L+LSLG H DVYCP RKR+RI+ PFV       
Sbjct  1     MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ---  572
             Q+K+ SIE LPDECLFEIFRRL GG+ERS+ A VSKRWL+L+SS+R +EI  SK+ Q   
Sbjct  61    QQKQSSIEVLPDECLFEIFRRLPGGQERSACASVSKRWLVLLSSIRRTEICTSKTTQSAK  120

Query  573   -----------DLSIADKVNG--ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLA  713
                        + S  DK +    SN+  ++  D DLE+E +G+L+R +EGKKATD+RLA
Sbjct  121   PEAGLVPDMGDESSKLDKEDSLPVSNENGVASVDVDLELESEGHLTRCLEGKKATDIRLA  180

Query  714   AIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEI  893
             AIAVGT SRGGLGKL +RGSNS RG+T+ G+SAI RGCPSLK LSLWNV ++GD GL EI
Sbjct  181   AIAVGTGSRGGLGKLLIRGSNSIRGVTDFGLSAIARGCPSLKALSLWNVSSIGDAGLSEI  240

Query  894   ARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             A  C  LEKLDLCQ PSIS+KGL+AIAE C NL SLTIESC  +GNE L+AIGR C  LQ
Sbjct  241   ASGCHMLEKLDLCQLPSISDKGLMAIAENCPNLISLTIESCSKVGNESLQAIGRCCPNLQ  300

Query  1074  CLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              ++IKDCPLVGDQGVASLLSS S VLTKVKL  LNI+D
Sbjct  301   SISIKDCPLVGDQGVASLLSSVSYVLTKVKLQGLNISD  338


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 91/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L  +    S RG        GL KL      S RG+T++G+ A+G+GCP+L+
Sbjct  348   GKAVTELVLTGLQ-NVSERGFWVMGNTHGLQKLKSITITSCRGVTDLGLEAVGKGCPNLR  406

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER-------------  980
              L L     + D GL+  AR   SLE L L +C  I+  G++                  
Sbjct  407   QLILQKCLFLSDNGLIAFARNAASLESLQLEECNRITQSGVLGALSNCGAKLKALSLVKC  466

Query  981   ---------------CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L S ++  CP  G+  L  +G+ C +LQ + +     + D G
Sbjct  467   MGIKDVVLGLPQLSPCNSLRSFSVRHCPGFGSSSLAMVGKLCPQLQYVDLSGLCGITDAG  526

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  L+ ++   L KV L   +N+TD
Sbjct  527   ILPLIENSELGLVKVNLSGCMNLTD  551



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   376 bits (965),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 247/323 (76%), Gaps = 17/323 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             MP LVNYSGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  F        
Sbjct  1     MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q KKPSI+ LPDECLFEIFRRL+GG+ERSS A VSK+WLML+SSVR  ++ ++       
Sbjct  61    QVKKPSIDVLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSVRKVDLCKNP------  114

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             +AD     S+  EM+  DED E E DG+L+R +EGKKATD+RLAAI+VGTSSRGGLGKL 
Sbjct  115   VADN----SDXTEMTNGDEDXEQENDGFLTRCLEGKKATDIRLAAISVGTSSRGGLGKLS  170

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS RG+TN+G+SA+ +GCPSLK L+LW++ +VGDEGL+EIA+ CP L KLDL QCP
Sbjct  171   IRGSNSFRGVTNLGLSAVAQGCPSLKSLALWDISSVGDEGLIEIAKGCPLLAKLDLFQCP  230

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             SISN GL+AIAE C NLT L IESC  IGNEGL+AIGR C KLQ + I+DC LVGD GV+
Sbjct  231   SISNXGLIAIAENCPNLTXLNIESCSRIGNEGLQAIGRSCXKLQSICIRDCVLVGDHGVS  290

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSS S+VL KV+L ALNITDF
Sbjct  291   SLLSSGSSVLMKVRLQALNITDF  313


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 76/166 (46%), Gaps = 29/166 (17%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S RG T+V + AIG+GC +LK + L     V D GL+  A+   SLE L L +C  ++  
Sbjct  360   SCRGTTDVSLEAIGKGCTNLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRVTQS  419

Query  957   GLVAIAERC-TNLTSLT---------------------------IESCPNIGNEGLRAIG  1052
             G+++    C   L SLT                           I +CP  G+  L  +G
Sbjct  420   GIISALSNCGEKLRSLTLVKCMGIKDVGAAVPIXSSCRSLRSLSIRNCPGFGSASLAMVG  479

Query  1053  RYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             R C +L  + +     + D GV SLL S    L KV L+  LN+TD
Sbjct  480   RLCPQLHNVDMSGLYGMTDAGVLSLLESLEEGLVKVNLNGCLNLTD  525



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   377 bits (967),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 244/320 (76%), Gaps = 17/320 (5%)
 Frame = +3

Query  252   LVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVV----EVQEK  410
              +  SGDDDF +G S    S DLG + S+    DVYCP RKRARI  PF+       Q K
Sbjct  51    FIGISGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFGETEFEQNK  110

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             +PSI+ LP+ECLFEIF+RL GGRERSS ACVSK WLML++S+R SE   SK      + +
Sbjct  111   QPSIDVLPEECLFEIFKRLPGGRERSSCACVSKHWLMLLTSIRKSEYESSKV-----VKE  165

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
               +  S DVEM  +DED     DGYL+R +EGKKATD+RLAA+AVGTS  GGLGKL +RG
Sbjct  166   NTDLVSEDVEMISSDED-----DGYLTRCLEGKKATDMRLAAVAVGTSGHGGLGKLSIRG  220

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             S+S+ G+TN G+SAI RGCPSLK LSLWN+P VGDEGL EIA+EC  LEKLDLCQCP +S
Sbjct  221   SSSSCGVTNFGLSAIARGCPSLKALSLWNIPCVGDEGLSEIAKECHLLEKLDLCQCPLVS  280

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             NKGL+AIAE C NLTSL+IESCP IGNEGL+AIG+ C KLQ ++IKDCPLVGD GV+SLL
Sbjct  281   NKGLIAIAENCPNLTSLSIESCPKIGNEGLQAIGKLCPKLQSISIKDCPLVGDHGVSSLL  340

Query  1131  ssasavlTKVKLHALNITDF  1190
             +SAS+VL+KVKL  LNITDF
Sbjct  341   ASASSVLSKVKLQGLNITDF  360


 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 77/150 (51%), Gaps = 11/150 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S +G        GL KL      S  G+T+V + A+G+GC +LK
Sbjct  369   GKSVTNLMLSGLQ-NVSEKGFWVMGNAQGLQKLASLMITSCWGVTDVSLEAMGKGCTNLK  427

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCP  1019
              + L     + D+GL+  A+   SLE L L +C  ++  G++ +   C  L SLT+  C 
Sbjct  428   QMCLRRCCFLSDDGLVAFAKSAGSLECLQLEECNRVTQSGIIRVLSNC-GLKSLTLVKCL  486

Query  1020  NIGNEGLRA-IGRYCTKLQCLTIKDCPLVG  1106
              I +  L A +   C  L+ L++++CP  G
Sbjct  487   GIKDMSLGAPLSSTCNSLKSLSVRNCPGFG  516



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   375 bits (963),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 213/323 (66%), Positives = 253/323 (78%), Gaps = 24/323 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSA---DLGLMLSLGHADVYCPSRKRARITGPFVVE----V  401
             MPTLVNYSGDD+F +G S  S+   DLG +LS+G ++ Y PS KRARI+  F +      
Sbjct  1     MPTLVNYSGDDEFYSGGSCYSSSPMDLGCLLSVG-SNAYPPS-KRARISSQFDIRGSSFE  58

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             QEKK SIE LP+ECLFEIFRRL GG+ER + A VSK+WLML+SS+R SE           
Sbjct  59    QEKKASIEVLPEECLFEIFRRLHGGKERITCASVSKKWLMLLSSIRPSE-----------  107

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                K    S+D EM+  DED + E DG+L+RS+EGKKATDVRLAAIAVGTSSRGGLGKL 
Sbjct  108   ---KEIPKSDDTEMTTGDED-QKETDGFLTRSLEGKKATDVRLAAIAVGTSSRGGLGKLS  163

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS  G+TN+G+SA+ RGCPSLK LSLWNV ++GDEGL+EIA+ CP LEKLDLCQCP
Sbjct  164   IRGSNSFHGVTNLGLSAVARGCPSLKALSLWNVSSIGDEGLIEIAKGCPLLEKLDLCQCP  223

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             SIS+KGL+AIAE C NLT+L IESCP IGNEGL+AIG+ C+KLQ ++IKDC LVGD GV+
Sbjct  224   SISSKGLIAIAENCPNLTALNIESCPQIGNEGLQAIGKSCSKLQSISIKDCVLVGDHGVS  283

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSSAS+ LTKVKL ALNITDF
Sbjct  284   SLLSSASSALTKVKLQALNITDF  306


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 80/167 (48%), Gaps = 29/167 (17%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
              S RG T+V + AIG+GC +LK + L     V D GLL  ++   SLE L L +C  ++ 
Sbjct  352   TSCRGTTDVSLEAIGKGCTNLKQMCLRKCCFVSDNGLLAFSKAVGSLESLQLEECNRVTQ  411

Query  954   KGLVA----------------------------IAERCTNLTSLTIESCPNIGNEGLRAI  1049
              G++A                            ++  CT+L SL+I +CP  G+  L  +
Sbjct  412   SGIIAALSNCGAKLRSLTLVKCMGIKDIVAGEPMSSPCTSLRSLSIRNCPGFGSASLAVV  471

Query  1050  GRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             G+ C +L+ + +     + D G+ SLL S    L K+ L   +N+TD
Sbjct  472   GKLCPQLRTVDLSGLYAMTDAGILSLLESLEDGLVKLNLSGCVNLTD  518



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   372 bits (954),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 244/324 (75%), Gaps = 16/324 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHA--DVYCPSRKRARITGPFVVEV---  401
             MP LVNYSGDD+   G+S      DLG M +LG +    YC   KRARI  P + E    
Sbjct  1     MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  402   -QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  578
              +++KP+IE LP+ECLFEIFRRLS G+ERSS +CVSKRWLMLMS +  +EI++S++  + 
Sbjct  61    RKDQKPAIEVLPNECLFEIFRRLSSGKERSSCSCVSKRWLMLMSRICKAEIYKSENLTEG  120

Query  579   SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
             S       AS DVEM+  DEDL +E DGYLSR +EGKKATDVRLAAIAVGTS+RGGLGKL
Sbjct  121   S-------ASCDVEMASVDEDLVIEDDGYLSRCLEGKKATDVRLAAIAVGTSARGGLGKL  173

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RG+NSARG+T+VG+SA+  GCPSL+  SLWNV +VGDEGL EIA+ C  LEKLD+CQ 
Sbjct  174   SIRGNNSARGVTDVGLSAVAHGCPSLRSFSLWNVSSVGDEGLSEIAKGCHMLEKLDICQA  233

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
              SISNK L+AIA+ C NLT+L IESCP IGNEGL+AI R C KL+C++IKDCPLVGD G 
Sbjct  234   SSISNKSLIAIAKGCPNLTTLNIESCPEIGNEGLQAIARSCPKLKCISIKDCPLVGDHG-  292

Query  1119  asllssasavlTKVKLHALNITDF  1190
              S L S++  L+++KL  LNITDF
Sbjct  293   VSSLLSSANNLSRLKLQDLNITDF  316


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 70/152 (46%), Gaps = 28/152 (18%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL     +S RG+T+  I AIG+GC  LK + +     V D+GL+   +   SLE L
Sbjct  352   GLQKLMSLTVSSCRGVTDASIEAIGKGCIHLKQMLMRRCCLVSDKGLVAFGKAASSLESL  411

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C SI+  G+                            V++   C +L  L+I +CP
Sbjct  412   QLEECNSITQFGIIGALSNFKTTLKYLTLLKCKGVKDIDAEVSMLSPCESLQHLSIRNCP  471

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              +GN  L  +G+ C +LQC+ +     V D G
Sbjct  472   GVGNASLTMVGKLCPQLQCVDLTGLYGVTDAG  503



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   367 bits (943),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 243/323 (75%), Gaps = 7/323 (2%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLGHA-DVYCPSRKRARITGPFVV---EVQ  404
             MPTLVNY G+D F  G SLC  S DL  + S+G + D+Y P  KRARI GP+ V   E +
Sbjct  1     MPTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  60

Query  405   EKKPS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
              ++PS I  LPDECLFEIFRRL GGRERS+ ACVSK WL L+SS+R +EI          
Sbjct  61    GERPSSIGELPDECLFEIFRRLPGGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKE  120

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
               +    +S DV+M   D    +E DGYL+R +EGKKATDVRLAA+AVGT+ RGGLGKL 
Sbjct  121   DEEMKTSSSGDVQMVSCDVSGGLEEDGYLTRCLEGKKATDVRLAAVAVGTNGRGGLGKLS  180

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG++S RG+TN+GISAI RGCPSL+ LSLWN+ ++GD+GL+EIA+EC  LEKLDL  CP
Sbjct  181   IRGTSSTRGVTNIGISAIARGCPSLRALSLWNLSSIGDDGLVEIAKECRLLEKLDLSHCP  240

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
              +SNKGL+AIAE C +L SL IESCP IGNEGL AIGR C +LQ ++IKDCPLVGD GVA
Sbjct  241   FVSNKGLIAIAENCRDLISLNIESCPKIGNEGLEAIGRCCPRLQSISIKDCPLVGDHGVA  300

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SL+SSAS+VL+K+KL  LNITDF
Sbjct  301   SLVSSASSVLSKIKLQGLNITDF  323


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 83/177 (47%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL K+      S  GIT++ ++AIG+GC +LK + L     V D GL+  +    SLE L
Sbjct  359   GLKKVSSLTIASCHGITDLSLAAIGKGCTNLKQMCLRKCLFVSDAGLIAFSGAVSSLEYL  418

Query  924   DLCQCPSISNKGLVAIAER----------------------------CTNLTSLTIESCP  1019
              + +   IS +G++ +                               C +L SL+I +CP
Sbjct  419   QVEELDRISLRGVIGVISNCEMKLKSLSIAKCMGIKDLLEGSLMLSSCASLRSLSIRNCP  478

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKL-HALNITD  1187
               G+  L  +G+ C  L+ + +     + D G++ LL ++ A L KV L + LNITD
Sbjct  479   GFGSASLAMVGKLCPHLEHIDLISLCGLTDAGLSPLLENSEAGLVKVNLSNCLNITD  535



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   366 bits (940),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 238/320 (74%), Gaps = 26/320 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EK  410
             MP LVNY GDD F  GS              H D YCP RKRAR++  F     E + E 
Sbjct  1     MPALVNYRGDDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFEFEN  46

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     +
Sbjct  47    QPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----E  102

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
              V   S+ VEM   DED     DGYL+R ++GKKATD+RLAAIAVGTS  GGLGKL +RG
Sbjct  103   VVASVSDHVEMVSCDED----GDGYLTRCLDGKKATDLRLAAIAVGTSGHGGLGKLSIRG  158

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             +    G+TN G+SAI RGCPSLK LSLWNVP+VGDEGLLEIA+EC  LEKL+LC CPSIS
Sbjct  159   NKYTHGVTNFGLSAIARGCPSLKSLSLWNVPSVGDEGLLEIAKECHLLEKLELCHCPSIS  218

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             N+ L+AIAE C NLTSL IESC  IGN+GL+AIG++C  LQCL+IKDCPLV DQG++SLL
Sbjct  219   NESLIAIAENCPNLTSLNIESCSKIGNDGLQAIGKFCRNLQCLSIKDCPLVRDQGISSLL  278

Query  1131  ssasavlTKVKLHALNITDF  1190
             SSAS+VLT+VKL ALNITDF
Sbjct  279   SSASSVLTRVKLQALNITDF  298


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 83/177 (47%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T+V + A+G+GC +LK + L     V D GL+  ++   SLE L
Sbjct  334   GLQKLVSLTIASGGGVTDVSLEAMGKGCLNLKQMCLRKCCFVSDNGLVAFSKAAGSLEIL  393

Query  924   DLCQCPSISNKGLVAI----AERCTNLT------------------------SLTIESCP  1019
              L +C  +S  G++ +    A +  +LT                        SL+I +CP
Sbjct  394   QLEECNRVSQSGILGVVSNSASKLKSLTLVKCMGIKDMATEMPMLSPNCSLRSLSIRNCP  453

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               GN  L  +G+ C +LQ + +     + D G+  LL S  A L KV L   LN+TD
Sbjct  454   GFGNASLAMLGKLCPQLQHVDLSGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTD  510



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   365 bits (936),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 239/320 (75%), Gaps = 4/320 (1%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEKK  413
             MPTLVNY G+D F  G SLC++ + L       D+Y P  KRARI GP+ V   E + + 
Sbjct  1     MPTLVNYGGEDQFFGGGSLCTSSIDLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEGEH  60

Query  414   PS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             PS I  LPDECLFEIFRRL  GRERS+ ACVSK WL L+SS+R +EI            +
Sbjct  61    PSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKEDEE  120

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
                 +S DVEM  +D    +E DGYL+R +EGKKATDVRLAA+AVGT+ RGGLGKL +RG
Sbjct  121   MKTSSSVDVEMVSSDVSGGLEGDGYLTRCLEGKKATDVRLAAVAVGTNGRGGLGKLSIRG  180

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             ++S RG+TN+GISAI RGCPSL+ LSLWN+ ++GD+GL+EIA+EC  L+KLDL QCP +S
Sbjct  181   TSSTRGVTNIGISAIARGCPSLRALSLWNLSSIGDDGLVEIAKECRLLKKLDLSQCPFVS  240

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             NKGL+AIAE C +L SL IESCP IGNEGL AIGR C +LQ ++IKDCPLVGD GVASL+
Sbjct  241   NKGLIAIAENCRDLISLNIESCPKIGNEGLEAIGRCCPRLQSISIKDCPLVGDHGVASLV  300

Query  1131  ssasavlTKVKLHALNITDF  1190
             SSAS+VL+K+KL  LNITDF
Sbjct  301   SSASSVLSKIKLQGLNITDF  320



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   365 bits (937),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 239/320 (75%), Gaps = 4/320 (1%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEKK  413
             MPTLVNY G+D F  G SLC++ + L       D+Y P  KRARI GP+ V   E + + 
Sbjct  1     MPTLVNYGGEDQFFGGGSLCTSSIDLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEGEH  60

Query  414   PS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             PS I  LPDECLFEIFRRL  GRERS+ ACVSK WL L+SS+R +EI            +
Sbjct  61    PSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKEDEE  120

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
                 +S DVEM  +D    +E DGYL+R +EGKKATDVRLAA+AVGT+ RGGLGKL +RG
Sbjct  121   MKTSSSVDVEMVSSDVSGGLEGDGYLTRCLEGKKATDVRLAAVAVGTNGRGGLGKLSIRG  180

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             ++S RG+TN+GISAI RGCPSL+ LSLWN+ ++GD+GL+EIA+EC  L+KLDL QCP +S
Sbjct  181   TSSTRGVTNIGISAIARGCPSLRALSLWNLSSIGDDGLVEIAKECRLLKKLDLSQCPFVS  240

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             NKGL+AIAE C +L SL IESCP IGNEGL AIGR C +LQ ++IKDCPLVGD GVASL+
Sbjct  241   NKGLIAIAENCRDLISLNIESCPKIGNEGLEAIGRCCPRLQSISIKDCPLVGDHGVASLV  300

Query  1131  ssasavlTKVKLHALNITDF  1190
             SSAS+VL+K+KL  LNITDF
Sbjct  301   SSASSVLSKIKLQGLNITDF  320


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 84/177 (47%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL K+      S  GIT++ ++AIG+GC +LK + +     V D GL+  +    SLE L
Sbjct  356   GLKKVSSLTIASCHGITDLSLAAIGKGCTNLKQMCIRKCLFVSDAGLIAFSGAVSSLEYL  415

Query  924   DLCQCPSISNKGLVAIAER----------------------------CTNLTSLTIESCP  1019
              + +   IS +G++ +                               CT+L SL+I +CP
Sbjct  416   QVEELDRISMRGVIGVISNCEMKLKSLSIAKCMGIKDLLEGSLMLSSCTSLRSLSIRNCP  475

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKL-HALNITD  1187
               G+  L  +G+ C  L+ + +     + D G++ LL ++ A L KV L + LNITD
Sbjct  476   GFGSASLAMVGKLCPHLEHIDLISLCGLTDAGLSPLLENSEAGLVKVNLSNCLNITD  532



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   367 bits (942),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 208/363 (57%), Positives = 253/363 (70%), Gaps = 33/363 (9%)
 Frame = +3

Query  120   SGLWIWNANLGRNPNLGCVDFAAKSNLF--CSLFGGFF*KETAMPTLVNYSGDDDFLAGS  293
             S + +++  L R    GC  F+    LF  CS           MP LVNY GDD F  GS
Sbjct  60    SSVLVFHLFLLRLVFFGCCFFSPARVLFSDCSPSA-----SATMPALVNYRGDDLFSIGS  114

Query  294   SLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EKKPSIEALPDECLFEIFR  461
                           H D YCP RKRAR++  F     E + E +PSI+ LPDECL+EIFR
Sbjct  115   --------------HVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFR  160

Query  462   RLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADED  641
             RL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     + V   S+ VEM   DED
Sbjct  161   RLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----EVVASVSDHVEMVSCDED  216

Query  642   LEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGR  821
                  DGYL+R ++GKKATD+RLAAIAVGTS  GGLGKL +RG+    G+TN G+SAI R
Sbjct  217   ----GDGYLTRCLDGKKATDLRLAAIAVGTSGHGGLGKLSIRGNKYTHGVTNFGLSAIAR  272

Query  822   GCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSL  1001
             GCPSLK LSLWNVP+VGDEGLLEIA+EC  LEKL+LC CPSISN+ L+AIAE C NLTSL
Sbjct  273   GCPSLKSLSLWNVPSVGDEGLLEIAKECHLLEKLELCHCPSISNESLIAIAENCPNLTSL  332

Query  1002  TIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNI  1181
              IESC  IGN+GL+AIG++C  LQCL+IKDCPLV DQG++SLLSSAS+VLT+VKL ALNI
Sbjct  333   NIESCSKIGNDGLQAIGKFCRNLQCLSIKDCPLVRDQGISSLLSSASSVLTRVKLQALNI  392

Query  1182  TDF  1190
             TDF
Sbjct  393   TDF  395


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 83/177 (47%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T+V + A+G+GC +LK + L     V D GL+  ++   SLE L
Sbjct  431   GLQKLVSLTIASGGGVTDVSLEAMGKGCLNLKQMCLRKCCFVSDNGLVAFSKAAGSLEIL  490

Query  924   DLCQCPSISNKGLVAI----AERCTNLT------------------------SLTIESCP  1019
              L +C  +S  G++ +    A +  +LT                        SL+I +CP
Sbjct  491   QLEECNRVSQSGILGVVSNSASKLKSLTLVKCMGIKDMATEMPMLSPNCSLRSLSIRNCP  550

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               GN  L  +G+ C +LQ + +     + D G+  LL S  A L KV L   LN+TD
Sbjct  551   GFGNASLAMLGKLCPQLQHVDLSGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTD  607



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   364 bits (934),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 249/323 (77%), Gaps = 17/323 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVV---EV-  401
             MP LVNYSGDDDF  G S    S DLG + S+    DVYCP RKR RI+ PF     EV 
Sbjct  1     MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q K+PSI+ LPDECL EIF+R+SGG+ERSS ACVSK WLML++S+R  E   SK      
Sbjct  61    QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSKV-----  115

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             + + V   S DVEM  ++ED     DGYL+R +EGKKATD+RLAA+AVGTS  GGLGKL 
Sbjct  116   VKENVGSNSGDVEMILSEED-----DGYLTRCLEGKKATDMRLAAVAVGTSGHGGLGKLS  170

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGS+S+RG+TN G+SA+ RGCPSLKVLSLWNVP VGDEGL EIA+EC  LEKLDLCQCP
Sbjct  171   IRGSSSSRGVTNFGLSAVARGCPSLKVLSLWNVPRVGDEGLCEIAKECHLLEKLDLCQCP  230

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
              +SNKGL+AIA  C NLT+L+I+SCP IGNEGL+AIG+ C KLQ ++IKDCPLVGD GV+
Sbjct  231   HLSNKGLIAIAANCPNLTALSIQSCPKIGNEGLQAIGKLCPKLQSISIKDCPLVGDHGVS  290

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSSAS+VL+KVKL  L+ITDF
Sbjct  291   SLLSSASSVLSKVKLQGLSITDF  313


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 76/150 (51%), Gaps = 11/150 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S +G        GL KL      S  G+T+V + AIG+GC +LK
Sbjct  322   GKSVTNLMLSGLQ-NVSEKGFWVMGNAQGLQKLVSFTIASCWGVTDVSLEAIGKGCANLK  380

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCP  1019
              + L     V  +GL+  A+   SLE L L +C  ++  G++ +   C  L SLT+  C 
Sbjct  381   QMCLRRCCFVSGDGLVAFAKSAGSLECLQLEECNRVTQSGVIGVLSNC-GLKSLTLVKCM  439

Query  1020  NIGNEGLRA-IGRYCTKLQCLTIKDCPLVG  1106
              I +  L A +   C  L+ L+I++CP  G
Sbjct  440   GIKDISLEAPLSSSCNSLKSLSIRNCPGFG  469



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   362 bits (930),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 209/323 (65%), Positives = 248/323 (77%), Gaps = 17/323 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVV---EV-  401
             MP LVNYSGDDDF  G S    S DLG + S+    DVYCP RKR RI+ PF     EV 
Sbjct  1     MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q K+PSI+ LPDECL EIF+R+SGG+ERSS ACVSK WLML++S+R  E   SK      
Sbjct  61    QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSKV-----  115

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             + +     S DVEM  ++ED     DGYL+R +EGKKATD+RLAA+AVGTS  GGLGKL 
Sbjct  116   VKENFGSNSGDVEMILSEED-----DGYLTRCLEGKKATDMRLAAVAVGTSGHGGLGKLS  170

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGS+S+RG+TN G+SA+ RGCPSLKVLSLWNVP VGDEGL EIA+EC  LEKLDLCQCP
Sbjct  171   IRGSSSSRGVTNFGLSAVARGCPSLKVLSLWNVPRVGDEGLCEIAKECHLLEKLDLCQCP  230

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
              +SNKGL+AIA  C NLT+L+I+SCP IGNEGL+AIG+ C KLQ ++IKDCPLVGD GV+
Sbjct  231   HLSNKGLIAIAANCPNLTALSIQSCPKIGNEGLQAIGKLCPKLQSISIKDCPLVGDHGVS  290

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSSAS+VL+KVKL  L+ITDF
Sbjct  291   SLLSSASSVLSKVKLQGLSITDF  313


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 92/203 (45%), Gaps = 36/203 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S +G        GL KL      S  G+++V + AIG+GC +LK
Sbjct  322   GKSVTNLMLSGLQ-NVSEKGFWVMGNAQGLQKLVSFTIASCWGVSDVSLEAIGKGCANLK  380

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              + L     V  +GL+  A+   SLE L L +C  ++  G++ +                
Sbjct  381   QMCLRRCCFVSGDGLVAFAKSAGSLECLQLEECNRVTQSGVIGVLSNCGLKSLTLVKCMG  440

Query  972   ----------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
                       +  C +L SL+I +CP  G   L  +GR C +LQ + +     + D G+ 
Sbjct  441   IKDISLEAPLSSSCNSLKSLSIRNCPGFGTASLAMVGRLCPQLQHVDLSGLCAITDAGLL  500

Query  1122  sllssasavlTKVKLHA-LNITD  1187
              LL +  A L KV L   LN+TD
Sbjct  501   PLLENCEAGLVKVNLSGCLNLTD  523



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   359 bits (922),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 197/320 (62%), Positives = 237/320 (74%), Gaps = 27/320 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EK  410
             MP LVNY  DD F  GS              H D YCP RKRAR++  F     E + E 
Sbjct  1     MPALVNYR-DDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFEFEN  45

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     +
Sbjct  46    QPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----E  101

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
              V   S+ VEM   DED     DGYL+R ++GKKATD+RLAAIAVGTS  GGLGKL +RG
Sbjct  102   VVASVSDHVEMVSCDED----GDGYLTRCLDGKKATDLRLAAIAVGTSGHGGLGKLSIRG  157

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             +    G+TN G+SAI RGCPSLK LSLWNVP+VGDEGLLEIA+EC  LEKL+LC CPSIS
Sbjct  158   NKYTHGVTNFGLSAIARGCPSLKSLSLWNVPSVGDEGLLEIAKECHLLEKLELCHCPSIS  217

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             N+ L+AIAE C NLTSL IESC  IGN+GL+AIG++C  LQCL+IKDCPLV DQG++SLL
Sbjct  218   NESLIAIAENCPNLTSLNIESCSKIGNDGLQAIGKFCRNLQCLSIKDCPLVRDQGISSLL  277

Query  1131  ssasavlTKVKLHALNITDF  1190
             SSAS+VLT+VKL ALNITDF
Sbjct  278   SSASSVLTRVKLQALNITDF  297


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 83/177 (47%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T+V + A+G+GC +LK + L     V D GL+  ++   SLE L
Sbjct  333   GLQKLVSLTIASGGGVTDVSLEAMGKGCLNLKQMCLRKCCFVSDNGLVAFSKAAGSLEIL  392

Query  924   DLCQCPSISNKGLVAI----AERCTNLT------------------------SLTIESCP  1019
              L +C  +S  G++ +    A +  +LT                        SL+I +CP
Sbjct  393   QLEECNRVSQSGILGVVSNSASKLKSLTLVKCMGIKDMATEMPMLSPNCSLRSLSIRNCP  452

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               GN  L  +G+ C +LQ + +     + D G+  LL S  A L KV L   LN+TD
Sbjct  453   GFGNASLAMLGKLCPQLQHVDLSGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTD  509



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   358 bits (919),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 209/323 (65%), Positives = 241/323 (75%), Gaps = 25/323 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             MP LVNY GDDDF +G S    S DLG + S+    DVY P RKRARIT PFVV      
Sbjct  1     MPALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q K+ SI+ LPDECLFEIF+RL GGRERSS ACVSK WLML+ S+R  E   SK+ ++  
Sbjct  61    QSKQASIDVLPDECLFEIFKRLPGGRERSSCACVSKHWLMLLISIRKGEYESSKAVKE--  118

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                     + D   S +DED     DGYL+R +EGKKATD+RLAA+AVGTS  GGLGKL 
Sbjct  119   --------NTD---SVSDED-----DGYLTRCLEGKKATDMRLAAVAVGTSGHGGLGKLS  162

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGS+S+ G+TN G+SAI RGCPSLK LSLWNVP VGDEGL EIA+EC  LEKLDLCQCP
Sbjct  163   IRGSSSSSGVTNFGLSAIARGCPSLKALSLWNVPRVGDEGLSEIAKECHLLEKLDLCQCP  222

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             S SNKGL+AIAE C NLTSL+IESCP IGNEGL+AIG+ C KLQ ++IKDC LVGD GV+
Sbjct  223   SFSNKGLIAIAENCPNLTSLSIESCPKIGNEGLQAIGKLCPKLQSVSIKDCLLVGDHGVS  282

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLSS S+VL+KVK   LNITDF
Sbjct  283   SLLSSTSSVLSKVKFQGLNITDF  305


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 94/202 (47%), Gaps = 35/202 (17%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S +G        GL KL      S RG+T+V + A+G+GC +L+
Sbjct  314   GKSVTNLMLSGLE-NVSEKGFWVMGNAQGLQKLVSLTIISCRGVTDVSLEAMGKGCANLR  372

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-----------  986
              + L     + D+GL+  A+   SLE L L +C  I+  G + +   C+           
Sbjct  373   QMCLRRCCFISDDGLVAFAKSAGSLESLQLEECNRITQSGTIGVLSNCSLKSLTVVKCMG  432

Query  987   --------------NLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
                           +L SL++ +CP  G  GL  +GR C +LQ + +     + D G+  
Sbjct  433   IKDISSEVPLSCCNSLKSLSVRNCPGFGTAGLAVVGRLCPQLQHVDLSGLCGITDAGLLP  492

Query  1125  llssasavlTKVKLHA-LNITD  1187
             LL S  A L KV L   LNITD
Sbjct  493   LLESCEAGLVKVNLSGCLNITD  514



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   358 bits (918),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 239/322 (74%), Gaps = 13/322 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE----V  401
             M  L  ++GDDDF  G S+ +   +LGL LSLGH  DVY PSRKR+RI  PFV       
Sbjct  1     MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             ++K+ SIE LPDECLFEIFRRL G  ERS+ A VSKRWL L+S++   E+   K+ Q L 
Sbjct  61    KKKQASIEVLPDECLFEIFRRLPG-EERSACAGVSKRWLGLLSNLSRDELCSKKTTQLLD  119

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
              + K N     VE+    ED E+E DGYLSRS+EGKKATD+RLAAIAVGT++RGGLGKL 
Sbjct  120   ESAKKN-----VEVKSEAEDQEIEGDGYLSRSLEGKKATDIRLAAIAVGTATRGGLGKLS  174

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS+ G+T VG+ AI RGCPSL+ LSLWN+P V DEGL EIA  C  LEKLDLC CP
Sbjct  175   IRGSNSSCGVTAVGLRAIARGCPSLRALSLWNLPFVSDEGLFEIANGCHMLEKLDLCGCP  234

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+KGL+AIA+ C NLT LTIESC  IGNEGL+A+G+YCT L+ ++IKDC  VGDQG++
Sbjct  235   AISDKGLLAIAKNCPNLTDLTIESCAKIGNEGLQAVGQYCTNLKSISIKDCSAVGDQGIS  294

Query  1122  sllssasavlTKVKLHALNITD  1187
              L+SS +  LTKVKL ALNITD
Sbjct  295   GLVSSTTYYLTKVKLQALNITD  316


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 91/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  +D+ L  +    S RG        GL KL      S RG+T+ G+ A+G+GCP+L+
Sbjct  326   GKAVSDIVLTNLP-NVSERGFWVMGKGHGLQKLKSFTVTSCRGVTDAGLEAVGKGCPNLR  384

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG-----------LVAIA----  974
                L     + D GL+   +   SLE L L +C  I+  G           L A+A    
Sbjct  385   QFCLRKCTFLSDNGLVSFVKAAGSLESLQLEECHRITQLGFFGSILNCGAKLKALALVNC  444

Query  975   -------------ERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL I +CP  G+  L  +G+ C +LQ + +     V D G
Sbjct  445   LGIRDLNLGSPQLSPCESLRSLIIRNCPGFGDASLSLLGKLCPQLQHVELSGLQGVTDAG  504

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  LL S  A + KV L   LN++D
Sbjct  505   LIPLLDSCGAGMVKVNLSGCLNLSD  529



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   357 bits (917),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 237/304 (78%), Gaps = 11/304 (4%)
 Frame = +3

Query  309   DLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ----EKKPSIEALPDECLFEIFRRLSG  473
             D GL++S+G   DVYCP RKR+RIT P++        EK+PSI+ LPDECLFEI RRL G
Sbjct  2     DSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLPG  61

Query  474   GRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG-----ASNDVEMSPADE  638
             G+ERSS A VSKRWLML+SS+R +EI   KS Q L+ + K++        +D+EM  A E
Sbjct  62    GQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLNESSKLDKELTIPVPDDIEMISA-E  120

Query  639   DLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIG  818
             D E+  DGYL+R +EGKKATD+ LAAIAVGTSSRGGLGKL +R S+S+RG+TN+G+S I 
Sbjct  121   DRELGSDGYLTRCLEGKKATDISLAAIAVGTSSRGGLGKLSIRESSSSRGVTNLGLSKIA  180

Query  819   RGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTS  998
              GCPSL+VLSLWNV  VGDEGL EI   C  LEKLDLCQCP IS+KGL+AIA+ C NLT+
Sbjct  181   HGCPSLRVLSLWNVSAVGDEGLFEIGNGCHMLEKLDLCQCPXISDKGLIAIAKNCPNLTA  240

Query  999   LTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALN  1178
             LTIESC NIGNE L+AIG  C KLQ ++IKDCPLVGDQGVA LLSSA+++L++VKL +LN
Sbjct  241   LTIESCANIGNESLQAIGSLCPKLQSISIKDCPLVGDQGVAGLLSSATSILSRVKLQSLN  300

Query  1179  ITDF  1190
             ITDF
Sbjct  301   ITDF  304


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 81/177 (46%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL  L      S RGIT+V + A+G+GCP+LK + L     V D GL+  A+   SLE L
Sbjct  340   GLQTLISLTITSCRGITDVSLEAMGKGCPNLKQMCLRKCCFVSDNGLIAFAKAAGSLEGL  399

Query  924   DLCQCPSISNKGLVA----------------------------IAERCTNLTSLTIESCP  1019
              L +C  ++  G++                             +   C +L SL+I +CP
Sbjct  400   QLEECNRVTQLGVIGSLSNCGSKLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCP  459

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               G+  L  +G+ C +L  + +     + D G+  LL S  A L KV L   LN+TD
Sbjct  460   GFGSASLAMVGKLCPQLHHVDLSGLDGMTDAGLLPLLESCEAGLAKVNLSGCLNLTD  516



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 197/325 (61%), Positives = 243/325 (75%), Gaps = 17/325 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  404
             M  L ++SG DDF  G S+     +  L LSLG H DVY PSRKR+RI+ PFV      +
Sbjct  1     MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  405   EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             +KKPSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL ++S++R+ EI  +K+ Q L +
Sbjct  61    QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSDEISDNKTTQALDL  120

Query  585   ----ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLG  752
                  DK  G  +DVE    DED+     GYLSRS+EGKKATDVRLAAIAVGT+ RGGLG
Sbjct  121   NYESTDKKGGDVSDVE----DEDVA---GGYLSRSLEGKKATDVRLAAIAVGTAGRGGLG  173

Query  753   KLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLC  932
             KL +RGSNS+RG+T VG+ AI RGCPSL+VLSLWN+  VGD+GL EIA  C  L+KLDLC
Sbjct  174   KLFIRGSNSSRGVTTVGLRAISRGCPSLRVLSLWNLATVGDDGLCEIAEGCHQLQKLDLC  233

Query  933   QCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
              CP+I+N+ L+A+A+ C +LT LTIE C NIGNEG++AI R C  L+ ++IKDC L+GDQ
Sbjct  234   HCPAITNESLLALAKGCPDLTDLTIEGCANIGNEGIQAIARCCPNLKSVSIKDCALLGDQ  293

Query  1113  GvasllssasavlTKVKLHALNITD  1187
             G+ASLL+S S  L+K+KL ALNITD
Sbjct  294   GIASLLTSTSYSLSKLKLQALNITD  318


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 64/138 (46%), Gaps = 28/138 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      +  G+T++G+ AIG+GCP+LK   L     + D GL+  A+   SLE L
Sbjct  355   GLQKLKSFTVKACCGVTDLGLEAIGKGCPNLKQFCLRKCAFLSDNGLVSFAKAAGSLESL  414

Query  924   DLCQCPSISNKGL-------------------VAIAER---------CTNLTSLTIESCP  1019
             +L +C  ++  G                    + I +          C +L SL+I +C 
Sbjct  415   ELEECHWVTQFGFFGSLINCGAKFKSISLVNCLGIKDLNVGLPPLPPCESLRSLSIRNCQ  474

Query  1020  NIGNEGLRAIGRYCTKLQ  1073
               G+  L A+G+ C +LQ
Sbjct  475   GFGDASLAALGKLCPQLQ  492


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 73/138 (53%), Gaps = 9/138 (7%)
 Frame = +3

Query  720   AVGTSSRGGLGKLCVRGSN----SARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGL  884
               G +S   LGKLC +  N       GIT+VG   +   C + L  ++L   PN+G++ +
Sbjct  475   GFGDASLAALGKLCPQLQNVELSGLHGITHVGFFPLLESCEAGLVKVNLSGCPNLGNKVV  534

Query  885   LEIAR-ECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRY-  1058
              ++A     +LE L+L  C  IS+ GLVAIAE C  L+ L +  C  I + G+ A+ R  
Sbjct  535   CKMADLHGWTLEMLNLDGC-KISDAGLVAIAENCQLLSDLDVSKC-TITDSGIAALARSN  592

Query  1059  CTKLQCLTIKDCPLVGDQ  1112
                LQ L++  C LV D+
Sbjct  593   LINLQILSVSGCNLVSDK  610



>ref|XP_012076562.1| PREDICTED: EIN3-binding F-box protein 1 [Jatropha curcas]
 gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   354 bits (909),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 245/322 (76%), Gaps = 19/322 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             M  L  ++GDDDF  G  + +   +  L+LSLG H DVY PSRKR+RI+ PFV+      
Sbjct  1     MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL L+S++   E+   K+ Q L+
Sbjct  61    QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLALLSNMSRDELCSKKTTQLLN  120

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
              + + NG +         EDLE+E DGYLSRS+EGKKATD+ LAAIAVGTSSRGGLGKL 
Sbjct  121   ESAEKNGEA---------EDLEIEDDGYLSRSLEGKKATDIGLAAIAVGTSSRGGLGKLS  171

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGS   RG+T+VG+ AI RGCPSL+ LSLWN+P+VG+EGL EIA  C  LEKLDLC CP
Sbjct  172   IRGS---RGVTSVGLRAIARGCPSLRALSLWNLPSVGNEGLFEIANGCHMLEKLDLCGCP  228

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+KGL+AIA+ C NLT LTIESC NIGN+GL+AIG+ C  L+ ++IKDCP+VGDQG+A
Sbjct  229   AISDKGLLAIAKSCPNLTELTIESCANIGNDGLQAIGQCCNNLKSISIKDCPVVGDQGIA  288

Query  1122  sllssasavlTKVKLHALNITD  1187
             SL+SSA+ VL K+KL +LNITD
Sbjct  289   SLVSSATCVLAKLKLQSLNITD  310


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 91/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ +  +    + RG        GL KL      S RG+T+ GI A+G+GCP+L+
Sbjct  320   GKAVTDLVITNLP-NVTERGFWVMGNGHGLQKLKSFAVTSCRGVTDAGIEAMGKGCPNLR  378

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
                L     + D GL+   +   SLE L L +C  I+  G                    
Sbjct  379   HFCLRKCVFLSDNGLVSFVKAAQSLEVLQLEECHRIAQLGFFGSLLNSGSKLKALSLVNC  438

Query  963   VAIAER---------CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + I E          C +L SL+I +CP  G+ GL  +G+ C +LQ L +     V D G
Sbjct  439   MGIRELNLRLPQVPPCNSLRSLSIRNCPGFGDGGLALLGKLCPQLQNLELSGLHGVTDAG  498

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                LL +  A L KV L   +N+TD
Sbjct  499   FIPLLENCEAGLVKVNLSGCVNLTD  523



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score =   354 bits (909),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 192/321 (60%), Positives = 237/321 (74%), Gaps = 17/321 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  407
             MP LVNYSGDD+F    +  S +LG + S+   ADVY P  KR RI+ PF+       Q 
Sbjct  1     MPALVNYSGDDEFFIRKN--SIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQN  58

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             K+PSI  LP EC+FEIF+RL  GRERS  ACVSKRWL L+SS+R  E   SK      + 
Sbjct  59    KQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGEYGSSKV-----VK  113

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
             + ++  S  +E   ++E+      GYL+R +EGKKATDVRLAA+AVGTS RGGLGKL +R
Sbjct  114   ENIDSVSYAIETISSNEN-----GGYLTRCLEGKKATDVRLAAVAVGTSGRGGLGKLSIR  168

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GSNS+ G+TN G+S+I RGCPSLK LSLWNVP+VGD GL EIA+EC  LEKLDLCQCP++
Sbjct  169   GSNSSCGVTNFGLSSIARGCPSLKSLSLWNVPHVGDVGLYEIAKECHLLEKLDLCQCPAV  228

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             S+KGL+AIAE C NLT+L+IESCP IGNE L+A+G+ C KLQ ++IKDCPLVGD GV+SL
Sbjct  229   SSKGLIAIAENCLNLTALSIESCPKIGNESLQAVGKLCPKLQSISIKDCPLVGDHGVSSL  288

Query  1128  lssasavlTKVKLHALNITDF  1190
              S AS+VL+KVKL  L I+DF
Sbjct  289   FSLASSVLSKVKLEGLKISDF  309


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 97/218 (44%), Gaps = 41/218 (19%)
 Frame = +3

Query  639   DLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGIT  794
             D  +   GY      GK  T++ L+ +    S +G        GL KL      S  G+T
Sbjct  308   DFSLSVIGYY-----GKSVTNLMLSGLR-NVSEKGFWVMGNAQGLQKLVSLMLTSCPGLT  361

Query  795   NVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA--  968
             +V + A+G+GC +LK + L +   V D+GLL  ++   SLE L L +C  ++  G++   
Sbjct  362   DVSLEAMGKGCANLKQMCLRSCRFVSDDGLLAFSKSQGSLECLQLEECNKVTQSGIIGFL  421

Query  969   ------------------------IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQC  1076
                                     ++  C +L SL++++CP  G   L  +G  C +LQ 
Sbjct  422   SNCGLKSLALVKCMGIRDVSLDTPLSSPCNSLKSLSVKNCPGFGTASLAMVGNLCPQLQH  481

Query  1077  LTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             + +     + D G+  LL S    L KV L   LN+TD
Sbjct  482   VDLSGLYGITDAGLLPLLESCREGLAKVNLSGCLNLTD  519



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score =   354 bits (909),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 238/321 (74%), Gaps = 17/321 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  407
             MP LVNYSGDDDF    +  S +LG + S+   ADVY P  KR RI+ PF+       Q 
Sbjct  1     MPALVNYSGDDDFFIRKN--SIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQN  58

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             K+PSI  LP EC+FEIF+RL  GRERS  ACVSKRWL L+SS+R  E +RS +     + 
Sbjct  59    KQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGE-YRSSN----VVK  113

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
             + ++  S  +E   ++E+      GYL+R +EGKKATDVRLAA+AVGTS RGGLGKL +R
Sbjct  114   ENIDSVSYAIETISSNEN-----GGYLTRCLEGKKATDVRLAAVAVGTSGRGGLGKLSIR  168

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GSNS+ G+TN G+S+I RGCPSLK LSLWNVP+VGD GL EIA+EC  LEKLDLCQCP++
Sbjct  169   GSNSSCGVTNFGLSSIARGCPSLKSLSLWNVPHVGDVGLYEIAKECHLLEKLDLCQCPAV  228

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             S+KGL+AIAE C NLT+L IESCP IGNE L+A+G+ C KLQ ++IKDCPLVGD GV+SL
Sbjct  229   SSKGLIAIAENCLNLTALRIESCPKIGNESLQAVGKLCPKLQSISIKDCPLVGDHGVSSL  288

Query  1128  lssasavlTKVKLHALNITDF  1190
              S AS+VL+KVKL  L I+DF
Sbjct  289   FSLASSVLSKVKLEGLKISDF  309


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 98/218 (45%), Gaps = 41/218 (19%)
 Frame = +3

Query  639   DLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGIT  794
             D  +   GY      GK  T++ L+ +    S +G        GL KL      S RG+T
Sbjct  308   DFSLSVIGYY-----GKSVTNLMLSGLG-NVSEKGFWVMGNAQGLQKLVSLMITSCRGLT  361

Query  795   NVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA--  968
             +V + A+G+GC +LK + L +   V D+GLL  ++   SLE L L +C  ++  G++   
Sbjct  362   DVSLEAMGKGCANLKQMCLRSCRFVSDDGLLAFSKAQGSLECLQLEECNKVTQSGIIGFL  421

Query  969   ------------------------IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQC  1076
                                     ++  C +L SL++++CP  G   L  +G  C +LQ 
Sbjct  422   SNCGLKSLALVKCMGIRDISLDTPLSSPCNSLKSLSVKNCPGFGTASLAMVGNLCPQLQH  481

Query  1077  LTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             + +     + D G+  LL S    L KV L   LN+TD
Sbjct  482   VDLSGLYGITDAGLLPLLESCKEGLAKVNLSGCLNLTD  519



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 197/325 (61%), Positives = 246/325 (76%), Gaps = 17/325 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  404
             M  L ++SG DDF  G S+ +   +  L LSLG H DVY PSRKR+RI+ PFV      +
Sbjct  1     MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  405   EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             +KKPSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL ++S++R++EI  +K+ Q L +
Sbjct  61    QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSNEISDNKTTQALDL  120

Query  585   ----ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLG  752
                  DK  G  ++VE    DED+     GYLSRS+EGKKATDVRLAAIAVGT+ RGGLG
Sbjct  121   NYESTDKKGGDVSEVE----DEDVA---GGYLSRSLEGKKATDVRLAAIAVGTAGRGGLG  173

Query  753   KLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLC  932
             KL +RGSNS+RG+T VG+ AI RGCPSL+VLSLWN+  VGD GL EIA  C  L+KLDLC
Sbjct  174   KLFIRGSNSSRGVTAVGLRAISRGCPSLRVLSLWNLATVGDGGLCEIAEGCHQLQKLDLC  233

Query  933   QCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
              CP+I+N+ L+++A+ C +LT LTIE C NIGNEG++AI R C  L+ ++IKDCPL+GDQ
Sbjct  234   HCPAITNESLLSLAKGCPDLTDLTIEGCANIGNEGIQAIARCCPNLKSVSIKDCPLLGDQ  293

Query  1113  GvasllssasavlTKVKLHALNITD  1187
             G+ASLL+SAS  L+K+KL ALNITD
Sbjct  294   GIASLLTSASYSLSKLKLQALNITD  318


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 77/166 (46%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    + +G        GL KL      + RG+T++G+ AIG+GCP+LK
Sbjct  328   GKAVTDLSLTSLP-NVTEKGFWVMGNGHGLQKLKSFTVKACRGVTDLGLEAIGKGCPNLK  386

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV-----------AIA----  974
                L     + D GL+  A+   SLE L+L +C  ++  G             AI+    
Sbjct  387   QFCLRKCAFLSDNGLVSFAKAAGSLESLELEECHRVTQFGFFGSLINCGAKFKAISLMNC  446

Query  975   -------------ERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                            C +L SL+I +CP  G+  L A+G+ C +LQ
Sbjct  447   LGIKDLNVGLPPLPPCESLRSLSIRNCPGFGDASLAALGKLCPQLQ  492


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 72/138 (52%), Gaps = 9/138 (7%)
 Frame = +3

Query  720   AVGTSSRGGLGKLCVRGSN----SARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGL  884
               G +S   LGKLC +  N       GIT+VG   +   C + L  ++L   PN+GD+ +
Sbjct  475   GFGDASLAALGKLCPQLQNVELSGLHGITDVGFLPLLESCEAGLVKVNLSGCPNLGDKVV  534

Query  885   LEIAR-ECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG-RY  1058
              ++A     +LE L+L  C  +S+ GLVAIAE C  L+ L +  C  I + G+ A+    
Sbjct  535   CKMADLHGWTLEMLNLDGC-KVSDAGLVAIAENCRVLSDLDVSKC-TITDSGIAALACSN  592

Query  1059  CTKLQCLTIKDCPLVGDQ  1112
                LQ L++  C LV D+
Sbjct  593   LINLQILSVSGCNLVSDK  610



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   353 bits (907),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 234/324 (72%), Gaps = 16/324 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHA--DVYCPSRKRARITG----PFVVE  398
             MPTLVNYSGDD+   G S C    DLG + + G    + Y    KRARI       F+  
Sbjct  1     MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPSKRARINALDAFEFLGR  60

Query  399   VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  578
              Q++KP+I+ LPDECLFE+FR LS G+ERSS A VSKRWLMLMSS+  +EI +S    + 
Sbjct  61    EQDQKPTIDVLPDECLFEVFRWLSSGKERSSCAYVSKRWLMLMSSICKAEIHKSDKMIEG  120

Query  579   SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
             S       AS  VEM+  DED  +E +GYL+R +EGKKAT+VRLAAIAVGTS+RGGLGKL
Sbjct  121   S-------ASGYVEMASVDEDQGIEDNGYLTRCLEGKKATNVRLAAIAVGTSARGGLGKL  173

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RGSNS RG+T+VG+SA+  GCPSL+  SLWNV +VGDEGL EIA+ C  LEKLD+CQ 
Sbjct  174   SIRGSNSVRGVTDVGLSAVAHGCPSLRSFSLWNVSSVGDEGLSEIAKGCHMLEKLDICQA  233

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
               ISNK L+AIA+ C NLT+L IESCP IGNEGL+AI R C KLQC++IKDCPLVGD G 
Sbjct  234   SFISNKSLIAIAKGCPNLTTLNIESCPKIGNEGLQAIARSCPKLQCISIKDCPLVGDHG-  292

Query  1119  asllssasavlTKVKLHALNITDF  1190
              S L S++  L+KVKL  LNITDF
Sbjct  293   VSSLLSSAIHLSKVKLQDLNITDF  316


 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 64/137 (47%), Gaps = 28/137 (20%)
 Frame = +3

Query  747   LGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLD  926
             L KL     +S RGIT+  I A+G+GC +LK + L     V D GL+  ++   SLE L 
Sbjct  353   LQKLMSLTVSSCRGITDASIEAMGKGCVNLKQMFLRRCCFVSDNGLVAFSKVASSLESLH  412

Query  927   LCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCPN  1022
             L +C +I+  G+                            V++   C +L  L+I +CP 
Sbjct  413   LEECNNINQFGIICALSNFKSTLKSLTLLKCKGVKDIDLEVSMFPPCESLRHLSIHNCPG  472

Query  1023  IGNEGLRAIGRYCTKLQ  1073
             +GN  L  +G+ C +LQ
Sbjct  473   VGNASLAMVGKLCPQLQ  489



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   352 bits (902),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 244/322 (76%), Gaps = 17/322 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  404
             M  L+ ++G+DDF  G S+ +   +  L LS G HADV+   RKR+RI+GPFV      +
Sbjct  1     MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  405   EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             +KKP SI+ LPDECLFEIF+RL GG ERS+ ACVSKRWL L+S++   E   + ++  L+
Sbjct  61    QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKRWLTLLSNIHRDEFCSNTTNLLLN  120

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
               D+V G          ++D EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL 
Sbjct  121   PQDEVTG----------NKDQEVESCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLT  170

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS RG+TN+G+ AI  GCPSL+VLSLWNV ++GDEGL EIA  C  LEKLDL QCP
Sbjct  171   IRGSNSGRGVTNLGLRAISHGCPSLRVLSLWNVSSIGDEGLCEIANRCHMLEKLDLSQCP  230

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+KGLVAIA++C NLT L++ESC NIGNEGL+AIG+ C  L+ ++IK+CPLVGDQG+A
Sbjct  231   AISDKGLVAIAKKCPNLTDLSLESCSNIGNEGLQAIGQCCPNLKSISIKNCPLVGDQGIA  290

Query  1122  sllssasavlTKVKLHALNITD  1187
             SLLSS S VLTKVKL AL ITD
Sbjct  291   SLLSSVSYVLTKVKLQALAITD  312


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 92/204 (45%), Gaps = 37/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L +I    + RG        GL KL      S +G+T+ G+ A+G+GCP+LK
Sbjct  322   GKAITDLVLTSIP-NVTERGFWVMGNGHGLQKLKSFTVTSCQGVTDTGLEAVGKGCPNLK  380

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG----------LVAIA-----  974
                L     + D GL+   +   SLE L L +C  I+  G          L A+A     
Sbjct  381   QFCLRKCLFISDSGLVSFCKAAGSLESLHLEECHRITQYGFFGALSTGAKLKAVAFVYCL  440

Query  975   ------------ERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
                           C +L SL+I +CP  GN GL  +GR C +LQ +       + D G 
Sbjct  441   GLKDLNLGLPEVSPCQSLRSLSIRNCPGFGNAGLALLGRLCPQLQHVDFSGLEGITDAGF  500

Query  1119  asllssasavlTKVKLHA-LNITD  1187
               LL +  A L KV L   +N+TD
Sbjct  501   LPLLENCEAGLVKVNLSGCVNVTD  524



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   352 bits (902),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 192/321 (60%), Positives = 232/321 (72%), Gaps = 21/321 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLG-LMLSLG-HADVYCPSRKRAR-ITGPFVVEVQE  407
             MP LVNYSGDD+   G S C    +LG L  ++G + DVY P  KR R I      E   
Sbjct  1     MPALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPRSIFEAIEREQYY  60

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             ++P IE LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++   EI R+ S       
Sbjct  61    QEPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEIERATSVD-----  115

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
                       E   +DE+ ++E DGYL+R ++GKKATDVRLAAIAVGTSSRGGLGKL +R
Sbjct  116   ----------ETVSSDENQDIEDDGYLTRCLDGKKATDVRLAAIAVGTSSRGGLGKLLIR  165

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GSNS RG+TN+G+SA+  GCPSL+ LSLWNV  +GDEG+ +IA+ C  LEKLDLC C SI
Sbjct  166   GSNSERGVTNLGLSAVAHGCPSLRSLSLWNVSTIGDEGVSQIAKGCHILEKLDLCHCSSI  225

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             SNKGL+AIAE C NLT+LTIESCPNIGNEGL+AI R CTKLQ +++KDCPLVGD G  S 
Sbjct  226   SNKGLIAIAEGCPNLTTLTIESCPNIGNEGLQAIARLCTKLQSISLKDCPLVGDHG-VSS  284

Query  1128  lssasavlTKVKLHALNITDF  1190
             L ++++ L++VKL  L ITDF
Sbjct  285   LLASASNLSRVKLQTLKITDF  305


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 76/180 (42%), Gaps = 37/180 (21%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    + RG        GL KL      S RGIT+  I AIG+GC +LK
Sbjct  314   GKAITNLVLSGLK-NVTERGFWVMGAAQGLQKLVSLTVTSCRGITDTSIEAIGKGCINLK  372

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
              L L     V D GL+  A+   SLE L L +C   +  G+                   
Sbjct  373   QLCLHRCCFVSDSGLVAFAKAAVSLESLQLEECNRFTQSGIIVALANIKTKLKSLSLVKC  432

Query  963   ---------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                      V +   C +L SL I+ CP  G+  L  IG+ C +LQ L +     + D G
Sbjct  433   MGVKDIDMEVCMLSPCESLRSLVIQKCPGFGSASLAMIGKLCPRLQHLNLTGLYGITDAG  492



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   353 bits (906),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 205/354 (58%), Positives = 248/354 (70%), Gaps = 24/354 (7%)
 Frame = +3

Query  180   FAAKSNLFCSLFGGFF*KETAMPTLVNY------------SGDDDFLAGSSLCS--ADLG  317
             F    +LF +LFGGF   E     L  +             G DDF  G S+     +  
Sbjct  15    FFLVGSLFFALFGGFLGGEQCRFDLPGFFELYLCQSSFLSVGSDDFCPGGSIYPNPKESS  74

Query  318   LMLSLGH-ADVYCPSRKRARITGPFVV---EVQEKKPSIEALPDECLFEIFRRLSGGRER  485
               LSLGH  DVY P RK++RI+ PFV      ++KKPSI+ LPDECLFEIFRRL GG+ER
Sbjct  75    HFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKKPSIDVLPDECLFEIFRRLPGGQER  134

Query  486   SSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGY  665
             S+ ACVSKRWL L+S++R  EI    + Q L++ D+       V     DED +VE DGY
Sbjct  135   SACACVSKRWLTLVSNIRKDEI----TTQALNLKDESTDKKGGV--VSEDEDQDVEGDGY  188

Query  666   LSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVL  845
             LSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +RGSNS+RG+T VG+ AI RGCPSL+VL
Sbjct  189   LSRSLEGKKATDVRLAAIAVGTASRGGLGKLFIRGSNSSRGVTAVGLRAISRGCPSLRVL  248

Query  846   SLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNI  1025
             SLW++  VGDEGL +IA  C  LEKLDLC CP+I++K L+A+A+ C NLT LTIE C NI
Sbjct  249   SLWSLSYVGDEGLCQIADGCHQLEKLDLCHCPAITDKSLIAVAKSCPNLTDLTIEGCANI  308

Query  1026  GNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             GNEGL+A+   C  L+ ++IKDCPLVGDQG+ASLLSSAS  LTKVKLHAL ITD
Sbjct  309   GNEGLQAVASCCPNLKSVSIKDCPLVGDQGIASLLSSASYSLTKVKLHALKITD  362


 Score = 67.8 bits (164),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 76/153 (50%), Gaps = 13/153 (8%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L ++    S +G        GL KL      S RG+T++G+ A+G+GCP+LK
Sbjct  372   GNAVTDLSLISLP-NVSEKGFWVMGNGHGLQKLKSFTVTSCRGVTDLGLEAVGKGCPNLK  430

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
                L     + D GL+  A+   SLE L L +C  I+  G       C   L +++  +C
Sbjct  431   QFCLRKCAFLSDNGLVSFAKAAGSLESLQLEECHRITQFGFFGSLLNCGAKLKAISFVNC  490

Query  1017  PNIG--NEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
               I   N GL ++   C  L+ L+I+DCP  GD
Sbjct  491   LGIKDLNLGLPSLSP-CESLRSLSIRDCPGFGD  522



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   350 bits (899),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 240/322 (75%), Gaps = 18/322 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  401
             M  +  ++G++DF  G  + +   +  L LS+G   DVY PSRKR+RI+ PFV       
Sbjct  1     MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+K+ SIE LPDECLFEIFRRL GG ER + ACVSKRWL L+S++   E+          
Sbjct  61    QKKQASIEFLPDECLFEIFRRLPGGDERGACACVSKRWLSLLSNICKDEL----------  110

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                +   A  + ++    ED E+E DGYLSRS+EGKKATD+RLAAIAVGT+SRGGLGKL 
Sbjct  111   -CSQNESAKKNTQVKSEVEDEEIEGDGYLSRSLEGKKATDIRLAAIAVGTASRGGLGKLF  169

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS++G+T VG+ AI RGCPSLKVLSLWN+P+VGDEGL EIA  C  LEKLDL QCP
Sbjct  170   IRGSNSSQGVTKVGLRAIARGCPSLKVLSLWNLPSVGDEGLSEIANGCHKLEKLDLSQCP  229

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I++KGL+AIA+ C NLT L IESC NIGNEGL+A+G++CT L+ ++IK+CP +GDQG+A
Sbjct  230   AITDKGLLAIAKSCPNLTDLVIESCTNIGNEGLQAVGQHCTNLKSISIKNCPAIGDQGIA  289

Query  1122  sllssasavlTKVKLHALNITD  1187
             +L+SSA+ VLTKVKL ALNITD
Sbjct  290   ALVSSATNVLTKVKLQALNITD  311


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 90/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L +++   S RG        GL KL      S  G+T+ G+ A+G+GCP+LK
Sbjct  321   GKAVTDLFLTSLS-NVSERGFWVMGNGQGLQKLKSMTVASCVGLTDTGLEAVGKGCPNLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
               +L     + D GL+  A+   SLE L L +C  I+  G                    
Sbjct  380   QFNLHKCSFLSDNGLVSFAKSAVSLESLLLEECHRITQFGFFGSLLNCGANLKAASLVNC  439

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I +CP  G+  L  +G+ C +LQ + +     V D G
Sbjct  440   FGIKDLKLDLPELSPCKSLRSLSIRNCPGFGDGSLALLGKLCPQLQNVELSGLQGVTDAG  499

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                +L +  A L KV L   +N++D
Sbjct  500   FLPVLENCEAGLVKVNLSGCVNLSD  524



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   349 bits (895),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 188/321 (59%), Positives = 231/321 (72%), Gaps = 21/321 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLG-LMLSLG-HADVYCPSRKRAR-ITGPFVVEVQE  407
             MP LVNYSGDD+   G S C    +LG L  ++G + D+Y P  KR R I      E   
Sbjct  1     MPALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPRSIFEAIEREQYY  60

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             + P IE LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++                 
Sbjct  61    QDPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTI---------------CK  105

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
             D++ G ++  E   +DE+ +++ DGYL+R ++GKKATDVRLAAIAVGTSSRGGLGKL +R
Sbjct  106   DEIEGTTSVAETVSSDENQDIDDDGYLTRCLDGKKATDVRLAAIAVGTSSRGGLGKLSIR  165

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GSNS RG+TN+G+SA+  GCPSL+ LSLWNV  +GDEGL ++A+ C  LEKLDLC C SI
Sbjct  166   GSNSERGVTNLGLSAVAHGCPSLRSLSLWNVSTIGDEGLSQVAKGCHMLEKLDLCHCSSI  225

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             SNKGL+AIAE C NLT+LTIESCPNIGNEGL+A  R C KLQ ++IKDCPLVGD G  S 
Sbjct  226   SNKGLIAIAEGCPNLTTLTIESCPNIGNEGLQATARLCPKLQSISIKDCPLVGDHG-VSS  284

Query  1128  lssasavlTKVKLHALNITDF  1190
             L ++++ L++VKL  LNITDF
Sbjct  285   LLASASNLSRVKLQTLNITDF  305


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 77/180 (43%), Gaps = 37/180 (21%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    + RG        GL KL      + RG+T+  I AIG+GC +LK
Sbjct  314   GKAITNLVLSGLK-NVTERGFWVMGAAQGLQKLLSLTVTACRGVTDTSIEAIGKGCINLK  372

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
              L L     V D GL+  A+   SLE L L +C   +  G+                   
Sbjct  373   HLCLRRCCFVSDNGLVAFAKAAISLESLQLEECNRFTQSGIIVALADIKTKLKSLALVKC  432

Query  963   ---------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                      V++   C +L SL I+ CP  G+  L  IG+ C +LQ L +     + D G
Sbjct  433   MGVKDIDMEVSMLSPCESLQSLAIQKCPGFGSASLATIGKLCPQLQHLNLTGLYGITDAG  492



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   347 bits (891),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 233/322 (72%), Gaps = 23/322 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLG--LMLSLGHADVYCPSRKRARITGPF----VVEVQ  404
             MP LVN SGDD+   G S+   DLG  L     + DVYC   KRARI+ PF    V   Q
Sbjct  1     MPALVNSSGDDEMYPGGSM---DLGGCLYTISSNVDVYCSPTKRARISAPFTFGAVEHKQ  57

Query  405   EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             + KPS+E LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++  SEI R+ S  + S+
Sbjct  58    DHKPSVEILPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTISKSEIERTNSSVEESV  117

Query  585   ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
             +   N           DED  VE DGYLSR +EG+KATDVRLAAIAVGTS RGGLGKL +
Sbjct  118   SSDEN-----------DED--VEGDGYLSRCLEGRKATDVRLAAIAVGTSGRGGLGKLSI  164

Query  765   RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPS  944
             RGSNS RG+TN G+SA+  GCPSL+ LSLWNV ++GD+GL EIA+ C  LEK+DLC CPS
Sbjct  165   RGSNSERGVTNRGLSAVAHGCPSLRSLSLWNVSSIGDKGLSEIAKGCHMLEKIDLCLCPS  224

Query  945   ISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
             I+NKGL+AIAE C NLT+L IESC  IGNEGL+AI + C KLQ ++IKDC LVGD G  S
Sbjct  225   ITNKGLIAIAEGCPNLTTLNIESCSKIGNEGLQAIAKLCPKLQSISIKDCCLVGDHG-VS  283

Query  1125  llssasavlTKVKLHALNITDF  1190
              L S ++ L++VKL ALNITDF
Sbjct  284   SLLSLASNLSRVKLQALNITDF  305


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 92/205 (45%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+++    S RG        GL KL      S RG+T+V I AI +GC +LK
Sbjct  314   GKAITNLVLSSLR-NVSERGFWVMGVAQGLQKLVSLTVTSCRGVTDVSIEAISKGCINLK  372

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
              + L     V D GL+  A+   SLE L L +C   +  G+                   
Sbjct  373   HMCLRKCCFVSDSGLVAFAKAAVSLENLQLEECNRFTQSGIIGALSNIKTKLKSLTLVKC  432

Query  963   ---------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                      V+    C +L +LTI++CP  G+  L  IG+ C +LQ + +     + D G
Sbjct  433   MGVKDIDVEVSTFSPCESLRTLTIQNCPGFGSASLAMIGKLCPQLQHVDLTGLYGITDAG  492

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  LL +  A L KV L    N+TD
Sbjct  493   LLPLLENCEAGLVKVNLTGCWNLTD  517



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 231/321 (72%), Gaps = 21/321 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSL--GHADVYCPSRKRAR-ITGPFVVEVQE  407
             MP LVNYSGDD+   G S C +  +LG + S    + D+Y P  KR+R I      E   
Sbjct  1     MPALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSRSILEAIEGEQHY  60

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             ++P IE LPDECLFEIFRRL  G+ERS  ACVSKRWLMLMSS+   EI R+ S  +    
Sbjct  61    QEPGIEVLPDECLFEIFRRLPSGKERSLCACVSKRWLMLMSSICKDEIERTTSAAE----  116

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
                        +SP DE+ ++ECDGYL+R ++GKKATDVRLAAIAVGTSSRGGLGKL +R
Sbjct  117   ----------TVSP-DENQDIECDGYLTRCLDGKKATDVRLAAIAVGTSSRGGLGKLSIR  165

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GSNS RG+TN+G+SA+  GCPSL+ LSLWNV ++GDEGL  IA+ C  LEKLDL  C SI
Sbjct  166   GSNSVRGVTNLGLSAVAHGCPSLRSLSLWNVSSIGDEGLSHIAKGCHILEKLDLSHCSSI  225

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             +NKGL+AIAE C N+T+L +ESCPNIGNEGL+A+ R C KLQ ++IKDCPLVGD G  S 
Sbjct  226   TNKGLIAIAEGCPNMTTLNMESCPNIGNEGLQALARLCPKLQSISIKDCPLVGDHG-VSN  284

Query  1128  lssasavlTKVKLHALNITDF  1190
             L S ++ L++VKL  LNITDF
Sbjct  285   LLSLASNLSRVKLQNLNITDF  305


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 66/152 (43%), Gaps = 28/152 (18%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S RG+T+  I AIG+GC +LK + L     V D GL+  A+   SLE L
Sbjct  341   GLQKLVSLTVTSCRGVTDKSIEAIGKGCINLKQMYLRRCCFVTDSGLVAFAKAAVSLESL  400

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C   +  G+                            V++   C +L SL I+ CP
Sbjct  401   QLEECNRFTQSGIIVALSNIKTKLRSLTLVKCTGVKDIDMEVSMLSPCQSLRSLAIQKCP  460

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               G+  L  IG+ C +L+ L +     + D G
Sbjct  461   GFGSSSLAMIGKLCPQLRHLNLTGLYGITDAG  492



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   346 bits (888),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 195/322 (61%), Positives = 240/322 (75%), Gaps = 17/322 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  404
             M  L+   G+DDF  G S+ +   +  L LSLG HADV+   RKR+RI+G FV      +
Sbjct  1     MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  405   EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             +KKP SI+ LPDECLFEIF+RL GG ERS+ ACVSK WL L+S++   E   + +   L+
Sbjct  61    QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKHWLTLLSNIHRDEFCSNTNDLSLN  120

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
               D+V G          ++D EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL 
Sbjct  121   PQDEVTG----------NKDQEVESCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLT  170

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS RG+TN+G+ AI  GCPSL+VLSLWNV ++GDEGL EIA  C  LEKLDL QCP
Sbjct  171   IRGSNSGRGVTNLGLRAISHGCPSLRVLSLWNVSSIGDEGLCEIANRCHMLEKLDLSQCP  230

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+KGLVAIA++C NLT L++ESC NIGNEGL+AIG+ C  L+ ++IK+CPLVGDQG+A
Sbjct  231   AISDKGLVAIAKKCPNLTDLSLESCSNIGNEGLQAIGQCCPNLKSISIKNCPLVGDQGIA  290

Query  1122  sllssasavlTKVKLHALNITD  1187
             SLLSS S VLTKVKL +L ITD
Sbjct  291   SLLSSVSYVLTKVKLQSLTITD  312



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   344 bits (883),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 194/323 (60%), Positives = 235/323 (73%), Gaps = 14/323 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  410
             M  L  +SG DDF  G S+  +     +    + DVY P  KR RI+ PFV    + ++K
Sbjct  1     MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQDVYFPPCKRYRISAPFVFAGGKFEQK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI--  584
             KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +++ Q   +  
Sbjct  61    KPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQASDLEH  120

Query  585   --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
                DK  G S++      D D +VE DGYLSRS++GKKATD+RLA+IAVGT+SRGGLGKL
Sbjct  121   ENTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDIRLASIAVGTASRGGLGKL  174

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RGS S  G+T VG+ AI RGCPSL+VLSLWN+ +VGDEGL EIA  C  LEKLDLC C
Sbjct  175   FIRGSKSRHGVTTVGLRAISRGCPSLRVLSLWNLSSVGDEGLCEIANGCHQLEKLDLCHC  234

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             PSI++K L+A+A+ C NLT LTIE C NIGNEGL+AI R C  L+ ++IKDCPLVGDQGV
Sbjct  235   PSITDKSLLAVAKGCPNLTDLTIEGCANIGNEGLQAIARSCPNLKSVSIKDCPLVGDQGV  294

Query  1119  asllssasavlTKVKLHALNITD  1187
             ASLLSSA   LTKVKL ALNITD
Sbjct  295   ASLLSSALYSLTKVKLQALNITD  317


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 77/166 (46%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    + +G        GL KL      S RG T+ G+ A+G+GCP+LK
Sbjct  327   GKAVTDLSLTSLP-NVTEKGFWVMGNGHGLQKLKSFTVTSCRGATDSGLEAVGKGCPNLK  385

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------VAIAE-  977
              L L   P + D+GL  +A+   SLE L L +C  IS  G              ++ A  
Sbjct  386   QLCLSKCPFLSDKGLASLAKAAGSLECLQLEECHRISQFGFFCSLINCGAKLKVISFANC  445

Query  978   --------------RCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                            C +L SL+I +CP  G+  L A+G+ C +LQ
Sbjct  446   LGIKDLNSGLPPLSPCESLRSLSIHNCPGFGDASLFALGKLCPQLQ  491


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 59/114 (52%), Gaps = 2/114 (2%)
 Frame = +3

Query  780   ARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIA--RECPSLEKLDLCQCPSISN  953
             A  IT+V ++ IG    ++  LSL ++PNV ++G   +        L+   +  C   ++
Sbjct  312   ALNITDVSLAVIGHYGKAVTDLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTVTSCRGATD  371

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              GL A+ + C NL  L +  CP + ++GL ++ +    L+CL +++C  +   G
Sbjct  372   SGLEAVGKGCPNLKQLCLSKCPFLSDKGLASLAKAAGSLECLQLEECHRISQFG  425



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   343 bits (881),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 194/323 (60%), Positives = 235/323 (73%), Gaps = 14/323 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  410
             M  L  +SG DDF  G S+  +     +    + DVY P  KR RI+ PFV    + ++K
Sbjct  1     MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQDVYFPPCKRYRISAPFVFAGGKFEQK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI--  584
             KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +++ Q   +  
Sbjct  61    KPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQASDLEH  120

Query  585   --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
                DK  G S++      D D +VE DGYLSRS++GKKATD+RLA+IAVGT+SRGGLGKL
Sbjct  121   ENTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDIRLASIAVGTASRGGLGKL  174

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RGS S  G+T VG+ AI RGCPSL+VLSLWN+ +VGDEGL EIA  C  LEKLDLC C
Sbjct  175   FIRGSKSRHGVTTVGLRAISRGCPSLRVLSLWNLSSVGDEGLCEIANGCHQLEKLDLCHC  234

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             PSI++K L+A+A+ C NLT LTIE C NIGNEGL+AI R C  L+ ++IKDCPLVGDQGV
Sbjct  235   PSITDKSLLAVAKGCPNLTDLTIEGCANIGNEGLQAIARSCPNLKSVSIKDCPLVGDQGV  294

Query  1119  asllssasavlTKVKLHALNITD  1187
             ASLLSSA   LTKVKL ALNITD
Sbjct  295   ASLLSSALYSLTKVKLQALNITD  317


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 78/167 (47%), Gaps = 39/167 (23%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    + +G        GL KL      S RG T+ G+ A+G+GCP+LK
Sbjct  327   GKAVTDLSLTSLP-NVTEKGFWVMGNGHGLQKLKSFTVTSCRGATDSGLEAVGKGCPNLK  385

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS-----------------------  950
              L L   P + D+GL  +A+   SLE L L +C  IS                       
Sbjct  386   QLCLSKCPFLSDKGLASLAKAAGSLECLQLEECHRISQFGFFCSLINCGAKLKVISFANC  445

Query  951   ------NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                   N GL  ++  C +L SL+I +CP  G+  L A+G+ C +LQ
Sbjct  446   LGIKDLNSGLPPLSP-CESLRSLSIHNCPGFGDASLFALGKLCPQLQ  491


 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 59/114 (52%), Gaps = 2/114 (2%)
 Frame = +3

Query  780   ARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIA--RECPSLEKLDLCQCPSISN  953
             A  IT+V ++ IG    ++  LSL ++PNV ++G   +        L+   +  C   ++
Sbjct  312   ALNITDVSLAVIGHYGKAVTDLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTVTSCRGATD  371

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              GL A+ + C NL  L +  CP + ++GL ++ +    L+CL +++C  +   G
Sbjct  372   SGLEAVGKGCPNLKQLCLSKCPFLSDKGLASLAKAAGSLECLQLEECHRISQFG  425



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   343 bits (880),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 238/322 (74%), Gaps = 18/322 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1     MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E+          
Sbjct  61    QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL----------  110

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                +   A  + E+    ED E+E DG LSRS+EGKKATD+RLAAI VGT++ GGLGKL 
Sbjct  111   -CSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDIRLAAIVVGTANSGGLGKLF  169

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS+RG+T VG+ AI RGCPSLKVLSLWN+P+VGDEGL EIA  C  LEKLDL QCP
Sbjct  170   IRGSNSSRGVTKVGLRAIARGCPSLKVLSLWNLPSVGDEGLSEIANGCHMLEKLDLSQCP  229

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I++KGL+AIA+ C NLT L +ESC NIGNEGL+A+G+YCT L+ ++I +CP VGDQG+A
Sbjct  230   AITDKGLLAIAKNCINLTDLVLESCSNIGNEGLQAVGQYCTNLKSISITNCPGVGDQGIA  289

Query  1122  sllssasavlTKVKLHALNITD  1187
             +L+SSAS VLTK+KL +LNITD
Sbjct  290   ALVSSASNVLTKLKLQSLNITD  311


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 74/152 (49%), Gaps = 11/152 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    S RG        GL KL      S  G+T++G+ A+G+GCPSLK
Sbjct  321   GKAVTDLVLTSLP-NVSERGFWVMGNGQGLHKLKSLTVTSCLGVTDIGLEAVGKGCPSLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
                L     + D GL+  A+    LE L L +C  I+  G       C  NL ++++ +C
Sbjct  380   QFCLHKCAFLSDNGLVSFAKAAEKLESLQLEECHRITLLGFFGSLLNCGANLKAISLVNC  439

Query  1017  PNIGNEGLRAIGRY-CTKLQCLTIKDCPLVGD  1109
               I +  L       C  L+ L+I++CP  GD
Sbjct  440   FGIRDLKLDLPQLSPCNSLRSLSIRNCPGFGD  471



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   343 bits (880),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 197/323 (61%), Positives = 237/323 (73%), Gaps = 14/323 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  410
             M  L  +SG DDF  G S+  +     +    + DVY P  KR R++ PFV    + ++K
Sbjct  1     MSKLFAFSGSDDFCPGGSIYPNRKESSLFFYPNQDVYFPPCKRCRVSSPFVFAGGKFEQK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ--DLSI  584
             KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +K+ Q  DL  
Sbjct  61    KPSIEILPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEIDDNKTTQASDLEY  120

Query  585   --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
                DK  G S++      D D +VE DGYLSRS++GKKATDVRLA+IAVGT+SRGGLGKL
Sbjct  121   ESTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDVRLASIAVGTASRGGLGKL  174

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RGS S  G+T VG+ AI RGCPSL+V SLWN+ +VGDEGL EIA  C  LEKLDLC C
Sbjct  175   FIRGSKSRYGVTTVGLRAISRGCPSLRVFSLWNLSSVGDEGLCEIANGCHQLEKLDLCHC  234

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             PSI++K L+A+A+ CTNLT LTIE C NIGNEGL+AI R C  L+ ++IKDCPLVGDQGV
Sbjct  235   PSITDKSLLAVAKGCTNLTDLTIEGCANIGNEGLQAIARSCPNLKYVSIKDCPLVGDQGV  294

Query  1119  asllssasavlTKVKLHALNITD  1187
             ASLLSSAS  LTKVKL AL+ITD
Sbjct  295   ASLLSSASYSLTKVKLQALSITD  317


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 77/166 (46%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    S +G        GL KL      S RG T++G+ A+G+GCP+LK
Sbjct  327   GKAVTDLSLTSLP-NVSEKGFWVMGNGHGLQKLKSFTVTSCRGATDLGLEAVGKGCPNLK  385

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------VAIAE-  977
              L L   P + D+GL  +A+   SLE L L +C  I+  G              ++ A  
Sbjct  386   QLCLSKCPFLSDKGLSSLAKAASSLECLQLEECHRITQFGFFCSLINCGAKLKVISFANC  445

Query  978   --------------RCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                            C +L SL+I +CP  G+  L A+G+ C  LQ
Sbjct  446   LGIKDLNSGLPPLSPCESLRSLSIHNCPGFGDASLFALGKLCPHLQ  491



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   343 bits (879),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 238/322 (74%), Gaps = 18/322 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1     MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E+          
Sbjct  61    QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL----------  110

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                +   A  + E+    ED E+E DG LSRS+EGKKATD+RLAAI VGT++ GGLGKL 
Sbjct  111   -CSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDIRLAAIVVGTANSGGLGKLF  169

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS+RG+T VG+ AI RGCPSLKVLSLWN+P+VGDEGL EIA  C  LEKLDL QCP
Sbjct  170   IRGSNSSRGVTKVGLRAIARGCPSLKVLSLWNLPSVGDEGLSEIANGCHMLEKLDLSQCP  229

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I++KGL+AIA+ C NLT L +ESC NIGNEGL+A+G+YCT L+ ++I +CP VGDQG+A
Sbjct  230   AITDKGLLAIAKNCINLTDLVLESCSNIGNEGLQAVGQYCTNLKSISITNCPGVGDQGIA  289

Query  1122  sllssasavlTKVKLHALNITD  1187
             +L+SSAS VLTK+KL +LNITD
Sbjct  290   ALVSSASNVLTKLKLQSLNITD  311


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 74/152 (49%), Gaps = 11/152 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    S RG        GL KL      S  G+T++G+ A+G+GCPSLK
Sbjct  321   GKAVTDLVLTSLP-NVSERGFWVMGNGQGLHKLKSLTVTSCLGVTDIGLEAVGKGCPSLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
                L     + D GL+  A+    LE L L +C  I+  G       C  NL ++++ +C
Sbjct  380   QFCLHKCAFLSDNGLVSFAKAAEKLESLQLEECHRITLLGFFGSLLNCGANLKAISLVNC  439

Query  1017  PNIGNEGLRAIGRY-CTKLQCLTIKDCPLVGD  1109
               I +  L       C  L+ L+I++CP  GD
Sbjct  440   FGIRDLKLDLPQLSPCNSLRSLSIRNCPGFGD  471



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   342 bits (878),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 237/319 (74%), Gaps = 12/319 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  410
             M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1     MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61    EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             +V+G           ED EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +RG
Sbjct  121   EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLMIRG  172

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             +NS RG+TN+G+ AI  GCPSL+VLSLWN+ ++GDEGL EIA  C  LEKLDL +CP+IS
Sbjct  173   NNSVRGVTNLGLKAISHGCPSLRVLSLWNMSSIGDEGLCEIANRCHLLEKLDLSRCPAIS  232

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGL+AIA++C NLT +++ESC NIGNEGL+AIG+ C  L+ ++IK+C LVGDQG+ SLL
Sbjct  233   DKGLIAIAKKCPNLTDVSLESCSNIGNEGLQAIGQCCPNLKSISIKNCHLVGDQGIVSLL  292

Query  1131  ssasavlTKVKLHALNITD  1187
             SS S VLTKVKL AL I+D
Sbjct  293   SSISYVLTKVKLQALTISD  311


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 90/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L +++   + RG        GL KL      S +G+T+ G+ A+G+GCP+LK
Sbjct  321   GNAVTDLVLTSLS-NVTERGFWVMGNGQGLQKLKSFTVTSCQGVTDTGLEAVGKGCPNLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
                L     V D GL+   +   SLE L L +C  I+  GL  +                
Sbjct  380   QFCLRKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGSKLKSLAFVSC  439

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I SCP  GN GL  +G+ C +LQ +       + D G
Sbjct  440   LGLKDLNFGSPGVSPCQSLQSLSIRSCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVG  499

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                L+ +  A L KV L   +N+TD
Sbjct  500   FLPLVENCEAGLVKVNLSGCVNLTD  524


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 62/141 (44%), Gaps = 30/141 (21%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECP----------------  908
             S  G  NVG++ +G+ CP L+ +    + ++ D G L +   C                 
Sbjct  465   SCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTD  524

Query  909   ------------SLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
                         ++E L+L  C  +S+ GL AIA  CT L+ L +  C  I N G+ ++ 
Sbjct  525   KVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA-ITNFGIASLA  583

Query  1053  RY-CTKLQCLTIKDCPLVGDQ  1112
                   LQ L+I  CPLV D+
Sbjct  584   HADQLNLQMLSISGCPLVSDK  604



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   343 bits (880),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 195/329 (59%), Positives = 235/329 (71%), Gaps = 16/329 (5%)
 Frame = +3

Query  222   FF*KETAMPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV  392
             FF +     +LV+   +DDF  G  + S   D  L LSLG H DVY PSRKR+RI+ PFV
Sbjct  43    FFKQYPCRRSLVSPVSNDDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFV  102

Query  393   VEVQ----EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS  560
                +    +KK SI+ LPDECLFEIFRRL    ERS++ACVSKRWLML+S++R  E+   
Sbjct  103   FSEERLQKKKKASIDVLPDECLFEIFRRLPA-EERSASACVSKRWLMLLSNIRQEELCSE  161

Query  561   KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSR  740
             K+   L   D +             ED E+E  GYLSRS+EGKKATDVRLAAIAVG +SR
Sbjct  162   KTSASLKSEDDI--------AEEKGEDQEIETQGYLSRSLEGKKATDVRLAAIAVGAASR  213

Query  741   GGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEK  920
             GGLGKL +RGSNS RG+TN+G+ AI  GCPSL+VLSLWN+ +VGDE L EIA  C  LEK
Sbjct  214   GGLGKLSIRGSNSGRGVTNLGLKAIAHGCPSLRVLSLWNMTSVGDEVLCEIADGCHLLEK  273

Query  921   LDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPL  1100
             LDLCQCP+IS+K L AIA+ C NLT LTIESC NIGN GL+A+GR C  L+ ++IK+C L
Sbjct  274   LDLCQCPAISDKALFAIAKNCPNLTELTIESCSNIGNAGLQAVGRSCPNLKSVSIKNCSL  333

Query  1101  VGDQGvasllssasavlTKVKLHALNITD  1187
             VGDQG+A L+SS S VL+KVKL ALNITD
Sbjct  334   VGDQGIAGLVSSTSFVLSKVKLQALNITD  362


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 91/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    S RG        GL KL      S +G+T+VG+ A+G+G P+L+
Sbjct  372   GKSITDLALTSLP-AVSERGFWVMGNGPGLQKLKSLTITSCQGVTDVGLEAVGKGSPNLR  430

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV-AIA--------------  974
                L     V D GL+  AR   SLE L L +C  I+  G   A+A              
Sbjct  431   QFCLRKSSFVSDNGLVAFARAAGSLESLQLEECHRITQFGFFGALANCGTKLKALSLVCC  490

Query  975   -------------ERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL I +CP  GN  L  +G+ C +LQ +       V D G
Sbjct  491   LGIKDLNVGLPQLSPCESLKSLCIRNCPGFGNASLNVLGKLCPQLQHVDFSGLEGVTDSG  550

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             + S L S  A L KV L   +N+TD
Sbjct  551   LLSFLESCEAGLAKVNLSGCVNLTD  575



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 243/335 (73%), Gaps = 21/335 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLGH-ADVYCPSRKRARITGPFVV-EVQEK  410
             M  + N+SGD+ F  G +L  +  +  L LSLGH  DVY P  KR+RIT P +  E Q+K
Sbjct  1     MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFTEKQKK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
              PSI+ LPDECLFE+FRR+S G+ERS+ ACVSKRWLML+SS+R  E   SK        +
Sbjct  61    LPSIDVLPDECLFEVFRRVSDGKERSACACVSKRWLMLLSSIRGDETVVSKPSPSSETEE  120

Query  591   KVNGAS----------------NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIA  722
             +   ++                N VE++   E  ++E +G+LSR ++GKKATDVRLAAIA
Sbjct  121   RSIRSAPIKPVDCIKKGEVVEPNGVEVADV-ETQDIEGEGHLSRCLDGKKATDVRLAAIA  179

Query  723   VGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARE  902
             VGT++ GGLGKL +RGSN +RG+T+ G+ AI RGCPSL+ LSLWNV +V DEGL EIA+ 
Sbjct  180   VGTATHGGLGKLSIRGSNPSRGVTDTGLKAIARGCPSLRALSLWNVSSVSDEGLSEIAQG  239

Query  903   CPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLT  1082
             C  LEKLDLCQCP+I++  LVAIA+ C NLTSLTIESC NIGNE L+A+GR+C KL+ ++
Sbjct  240   CHLLEKLDLCQCPAITDTSLVAIAKSCPNLTSLTIESCANIGNESLQAVGRFCPKLKFVS  299

Query  1083  IKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             +K+CPL+GDQG+ASL SSA  VLTKVKLHALNI+D
Sbjct  300   LKNCPLIGDQGIASLFSSAGHVLTKVKLHALNISD  334


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 83/177 (47%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      +  G+T+VG+ AIG+GCP+LK+  L     + D GL+  A+   SLE L
Sbjct  371   GLQKLRFLAITACNGVTDVGLEAIGKGCPNLKLFCLRKCAFLSDNGLVAFAKGSASLENL  430

Query  924   DLCQCPSISNKGLVAI----------------------------AERCTNLTSLTIESCP  1019
              L +C  I+  GL  +                               C +L SL+I +CP
Sbjct  431   QLEECHRITQAGLFGVLLSCGKKLKALSLVNCFGVKELACRFPSVLPCNSLQSLSIRNCP  490

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
              +GN  L  +GR C KL  L +     + D+G+  L+ S  A L K+ L   +N+TD
Sbjct  491   GVGNATLAVVGRLCPKLTYLELSGLVGITDEGLFPLMQSCEAGLVKMNLSGCVNVTD  547


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 71/147 (48%), Gaps = 7/147 (5%)
 Frame = +3

Query  675   SVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA----RGITNVGISAIG--RGCPSL  836
             S  G   T V+L A+ +   S   +G   +  ++ A    + I   G   +G  +G   L
Sbjct  316   SSAGHVLTKVKLHALNISDVSLAVIGHYGIAVTDIALIGLQSINERGFWVMGNGQGLQKL  375

Query  837   KVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESC  1016
             + L++     V D GL  I + CP+L+   L +C  +S+ GLVA A+   +L +L +E C
Sbjct  376   RFLAITACNGVTDVGLEAIGKGCPNLKLFCLRKCAFLSDNGLVAFAKGSASLENLQLEEC  435

Query  1017  PNIGNEGLRAIGRYC-TKLQCLTIKDC  1094
               I   GL  +   C  KL+ L++ +C
Sbjct  436   HRITQAGLFGVLLSCGKKLKALSLVNC  462



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   341 bits (875),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 244/335 (73%), Gaps = 21/335 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLGH-ADVYCPSRKRARITGPFVV-EVQEK  410
             M  + N+SGDD F  G +L  +  +  L LSLGH  DVY P  KR+R+T P +  E Q+K
Sbjct  1     MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFTEKQKK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK-----SHQD  575
              PSI+ LPDECLFE+ RR+S G+ERS+ ACVSKRWLML+SS+R  E   SK       ++
Sbjct  61    LPSIDVLPDECLFEVLRRVSDGKERSACACVSKRWLMLLSSIRGYETVVSKPSPSSETEE  120

Query  576   LSI-------ADKVNGAS----NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIA  722
              SI        D +        N VE++   E  ++E +G+LSR ++GKKATDVRLAAIA
Sbjct  121   RSIQSAPVKPVDSIKKGEVVDPNGVEVADI-ETQDIEGEGHLSRCLDGKKATDVRLAAIA  179

Query  723   VGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARE  902
             VGT++ GGLGKL +RGSN +RG+T+ G+ AI RGCPSL+ LSLWNV +V DEGL EIA+ 
Sbjct  180   VGTATHGGLGKLSIRGSNPSRGVTDTGLKAIARGCPSLRALSLWNVSSVSDEGLSEIAQG  239

Query  903   CPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLT  1082
             C  LEKLDLCQCP+I++  LVAIA+ C NLTSLTIESC NIGNE L+A+GR+C KL+ ++
Sbjct  240   CHLLEKLDLCQCPAITDASLVAIAKSCPNLTSLTIESCANIGNESLQAVGRFCPKLKFVS  299

Query  1083  IKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             +K+CPL+GDQG+ASL SSA  VLTKVKLHALNI+D
Sbjct  300   LKNCPLIGDQGIASLFSSAGHVLTKVKLHALNISD  334


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 82/177 (46%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      +  G+T++G+ A+G+GCP+LK+  L     + D GL+  A+   SLE L
Sbjct  371   GLQKLRSLAITACSGVTDLGLEALGKGCPNLKLFCLRKCAFLSDNGLVAFAKGSASLENL  430

Query  924   DLCQCPSISNKGLVAI----------------------------AERCTNLTSLTIESCP  1019
              L +C  I+  GL  +                               C +L SL+I +CP
Sbjct  431   QLEECHRITQAGLFGVLLSCGKKLKALSLVNCFGVKELACRFPSVLPCNSLQSLSIRNCP  490

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
              +GN  L   GR C KL  L +     + D+G+  L+ S  A L KV L   +N+TD
Sbjct  491   GVGNATLAVAGRLCPKLTHLELSGLVGITDEGLFPLVQSCEAGLVKVNLSGCVNVTD  547



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 231/321 (72%), Gaps = 17/321 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  404
             M  L   SG DDF  G  +     + GL+L LG + D+Y  +RKR+RI+ PFV      +
Sbjct  1     MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERFE  60

Query  405   EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             +K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL L+S++   EI   K       
Sbjct  61    QKQVSIEVLPDECLFEIFRRLDGGEERSACACVSKRWLSLLSNIHRDEIRSLKPE-----  115

Query  585   ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
                   A   VE+    ED +VE DGYLSRS+EGKKATD+RLAAIAVGT+SRGGLGKL +
Sbjct  116   ------AEKKVELVSDAEDPDVERDGYLSRSLEGKKATDIRLAAIAVGTASRGGLGKLSI  169

Query  765   RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPS  944
             RG+NS RG+T+VG+ AI RGCPSL+VLSLWN  +VGDEGL EIA  C  LEKLDLCQCP+
Sbjct  170   RGNNSTRGVTSVGLRAIARGCPSLRVLSLWNTSSVGDEGLCEIANGCHQLEKLDLCQCPA  229

Query  945   ISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
             I+++ L+ IA+ C  L  LTIESC +IGNEGL+A+GR+C  L+ ++IKDC LVGDQG+AS
Sbjct  230   ITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIAS  289

Query  1125  llssasavlTKVKLHALNITD  1187
             LLSSA+  L KVKL  LNITD
Sbjct  290   LLSSATYSLEKVKLQRLNITD  310


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 13/153 (8%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +    S RG        GL KL      S  G+T++G+ A+G+GCP+LK
Sbjct  320   GMAVTDLFLTGLP-HVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLK  378

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
                L     + D GL+  A+   SLE L L +C  I+  G       C   L +L++ SC
Sbjct  379   QFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKLKALSLVSC  438

Query  1017  PNIGNE--GLRAIGRYCTKLQCLTIKDCPLVGD  1109
               I ++  G+R++   C  L+ L+I++CP  GD
Sbjct  439   LGIKDQNLGVRSVSP-CKSLRSLSIRNCPGFGD  470



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 236/319 (74%), Gaps = 12/319 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  410
             M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1     MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61    EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             +V+G           ED EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL + G
Sbjct  121   EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLMIXG  172

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             +NS RG+TN+G+ AI  GCPSL+VLSLWN+ ++GDEGL EIA  C  LEKLDL +CP+IS
Sbjct  173   NNSVRGVTNLGLKAISHGCPSLRVLSLWNMSSIGDEGLCEIANRCXLLEKLDLSRCPAIS  232

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGL+AIA++C NLT +++ESC NIGNEGL+AIG+ C  L+ ++IK+C LVGDQG+ SLL
Sbjct  233   DKGLIAIAKKCPNLTDVSLESCSNIGNEGLQAIGQCCPNLKSISIKNCHLVGDQGIXSLL  292

Query  1131  ssasavlTKVKLHALNITD  1187
             SS S VLTKVKL AL I+D
Sbjct  293   SSISYVLTKVKLQALTISD  311


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 90/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L +++   + RG        GL KL      S +G+T+ G+ A+G+GCP+LK
Sbjct  321   GNAVTDLVLTSLS-NVTERGFWVMGNGQGLQKLKSFTVTSCQGVTDTGLEAVGKGCPNLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
                L     V D GL+   +   SLE L L +C  I+  GL  +                
Sbjct  380   QFCLXKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGSKLKSLAFVSC  439

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I SCP  GN GL  +G+ C +LQ +       + D G
Sbjct  440   LGLKDLNFGSPGVSPCQSLRSLSIRSCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVG  499

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                L+ +  A L KV L   +N+TD
Sbjct  500   FLPLVENCEAGLVKVNLSGCVNLTD  524


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 62/141 (44%), Gaps = 30/141 (21%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECP----------------  908
             S  G  NVG++ +G+ CP L+ +    + ++ D G L +   C                 
Sbjct  465   SCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTD  524

Query  909   ------------SLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
                         ++E L+L  C  +S+ GL AIA  CT L+ L +  C  I N G+ ++ 
Sbjct  525   KVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA-ITNFGIASLA  583

Query  1053  RY-CTKLQCLTIKDCPLVGDQ  1112
                   LQ L+I  CPLV D+
Sbjct  584   HADQLNLQXLSISGCPLVSDK  604



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 236/319 (74%), Gaps = 12/319 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  410
             M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1     MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61    EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             +V+G           ED EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL + G
Sbjct  121   EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLMIXG  172

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             +NS RG+TN+G+ AI  GCPSL+VLSLWN+ ++GDEGL EIA  C  LEKLDL +CP+IS
Sbjct  173   NNSVRGVTNLGLKAISHGCPSLRVLSLWNMSSIGDEGLCEIANRCXLLEKLDLSRCPAIS  232

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGL+AIA++C NLT +++ESC NIGNEGL+AIG+ C  L+ ++IK+C LVGDQG+ SLL
Sbjct  233   DKGLIAIAKKCPNLTDVSLESCSNIGNEGLQAIGQCCPNLKSISIKNCHLVGDQGIXSLL  292

Query  1131  ssasavlTKVKLHALNITD  1187
             SS S VLTKVKL AL I+D
Sbjct  293   SSISYVLTKVKLQALTISD  311


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 90/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L +++   + RG        GL KL      S +G+T+ G+ A+G+GCP+LK
Sbjct  321   GNAVTDLVLTSLS-NVTERGFWVMGNGQGLQKLKSFTVTSCQGVTDTGLEAVGKGCPNLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
                L     V D GL+   +   SLE L L +C  I+  GL  +                
Sbjct  380   QFCLXKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGSKLKSLAFVSC  439

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I SCP  GN GL  +G+ C +LQ +       + D G
Sbjct  440   LGLKDLNFGSPGVSPCQSLXSLSIRSCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVG  499

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                L+ +  A L KV L   +N+TD
Sbjct  500   FLPLVENCEAGLVKVNLSGCVNLTD  524


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 62/141 (44%), Gaps = 30/141 (21%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECP----------------  908
             S  G  NVG++ +G+ CP L+ +    + ++ D G L +   C                 
Sbjct  465   SCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTD  524

Query  909   ------------SLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
                         ++E L+L  C  +S+ GL AIA  CT L+ L +  C  I N G+ ++ 
Sbjct  525   KVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA-ITNFGIASLA  583

Query  1053  RY-CTKLQCLTIKDCPLVGDQ  1112
                   LQ L+I  CPLV D+
Sbjct  584   HADQLNLQXLSISGCPLVSDK  604



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 229/321 (71%), Gaps = 22/321 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVV---EVQ  404
             M  L ++SG D+F  G S+     +  L  SLGH  DVY P  KR+RI+ P V     V+
Sbjct  1     MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERVE  60

Query  405   EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             +K PSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL L+S++   EI     +    +
Sbjct  61    KKNPSIEILPDECLFEIFRRLPGGQERSSCACVSKRWLTLVSNIHRDEI---NDNNKGGV  117

Query  585   ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
               KV             ED +VE DGYLSR +EGKKATDVRLAAIAVGT+SRGGLGKL +
Sbjct  118   VSKV-------------EDQDVEGDGYLSRVLEGKKATDVRLAAIAVGTASRGGLGKLSI  164

Query  765   RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPS  944
             RGSNS  G+TNVG+ AI RGCPSL+VLSLW+  +VGDEGL EIA  C  LEKLDLC CP+
Sbjct  165   RGSNSTCGVTNVGLRAISRGCPSLRVLSLWDSSSVGDEGLFEIADGCHQLEKLDLCHCPA  224

Query  945   ISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
             I++K L+A+A+ C NL  LTIE C NI NEGL+A+ R C  L+ ++IKDCPL+GDQG+AS
Sbjct  225   ITDKSLLAVAKGCPNLKDLTIEGCANIENEGLQALARCCPNLKAISIKDCPLIGDQGIAS  284

Query  1125  llssasavlTKVKLHALNITD  1187
             +LSSAS  LTK+KL ALNITD
Sbjct  285   MLSSASFTLTKIKLQALNITD  305


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 98/205 (48%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G+  TD+ L ++    S +G        GL KL      S RG+T++G+ A+G+GCP+LK
Sbjct  315   GRAVTDLSLISLP-NVSEKGFWVMGNGHGLQKLKSFAVTSCRGVTDLGLEAVGKGCPNLK  373

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG-----------LVAIAE---  977
              L L     + D+GL+  A+   SLE L L +C  I+  G           L AI+    
Sbjct  374   QLCLHKCAFLSDKGLVSFAKTASSLESLQLEECHRITQFGFFGSLLNCGAKLKAISLVNC  433

Query  978   --------------RCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I +CP  G+  L A+G+ C +LQ + +     + D G
Sbjct  434   YGIKDLNLGLPSVLPCKSLRSLSIRNCPGFGDASLAALGKLCPQLQHVELSGLHGISDAG  493

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  LL +  A L KV L   +N++D
Sbjct  494   LLPLLETREADLVKVNLSGCVNLSD  518



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 239/322 (74%), Gaps = 18/322 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1     MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E+          
Sbjct  61    QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL----------  110

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                +   A  + E+    ED E+E DG LSRS+EGKKATD+RLAAIAVGT++ GGLGKL 
Sbjct  111   -CSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDIRLAAIAVGTANCGGLGKLF  169

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS++G+T VG+ AI RGCPSLKVLSLWN+P+VGDEGL EI+  C  LEKLDL QCP
Sbjct  170   IRGSNSSQGVTKVGLRAIARGCPSLKVLSLWNLPSVGDEGLSEISNGCHMLEKLDLSQCP  229

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I++KGL+AIA+ C NLT L +ESC NIGNEGL+A+G++CT L+ ++I +CP VGDQG+A
Sbjct  230   AITDKGLLAIAKNCINLTDLVLESCSNIGNEGLQAVGKHCTNLKSISITNCPGVGDQGIA  289

Query  1122  sllssasavlTKVKLHALNITD  1187
             +L+SSAS VLTK+KL +LNITD
Sbjct  290   ALVSSASNVLTKLKLQSLNITD  311


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 75/152 (49%), Gaps = 11/152 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    S RG        GL KL      S  G+T++G+ A+G+GCP+LK
Sbjct  321   GKAVTDLVLTSLP-NVSERGFWVMGNGQGLHKLKSLTVTSCLGVTDIGLEAVGKGCPNLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
                L     + D GL+  A+   +LE L L +C  I+  G       C  NL ++++ +C
Sbjct  380   QFCLHKCAFLSDNGLVSFAKAAETLESLQLEECHRITQFGFFGSLLNCGANLKAISLVNC  439

Query  1017  PNIGNEGLRAIGRY-CTKLQCLTIKDCPLVGD  1109
               I +  L       C  L+ L+I++CP  GD
Sbjct  440   FGIRDLKLDLPELSPCNSLRSLSIRNCPGFGD  471


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 59/116 (51%), Gaps = 4/116 (3%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPS-LEKLDLCQCPSISN  953
             S   I N G+ A+G+ C +LK +S+ N P VGD+G+  +     + L KL L Q  +I++
Sbjct  253   SCSNIGNEGLQAVGKHCTNLKSISITNCPGVGDQGIAALVSSASNVLTKLKL-QSLNITD  311

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAI--GRYCTKLQCLTIKDCPLVGDQG  1115
               L  +      +T L + S PN+   G   +  G+   KL+ LT+  C  V D G
Sbjct  312   VSLAVVGHYGKAVTDLVLTSLPNVSERGFWVMGNGQGLHKLKSLTVTSCLGVTDIG  367



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   339 bits (870),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 199/332 (60%), Positives = 245/332 (74%), Gaps = 17/332 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             M  L +Y+G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      
Sbjct  1     MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+++ SI+ LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +K+   L 
Sbjct  61    QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKTTGFLK  120

Query  582   IADKVNGASNDV----------EMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  731
               + +   + D           E++P   DLE+E DGYLSR +EGKKATDVRLAAIAVGT
Sbjct  121   PKETLISRNTDESSEAKKKGGDEVTPEAVDLEIESDGYLSRCLEGKKATDVRLAAIAVGT  180

Query  732   SSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPS  911
                GGLGKL +RGSNS+  +TN+G+ AI RGCPSL+VLSLWNV ++ DEGL+EIA  C  
Sbjct  181   GGHGGLGKLLIRGSNSSCRVTNLGLGAIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQ  240

Query  912   LEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKD  1091
             LEKLDLC CP+IS+K LVAIA+ C NLT+LTIESCP IGN GL+A+G++C  L+ ++IK+
Sbjct  241   LEKLDLCGCPTISDKALVAIAKNCHNLTALTIESCPRIGNAGLQAVGQFCPNLKSISIKN  300

Query  1092  CPLVGDQGvasllssasavlTKVKLHALNITD  1187
             CPLVGDQGVASLLSSAS  LTKVKLHALNITD
Sbjct  301   CPLVGDQGVASLLSSASYALTKVKLHALNITD  332


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 94/204 (46%), Gaps = 36/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +  VG        S  GL KL      S +G+T++G+ A+G+GCP+LK 
Sbjct  342   GKAITDLDLTGLQNVGERGFWVMGSGHGLQKLKSLTVTSCQGVTDMGLEAVGKGCPNLKQ  401

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL--------------------  962
               L     + D GL+ +A+   SLE L L +C  I+  G+                    
Sbjct  402   FCLRKCAFLSDNGLVSLAKVAASLESLQLEECHHITQYGVFGALVSCGGKLKSLALVNCF  461

Query  963   --------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
                     + +   C +L+SL+I +CP  GN  L  +G+ C +LQ L +     + + G 
Sbjct  462   GIKDTVEGLPLMTPCKSLSSLSIRNCPGFGNASLCMVGKLCPQLQRLDLSGALRITNAGF  521

Query  1119  asllssasavlTKVKLHA-LNITD  1187
               LL S  A L KV L   +N+TD
Sbjct  522   LPLLESCEASLIKVNLSGCMNLTD  545



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   338 bits (868),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 237/319 (74%), Gaps = 12/319 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  410
             M  L+ +SG DDF  G    +  + GL LSLGH ADV  P RKR+RI+ PFV      EK
Sbjct  1     MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFEK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             + SI+ LPDECLFEIF+R+ GG ERS+ ACVS+RWL ++S++   E   + ++      D
Sbjct  61    EVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSNPTNLSFKSQD  120

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             +V+G ++        ED EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +RG
Sbjct  121   EVSGNNS--------EDQEVENCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLMIRG  172

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             SNS  G+TN+G+ AI  GCPSL+VLSLWNV +VGDEGL EIA+ C  LEKLDL QCP+IS
Sbjct  173   SNSVCGVTNLGLKAISHGCPSLRVLSLWNVSSVGDEGLCEIAKRCHLLEKLDLTQCPAIS  232

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGL+AIA++C NLT +++E C NIGNEGL+AIG+ C  L+ ++IK+C LVGDQG+A LL
Sbjct  233   DKGLIAIAKKCPNLTDVSLEFCSNIGNEGLQAIGQCCPNLRSISIKNCRLVGDQGIAGLL  292

Query  1131  ssasavlTKVKLHALNITD  1187
             SS S VLTKVKL AL I+D
Sbjct  293   SSTSYVLTKVKLQALTISD  311


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 90/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ LA++    + RG        GL KL      S +G+T+ G+ A+G+GCP+LK
Sbjct  321   GLAVTDLVLASLR-NVTQRGFLFMGNGQGLQKLKSFTIASCQGVTDTGLQAVGKGCPNLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------VAIA--  974
                L     + D GL+   +   SLE L L +C  I+  G              VA A  
Sbjct  380   QFCLRKCLFISDSGLVSFCKATRSLESLHLEECHRITQFGFFGALSTGGSKLKSVAFASC  439

Query  975   -------------ERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I  CP  GN GL  +G+ C +L+ +       + D G
Sbjct  440   MGLKDVNFGSPAVSPCQSLRSLSIRRCPGFGNVGLALLGKLCPQLEHVDFSGLEAITDAG  499

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                L+ +  A L KV L   +N+TD
Sbjct  500   FLPLVENCEAGLVKVNLSGCVNLTD  524



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 237/331 (72%), Gaps = 16/331 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLG-LMLSLG-HADVYCPSRKRARITGPFVVEVQ-EKK  413
             M  + ++     F  G  L +  +  L L LG H DVY   RKR+RI+ PFVV  + E++
Sbjct  1     MSEVFDFKAVGKFCPGGFLTNPKVSSLFLPLGNHVDVYFLPRKRSRISAPFVVSGEPEQQ  60

Query  414   PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL-----  578
             PSI+ LPDECLFE+FRRL GG+ERS+ ACVSKRWLMLMSS+   EI  SK+ Q +     
Sbjct  61    PSIDVLPDECLFEVFRRLPGGQERSACACVSKRWLMLMSSIARDEICNSKTTQFVEPEIR  120

Query  579   ---SIAD---KVNGASNDVE--MSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTS  734
                ++A    K    SND+    S  +E  E +  GYLSR +EGKKATDVRLAAIAVGT+
Sbjct  121   SSPAVAHDSAKPKEKSNDMNGIKSEDEECQENDSHGYLSRCLEGKKATDVRLAAIAVGTA  180

Query  735   SRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSL  914
             SRGGLGKL +RGS S RG+TN+G+ AI RGCPSLKVLSLWN+ ++GDEGL EIA     L
Sbjct  181   SRGGLGKLSIRGSASTRGLTNLGLKAISRGCPSLKVLSLWNLSSIGDEGLCEIASGSRFL  240

Query  915   EKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDC  1094
             EKLDLC CP+I++KGL+AIA  C NL S+T+ESC NIGNE L+A+GRYC  L+C+T+K+C
Sbjct  241   EKLDLCHCPAITDKGLIAIALNCPNLISVTVESCSNIGNESLKALGRYCPNLRCVTVKNC  300

Query  1095  PLVGDQGvasllssasavlTKVKLHALNITD  1187
             PLVGDQG+A L SSA  +L K KL ALNI+D
Sbjct  301   PLVGDQGIAGLFSSAGHILEKAKLQALNISD  331


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (55%), Gaps = 2/124 (2%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      +  G++++G+ A+G+GCP LK+ +L   P+V D GL+   +   SLE L
Sbjct  368   GLQKLKSLSLTACPGVSDLGLEAVGKGCPDLKLFALRKCPHVSDPGLVSFTKAAGSLESL  427

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNI-GNEGLRAIGRYCTKLQCLTIKDCP  1097
              L +C  IS  G+  I   C   L +L IE+C  I  +E       +C  L+ L+I++CP
Sbjct  428   KLEECHRISQCGVFGILSSCGGKLKALAIENCLGIRDSEFAFPATSFCHSLRSLSIRNCP  487

Query  1098  LVGD  1109
               GD
Sbjct  488   GFGD  491


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 64/142 (45%), Gaps = 30/142 (21%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPS-LEKLDLCQCPSISN  953
             S   I N  + A+GR CP+L+ +++ N P VGD+G+  +       LEK  L Q  +IS+
Sbjct  273   SCSNIGNESLKALGRYCPNLRCVTVKNCPLVGDQGIAGLFSSAGHILEKAKL-QALNISD  331

Query  954   KGLVAIAERCTNLT----------------------------SLTIESCPNIGNEGLRAI  1049
               L  I    + +T                            SL++ +CP + + GL A+
Sbjct  332   VSLAVIGHYGSAMTDLALVGLQNVNERGFWVMGKGQGLQKLKSLSLTACPGVSDLGLEAV  391

Query  1050  GRYCTKLQCLTIKDCPLVGDQG  1115
             G+ C  L+   ++ CP V D G
Sbjct  392   GKGCPDLKLFALRKCPHVSDPG  413



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   336 bits (862),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 237/320 (74%), Gaps = 13/320 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE---VQE  407
             M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      ++
Sbjct  1     MSKLLGFSGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             K+ SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     
Sbjct  61    KEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQSFKSQ  120

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
             D+V+G           ED EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +R
Sbjct  121   DEVSGNKA--------EDQEVEGCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLMIR  172

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             G+NS RG+TN+G+ AI  GCPSL+VLSLWN+ ++GDEGL EIA  C  LEKLDL +CP+I
Sbjct  173   GNNSVRGVTNLGLKAISHGCPSLRVLSLWNMSSIGDEGLCEIANRCHLLEKLDLSRCPAI  232

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             S+KGL+AIA++C NLT +++ESC NIGN  L+AIG+ C  L+ ++IK+C LVGDQG+ASL
Sbjct  233   SDKGLIAIAKKCPNLTDVSLESCSNIGNGSLQAIGQCCPNLRSISIKNCHLVGDQGIASL  292

Query  1128  lssasavlTKVKLHALNITD  1187
             LSS S VLTKVKL AL I+D
Sbjct  293   LSSTSYVLTKVKLQALTISD  312


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 77/177 (44%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S +G+T+ G+ A+G+GCP LK   L     V D GL+   +   SLE L
Sbjct  349   GLQKLKSFTVTSCQGVTDTGLEAVGKGCPDLKQFCLRKCLFVSDSGLVSFCKAAGSLESL  408

Query  924   DLCQCPSISNKGLVA----------------------------IAERCTNLTSLTIESCP  1019
              L +C  I+  GL                                  C +L SL+I SCP
Sbjct  409   HLEECHRITQFGLFGALSTGGSKLKSLAFVSCLGLKDLNFGSPAVSPCQSLRSLSIRSCP  468

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               GN GL  +G+ C +LQ +       + D G   L+ +  A L KV L   +N+TD
Sbjct  469   GFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTD  525


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 63/141 (45%), Gaps = 30/141 (21%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECP----------------  908
             S  G  NVG++ +G+ CP L+ +    + ++ D G L +   C                 
Sbjct  466   SCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTD  525

Query  909   ------------SLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
                         +LE L+L  C  +S+ GL AIA  CT L+ L +  C  I + G+ ++G
Sbjct  526   KVVSSMAGLHGWTLEVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRCA-ITDFGIASLG  584

Query  1053  RY-CTKLQCLTIKDCPLVGDQ  1112
                   LQ L++  CPLV D+
Sbjct  585   HADQLNLQILSVSGCPLVSDK  605



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   337 bits (863),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 189/334 (57%), Positives = 232/334 (69%), Gaps = 19/334 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEK  410
             M  + ++ GD DF  G  L     + GL L LG H DVY P RKR+RI+ PFVV  V ++
Sbjct  1     MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVVSGVAKQ  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF------------  554
             +PSIE LPDECLFE+FRRL GG ERS+ ACVSKRWLML+SS+   EI             
Sbjct  61    QPSIEILPDECLFEVFRRLPGGHERSACACVSKRWLMLLSSIYRDEICTTVTTHFVEPEN  120

Query  555   RSKSHQDLSIADKVNGASNDVE--MSPADEDL-EVECDGYLSRSVEGKKATDVRLAAIAV  725
             RS+S +    A        D    + P DE+  E +  GYLSR +EGKKA+DVRLAAI+V
Sbjct  121   RSESQKADEFAQPKEKGEFDCPNGIKPEDEEFQEADSHGYLSRCLEGKKASDVRLAAISV  180

Query  726   GTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIAREC  905
             GT+SRGGLGKL +RG+ S   +T++G+ AI RGCPSL VLSLWN+ +VGDEGL  IA  C
Sbjct  181   GTASRGGLGKLSIRGNTSTSRLTDLGLKAISRGCPSLGVLSLWNLSSVGDEGLSAIATGC  240

Query  906   PSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTI  1085
              SLEKLDLC CP+I++KGL+AIA  C NLTS+TIESC NIGN  L+A+GR C  L+C+TI
Sbjct  241   HSLEKLDLCHCPAITDKGLIAIAMNCPNLTSVTIESCLNIGNGSLQALGRTCPNLKCITI  300

Query  1086  KDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             K+CPLVGDQG+ASL SSA   +TK    ALNI+D
Sbjct  301   KNCPLVGDQGIASLFSSAGHTITKANFQALNISD  334


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 92/205 (45%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G    D+ L  +  G + RG        GL KL      S RG+++VG+ A+G GCP+LK
Sbjct  344   GSAMVDLALGGLH-GVNERGFWVMGKGQGLHKLKSLSIASCRGVSDVGLEALGNGCPNLK  402

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC---------TN-  989
             V  L   P V D G++  A+   SL+ L L  C  I+  G++ I   C         TN 
Sbjct  403   VFGLQKCPLVSDNGVVSFAKAAGSLQSLRLEDCHRITQFGVLGILANCGGKLKAFALTNC  462

Query  990   ------------------LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                               L SLTI +CP +G+ GL  +GR C  L  + +     + D G
Sbjct  463   LGIRDIDFEFPLTTSCWSLRSLTIRNCPGLGDVGLGMLGRLCPGLTHVDLTGLQGITDSG  522

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  L+  +   L KV L   +N+TD
Sbjct  523   ILPLVQRSGVDLVKVNLSGCVNLTD  547



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 226/298 (76%), Gaps = 25/298 (8%)
 Frame = +3

Query  309   DLGLMLSLGHADVYCPSRKRARITGPFVVE----VQEKKPSIEALPDECLFEIFRRLSGG  476
             DLG +LS+G   VY P  KRAR    F  E     Q +KPSIE LPDECLFEIFRRL GG
Sbjct  2     DLGCLLSIGS--VYYPPSKRARKDSQFAFEGSDFEQVRKPSIEVLPDECLFEIFRRLDGG  59

Query  477   RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVEC  656
             +ERSS ACVSK+WLML+SS+R  ++ +S +   +    K++  S+D EM+  +ED E+E 
Sbjct  60    KERSSCACVSKKWLMLLSSIRKVDLCKSPAADKVIQPLKLDN-SDDTEMTTGEEDQELEN  118

Query  657   DGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSL  836
             DGYL+R +EGKKATD+RLAAIAVGTSSRGGLGKL +RGSNS RG+TN+G+SA+ +GCPSL
Sbjct  119   DGYLTRCLEGKKATDIRLAAIAVGTSSRGGLGKLSIRGSNSFRGVTNLGLSAVAQGCPSL  178

Query  837   KVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESC  1016
             K LSLWNV +VGDEGL+EIA+ CP LEKLDLCQCPSISN+                  +C
Sbjct  179   KSLSLWNVSSVGDEGLIEIAKGCPLLEKLDLCQCPSISNR------------------AC  220

Query  1017  PNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITDF  1190
               IGNEGL+AIGR+C+KLQ ++I+DC LVGD GV+SLLSSAS+VLTKVKL ALNITDF
Sbjct  221   SRIGNEGLQAIGRFCSKLQSISIRDCTLVGDHGVSSLLSSASSVLTKVKLQALNITDF  278


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 79/167 (47%), Gaps = 29/167 (17%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
              S RG T+V + AIG+GC +LK + L     V D GL+  A+   SLE L L +C  ++ 
Sbjct  324   TSCRGTTDVSLEAIGKGCTNLKQMCLRKCCFVSDNGLVGFAKAAGSLESLQLEECNRVTQ  383

Query  954   KGLVA----------------------------IAERCTNLTSLTIESCPNIGNEGLRAI  1049
              G+++                            +   C +L SL++ +CP  G+  L  +
Sbjct  384   AGIISALSNCGAKLRSLTLVKCMGIKDIGSAVPMLSSCISLRSLSVRNCPGFGSASLALV  443

Query  1050  GRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             GR C +LQ + +     + D G+ SLL S    L KV L+  LN+TD
Sbjct  444   GRLCPQLQNVDLSGLYGMTDAGILSLLESLEEGLVKVNLNGCLNLTD  490



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 189/320 (59%), Positives = 229/320 (72%), Gaps = 43/320 (13%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV----EVQEK  410
             MPTL+NYSG D+     S                 + PS KRARI  PFV+      QEK
Sbjct  1     MPTLINYSGKDELYNERS-----------------FYPSCKRARINAPFVLWGQESEQEK  43

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             + SI  LPDECLFEIFR L G +ERS+ ACVSK WL L+SS+R +E+             
Sbjct  44    RSSINVLPDECLFEIFRHLPG-QERSNCACVSKHWLTLLSSIRRAEMC------------  90

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
                    D++     +D EV  DG L+RSVEGKKATDVRLAAIAVGT++RGGLGKL +RG
Sbjct  91    -------DIDTVMVSDDKEV--DGCLTRSVEGKKATDVRLAAIAVGTAARGGLGKLSIRG  141

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             SNS+ G+TN G+SAI RGCPSLK LS+WNV ++GDEGL EIA EC  LEKLDLCQCPSI+
Sbjct  142   SNSSHGVTNSGLSAIARGCPSLKSLSVWNVSSIGDEGLFEIANECHVLEKLDLCQCPSIT  201

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             NKGL+AIAE C NLT+L+IESC NIGN+ ++AI + CTKL+ ++IKDCPLVGDQG+ASLL
Sbjct  202   NKGLIAIAENCPNLTTLSIESCANIGNDSIQAIAQGCTKLESISIKDCPLVGDQGLASLL  261

Query  1131  ssasavlTKVKLHALNITDF  1190
             SS+S+VL KVKL +LNI+DF
Sbjct  262   SSSSSVLAKVKLQSLNISDF  281


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 67/123 (54%), Gaps = 2/123 (2%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL  L     +S  G+T++ + AI +GC +LK +SL N   + + GLL +++   SLE +
Sbjct  317   GLKSLASLSISSCLGVTDLSLEAIAKGCSTLKQISLRNCCFMSNNGLLALSKSAESLENM  376

Query  924   DLCQCPSISNKGLVAIAERCTN-LTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCP  1097
              L  C  I+  G+++    C++   SL++  C  + +   +  +   C  L+CL+IK+CP
Sbjct  377   HLEDCNRITLPGVISALSNCSSKFRSLSLVKCMGLRDMAFQDVVLNPCISLRCLSIKNCP  436

Query  1098  LVG  1106
               G
Sbjct  437   AFG  439



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   335 bits (860),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 236/319 (74%), Gaps = 12/319 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  410
             M  L+ +SG DDF  G    +  + GL LSLGH ADV  P RKR+RI+ PFV      EK
Sbjct  1     MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFEK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             + SI+ LPDECLFEIF+R+ GG ERS+ ACVS+RWL ++S++   E   + ++      D
Sbjct  61    EVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSNPTNLSFKSQD  120

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             +V+G ++        ED EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +R 
Sbjct  121   EVSGNNS--------EDQEVENCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLMIRX  172

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             SNS  G+TN+G+ AI  GCPSL+VLSLWNV +VGDEGL EIA+ C  LEKLDL QCP+IS
Sbjct  173   SNSVCGVTNLGLKAISHGCPSLRVLSLWNVSSVGDEGLCEIAKRCHLLEKLDLTQCPAIS  232

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGL+AIA++C NLT +++E C NIGNEGL+AIG+ C  L+ ++IK+C LVGDQG+A LL
Sbjct  233   DKGLIAIAKKCPNLTDVSLEFCSNIGNEGLQAIGQCCPNLRSISIKNCRLVGDQGIAGLL  292

Query  1131  ssasavlTKVKLHALNITD  1187
             SS S VLTKVKL AL I+D
Sbjct  293   SSTSYVLTKVKLQALTISD  311


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 79/177 (45%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S +G+T+ G+ A+G+GCP+LK   L     V D GL+   +   SLE L
Sbjct  348   GLQKLKSFTVASCQGVTDTGLEALGKGCPNLKQFCLRKCLFVSDSGLVSFCKAARSLESL  407

Query  924   DLCQCPSISNKGL-------------VAIA---------------ERCTNLTSLTIESCP  1019
              L +C  I+  G              VA A                 C +L SL+I  CP
Sbjct  408   HLEECHRITQFGFFGALSTGGSKLKSVAFASCLGLKDVNFGSPAVSPCQSLRSLSIRRCP  467

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               GN GL  +G+ C +L+ +       + D G   L+ +  A L KV L   +N+TD
Sbjct  468   GFGNVGLALLGKLCPQLEHVDFSGLEAITDAGFLPLVENCEAGLVKVNLSGCVNLTD  524



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   334 bits (857),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 196/322 (61%), Positives = 236/322 (73%), Gaps = 29/322 (9%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             M  L +Y+G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      
Sbjct  1     MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+++ SI+ LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI          
Sbjct  61    QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEIC---------  111

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                          M+P   DLE+E DGYLSR +EGKKATDVRLAAIAVGT   GGLGKL 
Sbjct  112   -------------MTPEAVDLEIESDGYLSRCLEGKKATDVRLAAIAVGTGGHGGLGKLL  158

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNS+  +TN+G+ AI RGCPSL+VLSLWNV ++ DEGL+EIA  C  LEKLDLC CP
Sbjct  159   IRGSNSSCRVTNLGLGAIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQLEKLDLCGCP  218

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+K LVAIA+ C NLT+LTIESCP IGN GL+A+G++C  L+ ++IK+CPLVGDQGVA
Sbjct  219   TISDKALVAIAKNCHNLTALTIESCPRIGNAGLQAVGQFCPNLKSISIKNCPLVGDQGVA  278

Query  1122  sllssasavlTKVKLHALNITD  1187
             SLLSSAS  LTKVKLHALNITD
Sbjct  279   SLLSSASYALTKVKLHALNITD  300


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 94/204 (46%), Gaps = 36/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +  VG        S  GL KL      S +G+T++G+ A+G+GCP+LK 
Sbjct  310   GKAITDLDLTGLQNVGERGFWVMGSGHGLQKLKSLTVTSCQGVTDMGLEAVGKGCPNLKQ  369

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL--------------------  962
               L     + D GL+ +A+   SLE L L +C  I+  G+                    
Sbjct  370   FCLRKCAFLSDNGLVSLAKVAASLESLQLEECHHITQYGVFGALVSCGGKLKSLALVNCF  429

Query  963   --------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
                     + +   C +L+SL+I +CP  GN  L  +G+ C +LQ L +     + + G 
Sbjct  430   GIKDTVEGLPLMTPCKSLSSLSIRNCPGFGNASLCMVGKLCPQLQRLDLSGALRITNAGF  489

Query  1119  asllssasavlTKVKLHA-LNITD  1187
               LL S  A L KV L   +N+TD
Sbjct  490   LPLLESCEASLIKVNLSGCMNLTD  513



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   334 bits (857),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 230/323 (71%), Gaps = 21/323 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             M  ++ +SG DDF  G SL +   +    L LG   DVY P RKR+R+  PFV +     
Sbjct  1     MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q++K SIE+LPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+   EI   K+    S
Sbjct  61    QKQKTSIESLPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKDEICVIKN----S  116

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
              A+ +    +DVE            +GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL 
Sbjct  117   SAENIKKDGDDVEFGG---------EGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLS  167

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG+N  RG+T+VG+ A+  GCPSLK LSLWNV  VGDEGL+EIA  C  LEKLDLC+CP
Sbjct  168   IRGTNMCRGVTSVGLKAVSHGCPSLKSLSLWNVSTVGDEGLMEIANGCHQLEKLDLCKCP  227

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I++K LVAIA+ C NLT L++ESCPN+GNEGLRAIG++C  L+ +TIKDC  V DQG  
Sbjct  228   AITDKALVAIAKNCQNLTELSLESCPNVGNEGLRAIGKFCPDLRSITIKDCTGVSDQG-I  286

Query  1122  sllssasavlTKVKLHALNITDF  1190
             + L S S VLTKVKL AL+++D 
Sbjct  287   AGLFSTSLVLTKVKLQALSVSDL  309


 Score = 77.0 bits (188),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 93/205 (45%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S +G        GL KL      S RG+T++G+ A+G+GCP+LK
Sbjct  318   GKSVTDLVLNCLP-NVSEKGFWVMGNGSGLQKLKSLTVASCRGVTDIGLEAVGKGCPNLK  376

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
             +  L     + D GL+  A+   SL+ L L +C  I+  GL  +                
Sbjct  377   IAHLHKCAFLSDNGLISFAKAASSLQTLRLEECHRITQFGLFGVLFNCGGKLKAISVVRC  436

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SLTI +CP  GN  L  +G+ C KLQ + +     V D G
Sbjct  437   YGIKDLSLVLPTVSPCESLRSLTISNCPGFGNASLSVLGKLCPKLQHVELSGLDGVTDAG  496

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  +L S+ A L KV L    N+TD
Sbjct  497   LLPVLESSEAGLVKVNLSGCTNVTD  521



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 227/325 (70%), Gaps = 24/325 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             M  ++ +SG DDF    S+ +   +    LSLG   DVY P RKR+R+  PFV +     
Sbjct  1     MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q++K SIEALPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+  SEI  +K      
Sbjct  61    QKQKTSIEALPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKSEISVNK------  114

Query  582   IADKVNGASNDVEMSPADE--DLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
                      N    +P  E  D+E    GYLSRS+EGKKATDVRLAAIAVGTSSRGGLGK
Sbjct  115   ---------NTTVENPEKEGDDVEFGGKGYLSRSLEGKKATDVRLAAIAVGTSSRGGLGK  165

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RGSN   G+T+ G+ A+ RGCPSLK LSLWNV  VGDEGL+EIA  C  LEKLDLC+
Sbjct  166   LSIRGSNIVCGVTSHGLKAVARGCPSLKALSLWNVATVGDEGLIEIANGCHQLEKLDLCK  225

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CP+I++K LVAIA+ C NLT L++ESCPNIGNEGL AIG+ C+ L+ ++IKDC  V DQG
Sbjct  226   CPAITDKALVAIAKNCQNLTELSLESCPNIGNEGLLAIGKLCSNLRFISIKDCSGVSDQG  285

Query  1116  vasllssasavlTKVKLHALNITDF  1190
             +A L SS S  LTKVKL AL ++D 
Sbjct  286   IAGLFSSTSLFLTKVKLQALTVSDL  310


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 92/205 (45%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S RG        GL KL      S RG+T++G+ A+G+GCP+LK
Sbjct  319   GKSVTDLVLNCLP-NVSERGFWVMGNGNGLQKLKSLTVASCRGVTDIGLEAVGKGCPNLK  377

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
             +  L     + D GL+  A+   SLE L L +C  I+  G   +                
Sbjct  378   IAHLHKCAFLSDNGLISFAKAASSLESLRLEECHRITQLGFFGVLFNCGAKLKAISLVSC  437

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I +CP  GN  L  +G+ C +LQ + +     V D G
Sbjct  438   YGIKDLNLVLPTVSPCESLRSLSISNCPGFGNASLSVLGKLCPQLQHVELSGLEGVTDAG  497

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  LL S+ A L KV L    N+T+
Sbjct  498   LLPLLESSEAGLVKVNLSGCTNVTN  522



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 187/336 (56%), Positives = 241/336 (72%), Gaps = 21/336 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLG-HADVYCPSRKRARITGPFVV-EVQEK  410
             M  + N+SGDD F  G ++  +  +  L LSLG H DVY P  KR+R+  PFV  E ++K
Sbjct  1     MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTEKKQK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
               SI+ LPDECLFE+ RRLS G+ERS++ACVSKRWLML+SS+   E   S  +  L   +
Sbjct  61    LSSIDVLPDECLFEVLRRLSDGKERSASACVSKRWLMLLSSIHGDETVISDLNPSLETEE  120

Query  591   K-VNGA---------------SNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIA  722
             + +  A               SN  E++ A E  ++E +G+LSR ++GKKATDVRLAAIA
Sbjct  121   RSIQTALVKPVDCVKKGEVLDSNGAEVADA-ESQDIEGEGHLSRCLDGKKATDVRLAAIA  179

Query  723   VGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARE  902
             VGT S GGLGKL +RGSN  RG+T+ G+ AI RGCPSL+ LSLWNV +V DEGL+EIA+ 
Sbjct  180   VGTPSHGGLGKLSIRGSNPIRGVTDTGLKAIARGCPSLRALSLWNVSSVSDEGLIEIAQG  239

Query  903   CPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLT  1082
             C  LEKLDLCQCP+I++  L+AIA+ C NLTSLTIESC  IGNE L+A+GR+C KL+ ++
Sbjct  240   CHLLEKLDLCQCPAITDMSLMAIAKNCPNLTSLTIESCSKIGNETLQAVGRFCPKLKFVS  299

Query  1083  IKDCPLVGDQGvasllssasavlTKVKLHALNITDF  1190
             +K+CPL+GDQG+ASL SSA  VLTKVKL+ALNI+D 
Sbjct  300   LKNCPLIGDQGIASLFSSAGNVLTKVKLYALNISDI  335


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 83/177 (47%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      +  G+T++G+ A+G+GCP+LK+  L     + D GL+  A+   +LE L
Sbjct  371   GLQKLRSLAITACHGVTDLGLEALGKGCPNLKLFCLRKCTILSDNGLVAFAKGSVALENL  430

Query  924   DLCQCPSISNKGLVAI----------------------------AERCTNLTSLTIESCP  1019
              L +C  I+  G V +                               C +L SL+I +CP
Sbjct  431   QLEECHRITQAGFVGVLLSCGKKLKVLSMVNCFGVKELACRFPSVLPCNSLQSLSIRNCP  490

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
              +GN  L  +GR C KL  L +     V D+G+  L+ S  A L KV L   +N+TD
Sbjct  491   GVGNATLAIVGRLCPKLTHLELSGLLEVTDEGLFPLVQSCEAGLVKVNLSGCVNVTD  547



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 228/321 (71%), Gaps = 17/321 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  404
             M  L   SG DDF  G  +     + GL+L LG + DVY  +RKR+RI+ PFV      +
Sbjct  1     MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERFE  60

Query  405   EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             +K+ SIE LPDECLFEIFRRL GG ERS+ A VSKRWL L+S++   EI   K   +   
Sbjct  61    QKQVSIEVLPDECLFEIFRRLDGGEERSACASVSKRWLSLLSNIHRDEIRSLKPESE---  117

Query  585   ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
                       VE+    ED +VE DGYLSRS+EGKKATD+RLAAIAVGT+SRGGLGKL +
Sbjct  118   --------KKVELVSDAEDPDVERDGYLSRSLEGKKATDIRLAAIAVGTASRGGLGKLSI  169

Query  765   RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPS  944
              G+NS RG+T+ G+ AI RGCPSL+VLSLWN  +VGDEGL EIA  C  LEKLDLCQCP+
Sbjct  170   HGNNSTRGVTSAGLRAIARGCPSLRVLSLWNTSSVGDEGLCEIANGCHQLEKLDLCQCPA  229

Query  945   ISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
             I+++ L+ IA+ C  L  LTIESC +IGNEGL+A+GR+C  L+ ++IKDC LVGDQG+AS
Sbjct  230   ITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIAS  289

Query  1125  llssasavlTKVKLHALNITD  1187
             LLSSA+  L KVKL  LNITD
Sbjct  290   LLSSATYSLEKVKLQRLNITD  310


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 13/153 (8%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +    S RG        GL KL      S  G+T++G+ A+G+GCP+LK
Sbjct  320   GMAVTDLFLTGLP-HVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLK  378

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
                L     + D GL+  A+   SLE L L +C  I+  G       C   L +L++ SC
Sbjct  379   QFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKLKALSLVSC  438

Query  1017  PNIGNE--GLRAIGRYCTKLQCLTIKDCPLVGD  1109
               I ++  G+R++   C  L+ L+I++CP  GD
Sbjct  439   LGIKDQNLGVRSVSP-CKSLRSLSIRNCPGFGD  470



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   331 bits (849),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 229/322 (71%), Gaps = 19/322 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  401
             M  L  ++G DDF  G S+     + G  LSLG   D+Y P  KR+R + PFV       
Sbjct  1     MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q K+ SI+ LP+ECLFEIF+RL GG ERS+ ACVSK+WL L+S++   E     ++  + 
Sbjct  61    QNKQVSIDVLPEECLFEIFKRLPGGEERSACACVSKKWLSLLSNIHRDEFCNKNTNLSVK  120

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
               D+              ED E+E  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL 
Sbjct  121   SQDETT------------EDQEIESCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLM  168

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSNSAR +TN+G+ AI  GCPSL+VLS+WNV +VGDEGL EIA+ C  LEKLDL QCP
Sbjct  169   IRGSNSARPVTNLGLKAISHGCPSLRVLSMWNVSSVGDEGLCEIAKRCHLLEKLDLSQCP  228

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+KGL AIA  C NLT L +ESC NIGNEGL+AIG+ C KL+ ++IK+CPLVGDQG+A
Sbjct  229   AISDKGLAAIARSCPNLTDLALESCSNIGNEGLQAIGKCCPKLKSVSIKNCPLVGDQGIA  288

Query  1122  sllssasavlTKVKLHALNITD  1187
             SL+SSAS VL KVKL AL ITD
Sbjct  289   SLVSSASDVLEKVKLQALTITD  310


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 85/205 (41%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +      RG        GL KL      S +G T+ G+ A+ +GCP+LK
Sbjct  320   GKAVTDLVLTNLP-NVCERGFWVMGNGHGLQKLKSLAVTSCQGATDTGLEAVAKGCPNLK  378

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA-----------------  968
                L     + D GL+   +   SLE L L +C  I+  G                    
Sbjct  379   QFCLRKCLYLSDSGLVSFCKAAGSLESLHLEECHRITQYGFFGALSNSGAKLKALAFVYC  438

Query  969   -----------IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                        +   C +L SL+I +CP  GN G+  +G+ C +LQ +       + D G
Sbjct  439   LGLKDLNLGLPVVSPCESLRSLSIRNCPGFGNSGMAVLGQLCPQLQHVDFSGLEGITDAG  498

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                LL S  A L KV L   +N+TD
Sbjct  499   FLKLLKSTEAGLVKVNLSGCVNLTD  523



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   331 bits (849),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/322 (57%), Positives = 226/322 (70%), Gaps = 24/322 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQ  404
             M  L  +SG +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+
Sbjct  1     MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  405   EK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
              K   SIE LPDECLFEIFRRLSGG+ERS+ A VSKRWLML+S++ + E+          
Sbjct  61    SKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHEL----------  110

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                     S DV  S   ED+E+E DGYLSRS+EGKKATD+RLAAI+VGT+ RGGLGKL 
Sbjct  111   -------KSEDVVASKEVEDIEIESDGYLSRSLEGKKATDLRLAAISVGTAGRGGLGKLV  163

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG+N    +T++G+ AI RGC SL+ LSLWN+ ++ D GL EIA+    LEKLDLC+CP
Sbjct  164   IRGNNHVSKVTDLGLKAIARGCQSLRALSLWNLSSIRDGGLCEIAKASHQLEKLDLCRCP  223

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             ++S+K +V IA  C  LT +TIESC  IGNE LRAIG++CTKL+ + IKDCPLVGDQG+A
Sbjct  224   AVSDKAVVEIARNCPKLTDITIESCAQIGNESLRAIGQFCTKLKSIVIKDCPLVGDQGIA  283

Query  1122  sllssasavlTKVKLHALNITD  1187
             SLLS  +  L KVKL ALN++D
Sbjct  284   SLLSLNTCALNKVKLQALNVSD  305


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 88/205 (43%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S +G        GL KL     +S  G+T++G+ ++G+G P+LK
Sbjct  315   GKAVTDLVLTDLK-NVSEKGFWVMGNGHGLQKLKSFTISSCNGVTDMGLESVGKGSPNLK  373

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-----------  986
                L     + D GL+  A+   SLE L L +C  I+  G   +   C+           
Sbjct  374   HFCLRKCSFLSDNGLVSFAKAARSLECLQLEECHRITQFGFFGVVLNCSASLKALSLISC  433

Query  987   -----------------NLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                              +L SLTI +C   GN  L  +G+ C +LQ +       + D G
Sbjct  434   LGIKDINSELPIPASSGSLRSLTIRNCHGFGNRNLALLGKLCPQLQNVDFSGLVGIDDCG  493

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
               + L +  + L K+ L   +N+TD
Sbjct  494   FLAWLQNCQSGLVKINLSGCVNLTD  518



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   330 bits (845),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 229/323 (71%), Gaps = 20/323 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQE  407
             M  ++ +SG DDF    S+ +   +    L LG   DVY P RKR+R+  PFV   E  E
Sbjct  1     MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  408   KKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             +KP  S+EALPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+  +EI  +K      
Sbjct  61    QKPKTSVEALPDECLFEIFRRLPSGEDRSACACVSKRWLMLLSSICKNEICVNK------  114

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                  N     +E     +D+E   +GYLSRS+EGKKATDVRLAAIAVGTSSRGGLGKL 
Sbjct  115   -----NATVETIE--KEGDDVEFGGEGYLSRSLEGKKATDVRLAAIAVGTSSRGGLGKLS  167

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGSN  RG+T+ G+ A+ RGCPSLK LSLWNV  VGDEGL+EIA  C  LEKLDLC+CP
Sbjct  168   IRGSNMVRGVTSHGLKAVARGCPSLKALSLWNVATVGDEGLIEIANGCHQLEKLDLCKCP  227

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I++K LVAIA+ C NLT L+ ESCPNIGNEGLRAIG+ C+ L+ ++IKDC  V D G+A
Sbjct  228   AITDKALVAIAKNCQNLTELSFESCPNIGNEGLRAIGKLCSNLKSISIKDCTGVSDHGIA  287

Query  1122  sllssasavlTKVKLHALNITDF  1190
              LLSS S VL+KVKL AL ++D 
Sbjct  288   GLLSSTSLVLSKVKLQALTVSDL  310


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 91/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S RG        GL KL      S +G+T++G+ A+G+GCP+LK
Sbjct  319   GKSVTDLVLNCLP-NVSERGFWVMGNGNGLQKLKSLTVASCKGVTDIGLEAVGKGCPNLK  377

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
             +  L     + D GL+  A+   SLE L L +C  I+  G   +                
Sbjct  378   IAHLHKCAFLSDNGLMSFAKAASSLESLRLEECHRITQLGFFGVLFNCGAKLKAISLVSC  437

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I +C   GN  L  +G+ C +LQ + +     V D G
Sbjct  438   YGIKDLNLVLPTVSPCESLRSLSISNCSGFGNASLSVLGKLCPQLQHVELSGLEGVTDAG  497

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  LL S+ A L KV L    NITD
Sbjct  498   LLPLLESSEAGLVKVNLSGCTNITD  522



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   330 bits (846),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 235/325 (72%), Gaps = 10/325 (3%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-  410
             M  +V++SGD+ F   + L     +    LSLG H +VY   RKR+RIT PF+V  + K 
Sbjct  1     MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSGEPKQ  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL-SIA  587
             KPSIE LPDECLFE+FRRL GG+ERS+ A VSKRWLML+SS+   EI  +K    + S  
Sbjct  61    KPSIEILPDECLFEVFRRLEGGQERSACASVSKRWLMLLSSICKDEICTTKEEPKIGSDL  120

Query  588   DKVNGASNDVEMSPADEDLEVECD-----GYLSRSVEGKKATDVRLAAIAVGTSSRGGLG  752
              K + ++   E      DL  EC      GYLSRS+EGKKA+DVRLAAI+VGT+SRGGLG
Sbjct  121   PKADDSTKKAEEKGEFIDLTEECQETDSHGYLSRSLEGKKASDVRLAAISVGTASRGGLG  180

Query  753   KLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLC  932
             KL +RG++S R +TN+G+ +I RGCPSLKVLSLWN+ +VGDEGL EIA+ C SLEKLDL 
Sbjct  181   KLSIRGNSSTRRLTNLGLKSISRGCPSLKVLSLWNLSSVGDEGLSEIAKGCRSLEKLDLS  240

Query  933   QCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
              CP++++KGL+AIA  C NLTS+T+ESC NIGNE L+A+G  C  L+C+T+K+CPLVGDQ
Sbjct  241   HCPAVTDKGLIAIAMNCPNLTSVTLESCSNIGNESLKALGSNCPNLKCVTLKNCPLVGDQ  300

Query  1113  GvasllssasavlTKVKLHALNITD  1187
             G+ASL +SA  VL K  L  LNI+D
Sbjct  301   GIASLFTSAGHVLAKANLQTLNISD  325


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 74/166 (45%), Gaps = 29/166 (17%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL-----------  923
             S +G+++ G+ AIGRGCP LKV  L   P V D G++   R   SLE L           
Sbjct  373   SCQGVSDAGLDAIGRGCPDLKVFRLRKCPLVSDNGVVSFVRAAASLESLHLDESHRITQC  432

Query  924   ----------------DLCQCPSISNKGLV-AIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
                             DL  C  I +   V  +   C +L SLTI  CP +GN GL  +G
Sbjct  433   GIYGVLTNCGGKLKALDLANCLGIRDVDFVFPLTSFCNSLRSLTIRDCPGLGNSGLGMVG  492

Query  1053  RYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             R C KL  + +     + D GV   +  A A L K+ L    N+TD
Sbjct  493   RLCPKLTHVDLSGLKGITDAGVLPFVQRADAGLVKLNLSGCANLTD  538


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 56/128 (44%), Gaps = 28/128 (22%)
 Frame = +3

Query  816   GRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLT  995
             G+G  ++K L++ +   V D GL  I R CP L+   L +CP +S+ G+V+      +L 
Sbjct  360   GQGLQNMKSLTITSCQGVSDAGLDAIGRGCPDLKVFRLRKCPLVSDNGVVSFVRAAASLE  419

Query  996   SLTIESCPNIGNEGLRAI----------------------------GRYCTKLQCLTIKD  1091
             SL ++    I   G+  +                              +C  L+ LTI+D
Sbjct  420   SLHLDESHRITQCGIYGVLTNCGGKLKALDLANCLGIRDVDFVFPLTSFCNSLRSLTIRD  479

Query  1092  CPLVGDQG  1115
             CP +G+ G
Sbjct  480   CPGLGNSG  487



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   331 bits (848),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 244/348 (70%), Gaps = 25/348 (7%)
 Frame = +3

Query  195   NLFCSLFGGFF*KET---AMP----------TLVNYSGDDDFLAGSSLCSA-DLGLMLSL  332
             +LF +LF GFF  +     +P           L +    DDF  G    +  + GL+LSL
Sbjct  20    SLFFALFRGFFGGKLCTFGLPEVFELHPCQSYLASPVSKDDFCPGGIYTNPKEAGLLLSL  79

Query  333   GH-ADVYCPSRKRARITGPFVVE--VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACV  503
             GH ADV  P RKR+RI+ PF+      EK+ SI  LPDECLFEIF+R+ GG ERS+ ACV
Sbjct  80    GHHADVLFPPRKRSRISAPFIFSGGYFEKEVSINVLPDECLFEIFKRIPGGEERSACACV  139

Query  504   SKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVE  683
             SKRWL ++S++   E   + ++Q     D+V+G           ED EVE  GYLSRS+E
Sbjct  140   SKRWLNVLSNINRDEFSSNTTNQSFKSQDEVSGNK--------AEDQEVEGCGYLSRSLE  191

Query  684   GKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVP  863
             GKKATDVRLAAIAVGT+SRGGLGKL + G+NS RG+TN+G+ AI  GCPSL+VLSLWN+ 
Sbjct  192   GKKATDVRLAAIAVGTASRGGLGKLMIXGNNSVRGVTNLGLKAISHGCPSLRVLSLWNMS  251

Query  864   NVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLR  1043
             ++GDEGL EIA  C  LEKLDL +CP+IS+KGL+AIA++C NLT +++ESC NIGNEGL+
Sbjct  252   SIGDEGLCEIANRCXLLEKLDLSRCPAISDKGLIAIAKKCPNLTDVSLESCSNIGNEGLQ  311

Query  1044  AIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             AIG+ C  L+ ++IK+C LVGDQG+ SLLSS S VLTKVKL AL I+D
Sbjct  312   AIGQCCPNLKSISIKNCHLVGDQGIXSLLSSISYVLTKVKLQALTISD  359


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 90/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L +++   + RG        GL KL      S +G+T+ G+ A+G+GCP+LK
Sbjct  369   GNAVTDLVLTSLS-NVTERGFWVMGNGQGLQKLKSFTVTSCQGVTDTGLEAVGKGCPNLK  427

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
                L     V D GL+   +   SLE L L +C  I+  GL  +                
Sbjct  428   QFCLXKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGSKLKSLAFVSC  487

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I SCP  GN GL  +G+ C +LQ +       + D G
Sbjct  488   LGLKDLNFGSPGVSPCQSLXSLSIRSCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVG  547

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                L+ +  A L KV L   +N+TD
Sbjct  548   FLPLVENCEAGLVKVNLSGCVNLTD  572


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 68/158 (43%), Gaps = 33/158 (21%)
 Frame = +3

Query  726   GTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIAREC  905
             G S    L  L +R   S  G  NVG++ +G+ CP L+ +    + ++ D G L +   C
Sbjct  499   GVSPCQSLXSLSIR---SCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENC  555

Query  906   P----------------------------SLEKLDLCQCPSISNKGLVAIAERCTNLTSL  1001
                                          ++E L+L  C  +S+ GL AIA  CT L+ L
Sbjct  556   EAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDL  615

Query  1002  TIESCPNIGNEGLRAIGRY-CTKLQCLTIKDCPLVGDQ  1112
              +  C  I N G+ ++       LQ L+I  CPLV D+
Sbjct  616   DVSRCA-ITNFGIASLAHADQLNLQXLSISGCPLVSDK  652



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   331 bits (848),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 230/309 (74%), Gaps = 12/309 (4%)
 Frame = +3

Query  273   DDFLAGSSLCSA-DLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEKKPSIEALPDE  440
             DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK+ SI  LPDE
Sbjct  59    DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKEVSINVLPDE  118

Query  441   CLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVE  620
             CLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D+V+G      
Sbjct  119   CLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQDEVSGNK----  174

Query  621   MSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNV  800
                  ED EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL + G+NS RG+TN+
Sbjct  175   ----AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLMIXGNNSVRGVTNL  230

Query  801   GISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER  980
             G+ AI  GCPSL+VLSLWN+ ++GDEGL EIA  C  LEKLDL +CP+IS+KGL+AIA++
Sbjct  231   GLKAISHGCPSLRVLSLWNMSSIGDEGLCEIANRCXLLEKLDLSRCPAISDKGLIAIAKK  290

Query  981   CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKV  1160
             C NLT +++ESC NIGNEGL+AIG+ C  L+ ++IK+C LVGDQG+ SLLSS S VLTKV
Sbjct  291   CPNLTDVSLESCSNIGNEGLQAIGQCCPNLKSISIKNCHLVGDQGIXSLLSSISYVLTKV  350

Query  1161  KLHALNITD  1187
             KL AL I+D
Sbjct  351   KLQALTISD  359


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 90/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L +++   + RG        GL KL      S +G+T+ G+ A+G+GCP+LK
Sbjct  369   GNAVTDLVLTSLS-NVTERGFWVMGNGQGLQKLKSFTVTSCQGVTDTGLEAVGKGCPNLK  427

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
                L     V D GL+   +   SLE L L +C  I+  GL  +                
Sbjct  428   QFCLXKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGSKLKSLAFVSC  487

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I SCP  GN GL  +G+ C +LQ +       + D G
Sbjct  488   LGLKDLNFGSPGVSPCQSLRSLSIRSCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVG  547

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                L+ +  A L KV L   +N+TD
Sbjct  548   FLPLVENCEAGLVKVNLSGCVNLTD  572


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 62/141 (44%), Gaps = 30/141 (21%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECP----------------  908
             S  G  NVG++ +G+ CP L+ +    + ++ D G L +   C                 
Sbjct  513   SCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTD  572

Query  909   ------------SLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
                         ++E L+L  C  +S+ GL AIA  CT L+ L +  C  I N G+ ++ 
Sbjct  573   KVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA-ITNFGIASLA  631

Query  1053  RY-CTKLQCLTIKDCPLVGDQ  1112
                   LQ L+I  CPLV D+
Sbjct  632   HADQLNLQXLSISGCPLVSDK  652



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   331 bits (848),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 240/324 (74%), Gaps = 17/324 (5%)
 Frame = +3

Query  267   GDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----VQEKKPSIE  425
             G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      Q+++ SI+
Sbjct  109   GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  426   ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGA  605
              LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +K+   L   + +   
Sbjct  169   VLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKTTGFLKPKETLISR  228

Query  606   SNDV----------EMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
             + D           E++P   DLE+E DGYLSR +EGKKATDVRLAAIAVGT   GGLGK
Sbjct  229   NTDESSEAKKKGGDEVTPEAVDLEIESDGYLSRCLEGKKATDVRLAAIAVGTGGHGGLGK  288

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RGSNS+  +TN+G+ AI RGCPSL+VLSLWNV ++ DEGL+EIA  C  LEKLDLC 
Sbjct  289   LLIRGSNSSCRVTNLGLGAIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQLEKLDLCG  348

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CP+IS+K LVAIA+ C NLT+LTIESCP IGN GL+A+G++C  L+ ++IK+CPLVGDQG
Sbjct  349   CPTISDKALVAIAKNCHNLTALTIESCPRIGNAGLQAVGQFCPNLKSISIKNCPLVGDQG  408

Query  1116  vasllssasavlTKVKLHALNITD  1187
             VASLLSSAS  LTKVKLHALNITD
Sbjct  409   VASLLSSASYALTKVKLHALNITD  432


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 93/204 (46%), Gaps = 36/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +  VG        S  GL KL      S +G+T++G+ A+G+GC +LK 
Sbjct  442   GKAITDLDLTGLQNVGERGFWVMGSGHGLQKLKSLTVTSCQGVTDMGLEAVGKGCXNLKQ  501

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL--------------------  962
               L     + D GL+ +A+   SLE L L +C  I+  G+                    
Sbjct  502   FCLRKCAFLSDNGLVSLAKVAASLESLQLEECXHITQYGVFGALVSCGGKLKSLALVNCF  561

Query  963   --------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
                     + +   C +L+SL+I +CP  GN  L  +G+ C +LQ L +     + + G 
Sbjct  562   GIKDTVEGLPLMTPCKSLSSLSIRNCPGFGNASLCMVGKLCPQLQRLDLSGALRITNAGF  621

Query  1119  asllssasavlTKVKLHA-LNITD  1187
               LL S  A L KV L   +N+TD
Sbjct  622   LPLLESCEASLIKVNLSGCMNLTD  645



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 241/323 (75%), Gaps = 20/323 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  401
             M  +  ++G++DF  G  + +   +  L LS+G   DVY PSRKR+RI+ PFV       
Sbjct  1     MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF-RSKSHQDL  578
             Q+K+ SIE LPDECLFEIFRRL GG ER + ACVSK WL L+S++   E+  +++S + +
Sbjct  61    QKKQASIEVLPDECLFEIFRRLPGGNERGACACVSKHWLSLLSNICKDELCCQNESAKKI  120

Query  579   SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
             +            ++    ED EVE DGYLSRS+EGKKATD+RLAAI VGT++ GGLGKL
Sbjct  121   T------------QVKSEVEDEEVEGDGYLSRSLEGKKATDIRLAAIVVGTANSGGLGKL  168

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RGSNS+RG+T VG+ AI RGCPSLKVLSLWN+P+VGDEG+ EIA  C  LEKLDL QC
Sbjct  169   FIRGSNSSRGVTKVGLRAIARGCPSLKVLSLWNLPSVGDEGVSEIANGCHKLEKLDLSQC  228

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             P+I++KGL+AIA+ C NLT L IESC NIGNEGL+A+G++CT LQ ++IK+CP +GDQG+
Sbjct  229   PAITDKGLLAIAKSCPNLTDLVIESCTNIGNEGLQAVGQHCTNLQSISIKNCPAIGDQGI  288

Query  1119  asllssasavlTKVKLHALNITD  1187
             A+L+SSA+ VLTKVKL ALNITD
Sbjct  289   AALVSSATNVLTKVKLQALNITD  311


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 88/205 (43%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  ++   S RG        GL KL      S  G+T+ G+ A+G+GCP+LK
Sbjct  321   GKAVTDLFLTNLS-NVSERGFWVMGNGQGLQKLKSMTVASCVGLTDTGLEAVGKGCPNLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC------------  983
                L     + D GL+  A+   SLE L L +C  I+  G       C            
Sbjct  380   QFYLHKCSFLSDNGLVSFAKSAVSLESLLLEECHRITQFGFFGSLLNCGANLKAASLVNC  439

Query  984   ----------------TNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                              +L S++I +CP  G+  L  +G+ C +LQ + +     V D G
Sbjct  440   FGMKDVKLDLPDLSPRNSLRSVSIRNCPGFGDGSLALLGKLCPQLQNVELSGLQGVTDAG  499

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                +L +  A L KV L   +N++D
Sbjct  500   FLPVLENCEAGLVKVNLSGCVNLSD  524



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 230/321 (72%), Gaps = 17/321 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE----VQE  407
             M  +  +SGD+    G      +    LSLG   DVY P +KR+R++ PFV +     Q+
Sbjct  1     MSQVFGFSGDNFCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFEQK  60

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             +K SIE+LPDECLFEIFRRL  G ERS++ACVSKRWLML+S++  SEI  +KS       
Sbjct  61    QKTSIESLPDECLFEIFRRLPVGEERSASACVSKRWLMLLSNICKSEICSNKST------  114

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
                  +SND      D + E   +GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +R
Sbjct  115   -----SSNDENKMECDSE-EFGGEGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLSIR  168

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GSNS RG+T +G+ A+  GCPSLK  SLWNV +VGDEGL+EIA  C  LEKLDLC+CP+I
Sbjct  169   GSNSERGVTTLGLKAVASGCPSLKSFSLWNVSSVGDEGLIEIANGCQKLEKLDLCKCPAI  228

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             S+K L+ +A++C NLT L++ESCP+I NEGL+AIG++C  L+ ++IKDC  VGDQG+A L
Sbjct  229   SDKALITVAKKCPNLTELSLESCPSIRNEGLQAIGKFCPNLKAISIKDCAGVGDQGIAGL  288

Query  1128  lssasavlTKVKLHALNITDF  1190
              SS S VLTKVKL AL ++D 
Sbjct  289   FSSTSLVLTKVKLQALAVSDL  309


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 92/205 (45%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S RG        GL KL      S RG+T+VGI A+G+GCP+LK
Sbjct  318   GKTVTDLVLNFLP-NVSERGFWVMGNANGLHKLKSLTIASCRGVTDVGIEAVGKGCPNLK  376

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              + L     + D GL+   +   SLE L L +C  I+  G   +                
Sbjct  377   SVHLHKCAFLSDNGLISFTKAAISLESLQLEECHRITQFGFFGVLFNCGAKLKALSMISC  436

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I +CP  GN  L  +G+ C +LQ + +     V D G
Sbjct  437   FGIKDLDLELSPVSPCESLRSLSICNCPGFGNATLSVLGKLCPQLQQVELTGLKGVTDAG  496

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  LL S+ A L KV L   +N+TD
Sbjct  497   LLPLLESSEAGLVKVNLSGCVNLTD  521



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 233/313 (74%), Gaps = 13/313 (4%)
 Frame = +3

Query  264   SGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE---VQEKKPSIEA  428
             +G DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      ++K+ SI  
Sbjct  12    AGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKKEVSINV  71

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D+V+G  
Sbjct  72    LPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQSFKSQDEVSGNK  131

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
                      ED EVE  GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +RG+NS RG
Sbjct  132   --------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLMIRGNNSVRG  183

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN+G+ AI  GCPSL+VLSLWN+ ++GDEGL EIA  C  LEKLDL +CP+IS+KGL+A
Sbjct  184   VTNLGLKAISHGCPSLRVLSLWNMSSIGDEGLCEIANRCHLLEKLDLSRCPAISDKGLIA  243

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IA++C NLT +++ESC NIGN  L+AIG+ C  L+ ++IK+C LVGDQG+ASLLSS S V
Sbjct  244   IAKKCPNLTDVSLESCSNIGNGSLQAIGQCCPNLRSISIKNCNLVGDQGIASLLSSTSCV  303

Query  1149  lTKVKLHALNITD  1187
             LTKVKL AL I+D
Sbjct  304   LTKVKLQALTISD  316


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 89/205 (43%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L +++   + RG        GL KL      S +G+T+ G+ A+G+GCP LK
Sbjct  326   GKAVTDLVLTSLS-NVTERGFWVMGNGQGLQKLKSFTVTSCQGVTDTGLEAVGKGCPDLK  384

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
                L     V D GL+   +   SLE L L +C  I+  GL                   
Sbjct  385   QFCLRKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGALSTGGSKLKSVAFVSC  444

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I SCP  GN GL  +G+ C +LQ +       + D G
Sbjct  445   LGLKDLNFGSPAVSPCQSLRSLSIRSCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVG  504

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
                L+ +  A L KV L   +N+TD
Sbjct  505   FLPLVENCEAGLVKVNLSGCVNLTD  529


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 63/141 (45%), Gaps = 30/141 (21%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECP----------------  908
             S  G  NVG++ +G+ CP L+ +    + ++ D G L +   C                 
Sbjct  470   SCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTD  529

Query  909   ------------SLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
                         +LE L+L  C  +S+ GL AIA  CT L+ L +  C  I + G+ ++G
Sbjct  530   KVVSSMAGLHGWTLEVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRCA-ITDFGIASLG  588

Query  1053  RY-CTKLQCLTIKDCPLVGDQ  1112
                   LQ L++  CPLV D+
Sbjct  589   HADQLNLQILSVSGCPLVSDK  609



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   327 bits (839),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 225/322 (70%), Gaps = 24/322 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQ  404
             M  L  +SG +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+
Sbjct  1     MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  405   EK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
              K   SIE LPDECLFEIFRRLS G+ERS+ A VSKRWLML+S++ + E+          
Sbjct  61    SKANVSIEILPDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHEL----------  110

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                     S D   S   ED+E+E DGYLSRS+EGKKATD+RLAAI+VGT+SRGGLGKL 
Sbjct  111   -------KSEDEVASKEVEDIEIESDGYLSRSLEGKKATDLRLAAISVGTASRGGLGKLV  163

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG+N    +T++G+ AI RGC SL+ LSLWN+ ++ DEGL EIA+    LEKLDLC+CP
Sbjct  164   IRGNNHVSKVTDLGLKAIARGCQSLRALSLWNLSSIRDEGLCEIAKASHQLEKLDLCRCP  223

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             ++S+K +V IA  C  LT +TIESC  IGNE +RAIG++C KL+ + IKDCPLVGDQG+A
Sbjct  224   AVSDKAVVEIARNCPKLTDITIESCAKIGNESMRAIGQFCPKLKSIVIKDCPLVGDQGIA  283

Query  1122  sllssasavlTKVKLHALNITD  1187
             SLLS  +  L KVKL ALN++D
Sbjct  284   SLLSLNTCALNKVKLQALNVSD  305


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 88/205 (43%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S +G        GL KL     +S  G+T++G+ ++G+G P+LK
Sbjct  315   GKAVTDLVLTDLK-NVSEKGFWVMGNGHGLQKLKSFTISSCNGVTDMGLESVGKGSPNLK  373

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-----------  986
                L     + D GL+  A+   SLE L L +C  I+  G   +   C+           
Sbjct  374   HFCLRKCSFLSDNGLVSFAKAARSLECLQLEECHRITQFGFFGVVLNCSASLKALSLISC  433

Query  987   -----------------NLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                              +L SLTI +C   GN  L  +G+ C +LQ +       + D G
Sbjct  434   LGIKDINSELPIPASSVSLRSLTIRNCHGFGNRNLALLGKLCPQLQNVDFSGLVGIEDCG  493

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
               + L +    L K+ L+  +N+TD
Sbjct  494   FLAWLQNCQLGLVKINLNGCVNLTD  518



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   324 bits (831),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 232/322 (72%), Gaps = 21/322 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  401
             M  ++ ++G +DF +G S+  +  +  L LSLG H DVY P  KR+RI+ PFV       
Sbjct  1     MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+++ +IE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++  +E    KS     
Sbjct  61    QKRQDTIEVLPDECLFEIFRRLPGGQERSACACVSKRWLNLLSNICPNERSSGKSQ----  116

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                      N+++ +   E++  E DG+LSRS+EGKKATD+RLAAIAVGT+ RGGLGKL 
Sbjct  117   ---------NNLDPTCGGEEVSSEDDGFLSRSLEGKKATDIRLAAIAVGTADRGGLGKLS  167

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGS  +  +T++G+ AI R CPSLK LSLW++P+VGDEGLLE+A  C  LEKLDLCQCP
Sbjct  168   IRGSKLSH-VTSLGLGAIARSCPSLKALSLWHLPSVGDEGLLEVANGCHQLEKLDLCQCP  226

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I+NK LVA+A  C NLT ++IESC +IGNEGL A+G++C  L+ ++IK+CP VGDQG+ 
Sbjct  227   NITNKFLVAVARNCPNLTDISIESCSSIGNEGLAAVGQFCQNLKSISIKNCPSVGDQGIV  286

Query  1122  sllssasavlTKVKLHALNITD  1187
              L+S A + LTK KL ALNITD
Sbjct  287   GLISRAGSALTKFKLQALNITD  308


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 90/201 (45%), Gaps = 38/201 (19%)
 Frame = +3

Query  696   TDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSL  851
             TD+ LA++    + RG        GL +L      + RG T++G+ ++G+GCP+LK L +
Sbjct  322   TDLTLASLH-NVTERGFWVMGNGHGLQRLRSLIVTACRGATDLGLESLGKGCPNLKQLCI  380

Query  852   WNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI--------------------  971
              +   + D GL+   +   SLE L L +C  I+  GL  +                    
Sbjct  381   RSSAFLSDGGLVSFMKSARSLESLQLEECHRITLSGLYGLVVGCGDKLKSLALTNCWGFK  440

Query  972   --------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
                        C +L S  + +CP  G+  L A+G+ C  LQ + +     + D+G+  L
Sbjct  441   DFDFGSPQVSPCKSLRSFAVRNCPGFGDACLVALGKICPHLQQVELSGLTGITDEGLLRL  500

Query  1128  lssasavlTKVKLHA-LNITD  1187
             L    A L KV L   +N+TD
Sbjct  501   LECCEAGLVKVNLSGCINLTD  521


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 61/116 (53%), Gaps = 4/116 (3%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE-IARECPSLEKLDLCQCPSISN  953
             S   I N G++A+G+ C +LK +S+ N P+VGD+G++  I+R   +L K  L Q  +I++
Sbjct  250   SCSSIGNEGLAAVGQFCQNLKSISIKNCPSVGDQGIVGLISRAGSALTKFKL-QALNITD  308

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAI--GRYCTKLQCLTIKDCPLVGDQG  1115
               L  I    T +T LT+ S  N+   G   +  G    +L+ L +  C    D G
Sbjct  309   VSLAVIGHYATAVTDLTLASLHNVTERGFWVMGNGHGLQRLRSLIVTACRGATDLG  364



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   323 bits (827),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 228/322 (71%), Gaps = 21/322 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE----VQ  404
             M  +  +SGD+   +GS   +  +     SLGH  D Y P +KR+R++ PFV +     Q
Sbjct  1     MSQVFGFSGDNFCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFTQ  60

Query  405   EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             ++K SIE+LPDECLFEIFRRL  G ERSS ACVSKRWLML+S++  SEI  +KS  +   
Sbjct  61    KQKTSIESLPDECLFEIFRRLPVGEERSSCACVSKRWLMLLSNICKSEICSNKSDDE---  117

Query  585   ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
              +K+ G S            E   +GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +
Sbjct  118   -NKMEGVSE-----------EFGGEGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLSI  165

Query  765   RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPS  944
             RGSNS  G+T +G+ A+  GCPSLK LSLWNV +VGDEGL+EIA  C  LEKLDLC+CP+
Sbjct  166   RGSNSGCGVTALGLKAVASGCPSLKALSLWNVSSVGDEGLIEIASGCQQLEKLDLCKCPA  225

Query  945   ISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
             IS+K L+A+A+ C NLT L++ESC NI NEGL+AIG+ C  L+ ++IKDC  VGDQG+A 
Sbjct  226   ISDKALIAVAKNCPNLTELSLESCSNIHNEGLQAIGKCCPNLKSMSIKDCAGVGDQGIAG  285

Query  1125  llssasavlTKVKLHALNITDF  1190
             L SS S  LTKVKL AL I+D 
Sbjct  286   LFSSTSLALTKVKLQALTISDL  307


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 92/205 (45%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S RG        GL KL      S RG+T+VG+ AIG+GCP+LK
Sbjct  316   GKTVTDLVLNFLP-NVSERGFWVMGNGNGLHKLKSLTIASCRGVTDVGLEAIGKGCPNLK  374

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              + L     + + GL+   +   SLE L L +C  I+  G   +                
Sbjct  375   SVQLLKCAFLSNNGLISFTKAASSLESLQLEECHRITQFGFFGVLFNCGAKLKAISLASC  434

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I +CP  GN  L  +G+ C +LQ + +     V D G
Sbjct  435   YGIKDLDLELSPVSPCESLRSLSIRNCPGFGNATLSVMGKLCPQLQQVELTGLKGVNDAG  494

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  LL S+ A L KV L   +N+TD
Sbjct  495   LLPLLESSEAGLIKVNLSGCVNLTD  519



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   323 bits (828),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 232/347 (67%), Gaps = 34/347 (10%)
 Frame = +3

Query  198   LFCSLFGGFF*KETAMPTLVN-YS---------GDDDFLAGSSLCS--ADLGLMLSL-GH  338
             LF   FG F  +   +P   + YS           +DF  G S+     D  L LSL  H
Sbjct  26    LFRGFFGSFPSRFHHLPWFFHLYSCRSSSPFPVSSEDFCTGGSIYPNPKDSSLFLSLPHH  85

Query  339   ADVYCPSRKRARITGPFVV---EVQEK-KPSIEALPDECLFEIFRRLSGGRERSSAACVS  506
              DVY P RKR+RIT PFV    EV+ K   SIE LPDECLFEIFRRLSGG+ERS+ A VS
Sbjct  86    VDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILPDECLFEIFRRLSGGKERSACATVS  145

Query  507   KRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEG  686
             KRWLML+S++ + E+                  S DV  S   ED+E+E DGYLSRS+EG
Sbjct  146   KRWLMLLSNISSHEL-----------------KSEDVVASKEVEDIEIESDGYLSRSLEG  188

Query  687   KKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPN  866
             KKATD+RLAAI+VGT+ RGGLGKL +RG+N    +T++G+ AI RGC SL+ LSLWN+ +
Sbjct  189   KKATDLRLAAISVGTAGRGGLGKLVIRGNNHVSKVTDLGLKAIARGCQSLRALSLWNLSS  248

Query  867   VGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRA  1046
             + D GL EIA+    LEKLDLC+CP++S+K +V IA  C  LT +TIESC  IGNE LRA
Sbjct  249   IRDGGLCEIAKASHQLEKLDLCRCPAVSDKAVVEIARNCPKLTDITIESCAQIGNESLRA  308

Query  1047  IGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             IG++CTKL+ + IKDCPLVGDQG+ASLLS  +  L KVKL ALN++D
Sbjct  309   IGQFCTKLKSIVIKDCPLVGDQGIASLLSLNTCALNKVKLQALNVSD  355


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 71/166 (43%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  +    S +G        GL KL     +S  G+T++G+ ++G+G P+LK
Sbjct  365   GKAVTDLVLTDLK-NVSEKGFWVMGNGHGLQKLKSFTISSCNGVTDMGLESVGKGSPNLK  423

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-----------  986
                L     + D GL+  A+   SLE L L +C  I+  G   +   C+           
Sbjct  424   HFCLRKCSFLSDNGLVSFAKAARSLECLQLEECHRITQFGFFGVVLNCSASLKALSLISC  483

Query  987   -----------------NLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                              +L SLTI +C   GN  L  +G+ C +LQ
Sbjct  484   LGIKDINSELPIPASSGSLRSLTIRNCHGFGNRNLALLGKLCPQLQ  529



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   320 bits (821),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 236/323 (73%), Gaps = 11/323 (3%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             M  +  ++GD DF  G SL     +  L LSLG H D+Y P+ KR+RI+ PFV       
Sbjct  1     MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+KK SI+ LPDECLFEIFRRL  G+ERS+ ACVSKRWLML+S++R  E+  +K+   L 
Sbjct  61    QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKTTLPLK  120

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
               D  N   N+ E+S  DE   ++ DGYL+R +EGKKATDVRLAAIAVGTSS GGLGKL 
Sbjct  121   RED--NPGENE-EIS-GDEPPAIKDDGYLTRVLEGKKATDVRLAAIAVGTSSHGGLGKLS  176

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG+NS RG+T++G+  + RGCPSLKVLS+WNV +VGDEGL+EIA  C  LEKL+L  C 
Sbjct  177   IRGNNSIRGVTDLGLRTVARGCPSLKVLSIWNVSSVGDEGLIEIANGCRQLEKLELRHCN  236

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             ++S+K L+++A+ C NLT ++I+SC  I NEGL+AIG+ C  L+ ++I +CP VGDQG+A
Sbjct  237   AVSDKALISLAKNCPNLTDISIDSCSTIRNEGLQAIGQNCPNLKSISINNCPHVGDQGIA  296

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLS+ S VLTKVKL AL++TD 
Sbjct  297   SLLSNTSCVLTKVKLQALHVTDL  319


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 81/156 (52%), Gaps = 19/156 (12%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ LA +    S RG        GL KL      S +G+T++G+ A+G+GCP+LK
Sbjct  328   GKAVTDLILANLQ-NVSERGFWVMGSGHGLQKLRSFAVTSCQGMTDMGLEALGKGCPNLK  386

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESC  1016
              L + N   + D GL   A+   SLE+L L +C  I+  GL  +   C + L SLT+  C
Sbjct  387   QLCVHNCAFLSDRGLDSFAKAALSLERLQLEECHRITQYGLFTVLANCGDKLKSLTLVHC  446

Query  1017  -----PNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
                   N+G+  L +    C  L+ L+++ CP  GD
Sbjct  447   LGMKDLNMGSPMLSS----CKSLRSLSVRHCPGFGD  478



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 229/334 (69%), Gaps = 21/334 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSL-GHADVYCPSRKRARITGPFVV-EVQEKKP  416
             M  + N+SGD       S    +  L LSL  H DVY P  KR+R+  PFV  E + K  
Sbjct  1     MSKVFNFSGDHGGTVYPS--PKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSEKKHKLS  58

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK-  593
             SI+ LPDECLFE+ RRLS G++RS++ACVSKRWLML+SS+R  E   S  +  L   ++ 
Sbjct  59    SIDVLPDECLFEVLRRLSDGKDRSASACVSKRWLMLLSSIRGDETVISNPNPSLETEERS  118

Query  594   VNGA---------------SNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG  728
             +  A               SN  E++ A E  ++E +G+LSR ++GKKATDVRLAAIAVG
Sbjct  119   IQTALVKSVDCVKKGEVVDSNAAEVAEA-ESQDIEGEGHLSRCLDGKKATDVRLAAIAVG  177

Query  729   TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECP  908
             T   GGLGKL +RGSN  RG+T+ G+  I RGCPSL +  LWNV +V DEGL EIA+ C 
Sbjct  178   TPGHGGLGKLSIRGSNPIRGVTDTGLKVIARGCPSLGLFRLWNVSSVSDEGLTEIAQGCH  237

Query  909   SLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIK  1088
              LEKLD CQCP+I++  L+AIA+ C NLTSLTIESC  IGNE L+A+GR+C KL+ +++K
Sbjct  238   LLEKLDPCQCPAITDMSLMAIAKNCPNLTSLTIESCSKIGNETLQAVGRFCPKLKFVSLK  297

Query  1089  DCPLVGDQGvasllssasavlTKVKLHALNITDF  1190
             +CPL+GDQG+ASL SSA  VLTKVKLHALNI+D 
Sbjct  298   NCPLIGDQGIASLFSSAGHVLTKVKLHALNISDI  331


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      +  G+T++G+ A+G+GCP+LK+  L     + D GL+  A+   +LE L
Sbjct  367   GLQKLRSLAITACHGVTDLGLEALGKGCPNLKLFCLRKCTILSDNGLVAFAKGSVALENL  426

Query  924   DLCQCPSISNKGLVAI----AER------------------------CTNLTSLTIESCP  1019
              L +C  I+  G V +     E+                        C +L SL+I +CP
Sbjct  427   QLEECHRITQAGFVGVLLSCGEKLKVLSMVKCFGVKELACRFPSVLPCNSLQSLSIRNCP  486

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
              +GN  L  +GR C KL  L +     V D+G+  L+ S  A L KV L   +N+TD
Sbjct  487   GVGNATLAIMGRLCPKLTHLELSGLLQVTDEGLFPLVQSCEAGLVKVNLSGCVNVTD  543



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   313 bits (801),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 180/328 (55%), Positives = 237/328 (72%), Gaps = 14/328 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  413
             MP LVNY G DD  +   L S   D   +LSL  + DV+CP RKR+R+T PF+ +  EK+
Sbjct  1     MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  414   P---------SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  566
                       SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+S++R SE+   K+
Sbjct  61    GAEKQKQQSCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSTIRASEMAAHKN  120

Query  567   HQDLSIADKVNGASNDVEMS-PADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRG  743
             +   S  + +     D+  +   DE+ E E  GYL+R ++ K ATDVRLAAIAVGT   G
Sbjct  121   NCT-SGCETLKKPLPDLNSAMSTDEEEEFESTGYLTRKLKAKDATDVRLAAIAVGTGGHG  179

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GLGKL + GSN+ R +T++G+SA+ RGCPSL+VLS+WNVP + D GL EIA  CP+LEKL
Sbjct  180   GLGKLYIEGSNATRPLTDIGLSAVARGCPSLRVLSMWNVPFISDIGLSEIASGCPTLEKL  239

Query  924   DLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLV  1103
             DLCQCP IS+KGL+A+A++C NLTSL +ESC +IGNEGL+AIGR C KL+ + IKDCP +
Sbjct  240   DLCQCPLISDKGLIAVAQKCPNLTSLMVESCLSIGNEGLQAIGRCCPKLKSIVIKDCPRI  299

Query  1104  GDQGvasllssasavlTKVKLHALNITD  1187
             GDQGVASL+S+AS+ L +++L  +NI+D
Sbjct  300   GDQGVASLVSAASSFLARIRLENVNISD  327


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 68/166 (41%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK   D+ L  +    S RG        GL  L     NS RG+T++G+ AI +GCP+LK
Sbjct  337   GKAVADLALTGLQ-SVSERGFWVMGNAFGLQNLKSIMINSCRGVTDLGLEAIAKGCPNLK  395

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV------------------  965
              L L     + D GL   A    +LE L L +C  IS  G++                  
Sbjct  396   QLCLRRCCYLSDAGLKAFAVTARALENLHLEECNRISLIGVLGCLLNCNEKFRALSLVKC  455

Query  966   ----------AIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                       A    C +L SLTI  CP      L  +G+ C +LQ
Sbjct  456   LGIKDISFCTAPLPSCLSLRSLTIRDCPGFTGASLAVVGKICPQLQ  501



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   312 bits (799),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 236/328 (72%), Gaps = 14/328 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV------  395
             MP LVNY G DD  +   L S   D   +LSL  + DV+CP RKR+R+T PF+       
Sbjct  1     MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  396   --EVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  566
               E Q+++P SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+SS+R SE+   K+
Sbjct  61    GAEKQKQQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEMAAYKN  120

Query  567   HQDLSIADKVNGASNDVEMS-PADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRG  743
             +   S  + +     D+  +   DE+ E E  GYL+R ++ K ATDVRLAAIAVGT   G
Sbjct  121   NGT-SGCETLKKPLPDLNSAMSTDEEEEFESTGYLTRKLKAKDATDVRLAAIAVGTGGHG  179

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GLGKL + GSN+ R +T++G+S + RGCPSL+VLS+WNVP + D GL EIA  CP LEKL
Sbjct  180   GLGKLYIEGSNATRPLTDIGLSTVARGCPSLRVLSMWNVPFISDIGLSEIASGCPMLEKL  239

Query  924   DLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLV  1103
             DLCQCP IS+KGL+A+A +C NLTSL +ESC +IGNEGL+AIGR C KL+ + IKDCP V
Sbjct  240   DLCQCPLISDKGLIAVARKCPNLTSLMVESCLSIGNEGLQAIGRCCPKLKSIVIKDCPRV  299

Query  1104  GDQGvasllssasavlTKVKLHALNITD  1187
             GDQGVASL+S+AS+ L +++L  +NI+D
Sbjct  300   GDQGVASLVSAASSFLARIRLENVNISD  327


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 68/166 (41%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK   D+ L  +    S RG        GL  L     NS RG+T++G+ AI +GCP+LK
Sbjct  337   GKAVADLALTGLQ-SVSERGFWVMGNAFGLQNLESIMINSCRGVTDLGLEAIAKGCPNLK  395

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV------------------  965
              L L     + D GL   A    +LE L L +C  IS  G++                  
Sbjct  396   QLCLRRCCYLSDAGLKAFAITARALENLHLEECNRISLIGVLGCLLNCNEKFRALSLVKC  455

Query  966   ----------AIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                       A    C +L SLTI  CP      L  +G+ C +LQ
Sbjct  456   LGIKDISFCTAPLPSCLSLRSLTIRDCPGFTGASLAVVGKICPQLQ  501



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score =   310 bits (795),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 178/328 (54%), Positives = 232/328 (71%), Gaps = 31/328 (9%)
 Frame = +3

Query  267   GDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV-------EVQEKKP  416
             G DD  +   L S   D   +LS+  + DV+ P RKR+RIT PF+        E Q+++P
Sbjct  21    GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  417   -SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  593
              SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+SS+R SE+           A K
Sbjct  81    CSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEM----------AAHK  130

Query  594   VNGASN---------DVEMSPA-DEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRG  743
              NGAS+         D+  S + DE+ E E  GYL+R ++ K ATDVRLAA+AVGT   G
Sbjct  131   KNGASSGETLKKPLPDLNTSASTDEEKEFESTGYLARKLKAKDATDVRLAAMAVGTCGHG  190

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GLGKL + GSN+ R +T++G+SA+ RGCPSL+VLS+WNVP + D GL EI   CP LEKL
Sbjct  191   GLGKLYIEGSNATRPVTDIGLSAVARGCPSLRVLSMWNVPFISDIGLSEIGSGCPMLEKL  250

Query  924   DLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLV  1103
             DLC+CP IS++GL+A+A++C NLTSL IESC +IGNE L+A+GR C KL+ + IKDCPLV
Sbjct  251   DLCRCPLISDEGLIAVAQKCPNLTSLMIESCLSIGNECLQAMGRCCPKLKSIVIKDCPLV  310

Query  1104  GDQGvasllssasavlTKVKLHALNITD  1187
             GDQGVASL+S+AS+ L +++L  +NITD
Sbjct  311   GDQGVASLVSAASSFLARIRLENVNITD  338


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 57/110 (52%), Gaps = 2/110 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             NS RG+T++G+ AI + CP+LK L L     + D GL   A    +LE L + +C  IS 
Sbjct  385   NSCRGVTDLGLEAIAKSCPNLKQLCLRRCCYLSDAGLKAFAMTARALENLHVEECNRISL  444

Query  954   KGLVAIAERCT-NLTSLTIESCPNIGNEGL-RAIGRYCTKLQCLTIKDCP  1097
              G++     C   L +L++  C  + +     A    C  L+ LTI+DCP
Sbjct  445   IGVLGCLLNCNEKLRALSLVKCLGVKDISFCTAPLPLCMSLRSLTIRDCP  494



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   310 bits (794),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 229/329 (70%), Gaps = 25/329 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDF---LAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPF-------  389
             M  LVNY G DD      GSS         LS G + DVYCP RKRAR+  P        
Sbjct  1     MAALVNYGGGDDLCPLFPGSSR-------FLSPGRNVDVYCPPRKRARVIAPLGFSFRGR  53

Query  390   -VVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  563
               V  ++++P SI+ LPDECLFEI RRL G +ERSS ACVSKRWLML+ S+R+SE+    
Sbjct  54    EEVAAEKQQPRSIDTLPDECLFEILRRLPGEKERSSCACVSKRWLMLLISIRSSELAARM  113

Query  564   SHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRG  743
                D S+  ++   S  V      E+ E E +GYL+R ++ ++ATD+RLA+IA G+ SRG
Sbjct  114   KTTDESVKTRMPDLSKGV----CAEEKECENNGYLTRRLDAEEATDIRLASIAFGSCSRG  169

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GLG+L +RGSNS R +T+VG+SAI  GCPSL+VLSLW VP + D GL EIA  CP LEK+
Sbjct  170   GLGRLFIRGSNSTR-VTDVGLSAIAHGCPSLRVLSLWKVPLITDAGLSEIADGCPLLEKI  228

Query  924   DLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLV  1103
             DLCQCP IS+KGL+A+A++C NLTSLTIESC +I NEGL+AIGR C  L+ +T+KDC  V
Sbjct  229   DLCQCPQISDKGLIAVAQKCPNLTSLTIESCSSIHNEGLQAIGRCCPNLKSVTVKDCMRV  288

Query  1104  GDQGvasllssasavlTKVKLHALNITDF  1190
             GDQG+ASL+SSAS+ L ++KL  LNI+D 
Sbjct  289   GDQGIASLVSSASSSLQRIKLQTLNISDL  317


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 60/137 (44%), Gaps = 27/137 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL +L      S  G+T++G+ AI +G PSLK L +     + D GL   A    +LE L
Sbjct  353   GLQRLRSISITSCSGLTDLGLQAISKGSPSLKQLFICKSEYLSDAGLRAFAETARALENL  412

Query  924   DLCQCPSISNKGLVAIAE---------------------------RCTNLTSLTIESCPN  1022
              L  C  ++  G+ ++ +                            C +L SLTI  CP 
Sbjct  413   HLEDCNQVTLVGVSSLLKCNPELKSLALARCLGIKDITLCPTQMPSCVSLRSLTIHDCPG  472

Query  1023  IGNEGLRAIGRYCTKLQ  1073
             + +  L+ +G+ C +LQ
Sbjct  473   VTDASLQTVGKICPQLQ  489



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   309 bits (791),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 228/323 (71%), Gaps = 28/323 (9%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQE  407
             M  + +++G+DDF  G  +     +  L LSLG   DVY P +KR+R + PF +  E  E
Sbjct  1     MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  408   KKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             +KP  SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +E + ++S     
Sbjct  61    QKPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNETYSNES-----  115

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                              +E+ E+  +GYLSRS+EGKKATDVRLAAIA+GT+SRGGLGKL 
Sbjct  116   ---------------TGNENQEISDEGYLSRSLEGKKATDVRLAAIAIGTASRGGLGKLT  160

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG NS RG+T+VG+ AI  GCPSLKV SLW+V  V DEGL+EIA  C  LEKLDLC+CP
Sbjct  161   IRGCNSDRGVTSVGLKAIAHGCPSLKVCSLWDVATVDDEGLIEIASGCHRLEKLDLCKCP  220

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+K L+A+A+ C  L  L+IESCPNIGNEGL+AIG+ C  L+ ++IKDC  VGDQGVA
Sbjct  221   NISDKTLIAVAKNCPKLAELSIESCPNIGNEGLQAIGK-CPNLRSISIKDCSGVGDQGVA  279

Query  1122  sllssasavlTKVKLHALNITDF  1190
              +LSSAS  LTKVKL +LN++D 
Sbjct  280   GVLSSASFALTKVKLESLNVSDL  302


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 83/177 (47%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL     +  RG+T+VG+ AIGRGCP+++   L     + D+GL+  AR  PS+E L
Sbjct  338   GLQKLTSITIDCCRGVTDVGLEAIGRGCPNVQNFKLRKCAFLSDKGLVSFARAAPSVESL  397

Query  924   DLCQCPSISNKGLVAIAERC----------------------------TNLTSLTIESCP  1019
              L +C  I+  GL  +   C                             ++ SLTI  CP
Sbjct  398   QLQECHRITQIGLFGVFFNCGAKLKVLTLISCYGIKDLNMELPAISPSESIWSLTIRDCP  457

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               G+  L  +G+ C ++Q + +     V D G   LL S+ A L KV L   +N+TD
Sbjct  458   GFGDANLALLGKLCPRIQHVELSGLQGVTDAGFLPLLESSEAGLVKVNLSGCVNLTD  514



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   309 bits (791),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 224/322 (70%), Gaps = 30/322 (9%)
 Frame = +3

Query  252   LVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV------EVQ  404
             ++ +SG+DDF  G  +     +  L LSLG   DVY P +KR+R + PF +      + Q
Sbjct  1     MLGFSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQ  60

Query  405   EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             + K SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI    S      
Sbjct  61    KPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYGS------  114

Query  585   ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
                             +E+ E+  +GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL +
Sbjct  115   --------------TGNENQEISDEGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLTI  160

Query  765   RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPS  944
             RG NS RG+TNVG+ AI  GCPSLKV SLW+V  VGD GL+EIA  C  LEKLDLC+CP+
Sbjct  161   RGCNSDRGVTNVGLKAIAHGCPSLKVCSLWDVATVGDVGLIEIASGCHQLEKLDLCKCPN  220

Query  945   ISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
             IS+K L+A+A+ C NL  L+IESCPNIGNEGL+AIG+ C  L+ ++IK+C  VGDQGVA 
Sbjct  221   ISDKTLIAVAKNCPNLAELSIESCPNIGNEGLQAIGK-CPNLRSISIKNCSGVGDQGVAG  279

Query  1125  llssasavlTKVKLHALNITDF  1190
             LLSSAS  LTKVKL +L ++D 
Sbjct  280   LLSSASFALTKVKLESLTVSDL  301


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 85/177 (48%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL     N  +G+T+VG+ AIGRGCP+++ L L     + D+GL+  AR  PS+E L
Sbjct  337   GLQKLTSITINCCQGVTDVGLEAIGRGCPNVQNLKLRKSAFLSDKGLVSFARAAPSVESL  396

Query  924   DLCQCPSISNKGLVAIAERC----------------------------TNLTSLTIESCP  1019
              L +C  I+  GL  +   C                             ++ SLTI  CP
Sbjct  397   QLQECHRITQIGLFGVFFNCGAKLKVLTLISCYGIKDLNMDLPAISPSESIWSLTIHDCP  456

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               GN  L  +G+ C +LQ + +     V D G   LL S+ A L KV L+  +N++D
Sbjct  457   GFGNANLALLGKLCPRLQHVELSGLQGVTDAGFLPLLESSEAGLVKVNLNGCVNLSD  513



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 217/314 (69%), Gaps = 35/314 (11%)
 Frame = +3

Query  261   YSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV----EVQEKKPSIEA  428
             +SG+D+   G S   +      ++ H DVY P  KR R+  PFV+      Q  + SI  
Sbjct  8     FSGEDELYGGRSSNPS------AMSHVDVYGPPNKRQRVNAPFVLWGSNPEQNTRSSINV  61

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LPDEC+FE+FRRL   +ERS+ ACVSK+WL +++ +R SE+  + S Q          +S
Sbjct  62    LPDECMFEVFRRLPP-QERSNCACVSKQWLTILTGIRRSEMSSTLSVQ----------SS  110

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             +DV             D  L+RSVEGKKATDVRLAAIAVGT+SRGGL KL +RGSN  RG
Sbjct  111   DDV-------------DSCLTRSVEGKKATDVRLAAIAVGTASRGGLRKLSIRGSNVTRG  157

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +T+VG+SA+ RGCPSLK LS+WNV +V DEGL+EIA EC  LE+LDLC CPSI+NKGL+A
Sbjct  158   VTDVGLSAVARGCPSLKSLSIWNVSSVSDEGLVEIANECNLLERLDLCLCPSITNKGLIA  217

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAERC NL SL++ESCPNIGN+G++AI + C KL+ + IKDCPLVGDQ   + L S    
Sbjct  218   IAERCPNLVSLSVESCPNIGNDGMQAIAQGCPKLESILIKDCPLVGDQA-VASLLSLLTA  276

Query  1149  lTKVKLHALNITDF  1190
             L+KVKL +LNI++F
Sbjct  277   LSKVKLQSLNISEF  290


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 74/151 (49%), Gaps = 11/151 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S +G        GL  L     +S  G+T + + A+G+GC  LK
Sbjct  299   GKSVTNLTLSNLR-NVSEKGFWVMGNAQGLKSLVSLSISSCLGVTGLSLEALGKGCSILK  357

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESC  1016
              +SL N   + D GL   +    SLE + L  C +I+  GL ++   C++   SL++  C
Sbjct  358   QISLRNCSLLSDNGLSAFSNSALSLESMHLEHCNAITLSGLKSMLSNCSSKFRSLSLVKC  417

Query  1017  PNIGNEGLR-AIGRYCTKLQCLTIKDCPLVG  1106
               + +  +   +   C  L+ L+IK+CP  G
Sbjct  418   MGLKDIAIENNLQNPCVSLRSLSIKNCPAFG  448



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   306 bits (784),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 185/326 (57%), Positives = 236/326 (72%), Gaps = 31/326 (10%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG---HADVYCPSRKRARITGPFV-----  392
             M  + ++SG+++F  G S+ S   + G  LSLG   H DVY P+ KRARI+ P V     
Sbjct  1     MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  393   VEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  572
             +E Q+K+ S++ LPDECL+EI RRL G +ERSS A VSKRWLML+SS+ ++++       
Sbjct  60    LE-QKKQVSLDVLPDECLYEILRRLPGDQERSSCASVSKRWLMLLSSIPSADL-------  111

Query  573   DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLG  752
                         N  E+  A+E  E+E DG+L+RS+EGKKATDVRLAAIAVG+  RGGLG
Sbjct  112   -----------CNKFEVV-AEEGDEIESDGFLTRSLEGKKATDVRLAAIAVGSGGRGGLG  159

Query  753   KLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLC  932
             KL +RGSNS RG+T++G+ A+ R CPSLK +SLWNV +VGDEGL+EIA  C  LEKLDLC
Sbjct  160   KLTIRGSNSVRGVTDLGLKAVARCCPSLKSVSLWNVSSVGDEGLVEIANGCHRLEKLDLC  219

Query  933   QCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
              CPSI+NK L AIA+ C  LTSL+IE C  IGNEG++AIG++C  L+ +TIKDCPLVGDQ
Sbjct  220   NCPSITNKALFAIAKNCPTLTSLSIEGCQYIGNEGVQAIGQFCPNLKSVTIKDCPLVGDQ  279

Query  1113  GvasllssasavlTKVKLHALNITDF  1190
             GVASL+SSAS VLTK+KL  LN+TD 
Sbjct  280   GVASLMSSASFVLTKLKLQGLNVTDL  305


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 77/180 (43%), Gaps = 37/180 (21%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ LA +    + +G        GL  L     +S RG+T+V + A+G+GCP+LK
Sbjct  314   GKTVTDLVLANLQ-NVNEKGFWVMGNAQGLQHLRSFTISSCRGVTDVAVEAVGKGCPNLK  372

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC------------  983
                L     + D GL+  A+   SLE L + +C  I+  G   +   C            
Sbjct  373   QFVLKKCAFMSDNGLMSFAKAARSLESLQIEECHRITQIGFFGLLLNCGPKLKALTMSSC  432

Query  984   ----------------TNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                               L S+T+ +CP +G+  L  + + C +LQC+     P + D G
Sbjct  433   FGFKDMILGFPLPNKSAPLRSVTVSNCPGLGDMTLAMLAKLCPQLQCVNFHGLPYITDAG  492



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   306 bits (783),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 232/327 (71%), Gaps = 17/327 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARITGPFVVEVQEK-  410
             M  LVN  G DD   G SL S  +   L L    + DVYC SRKR R+T P     ++K 
Sbjct  1     MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  411   -----KP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-FRSKSH  569
                  +P SI++LPDECLFEI RRL G +ERS++A VSKRWLML+SS+R+SE+  R KSH
Sbjct  61    AYKKQQPRSIDSLPDECLFEILRRLPGDKERSNSARVSKRWLMLLSSIRSSELGARKKSH  120

Query  570   QDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGL  749
                   +       D+  +   ++ E E +GYL+R ++ ++ATD+RLA+IA+GT SRGGL
Sbjct  121   -----VESGKKFLPDLNKNVLLDEQESENNGYLTRRLDAEEATDIRLASIALGTCSRGGL  175

Query  750   GKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDL  929
             GKL ++GSNS R +T+VG+SAI   CP+L+VLS+W VP + D GL EIA  CP LEKLDL
Sbjct  176   GKLFIQGSNSTR-VTDVGLSAIAHACPALRVLSMWKVPLITDAGLSEIADGCPLLEKLDL  234

Query  930   CQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             CQCP I++KGLV++A++C NLTSLTIESC NI NEGL+ IGR C KL+ LTIKDC  VGD
Sbjct  235   CQCPLITDKGLVSVAKKCPNLTSLTIESCANICNEGLQVIGRSCPKLKSLTIKDCLHVGD  294

Query  1110  QGvasllssasavlTKVKLHALNITDF  1190
             QG+ASL+SSAS+ L ++KL ALNI+D 
Sbjct  295   QGIASLVSSASSCLERIKLQALNISDI  321


 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 60/116 (52%), Gaps = 4/116 (3%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPS-LEKLDLCQCPSISN  953
             S   I N G+  IGR CP LK L++ +  +VGD+G+  +     S LE++ L Q  +IS+
Sbjct  262   SCANICNEGLQVIGRSCPKLKSLTIKDCLHVGDQGIASLVSSASSCLERIKL-QALNISD  320

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRY--CTKLQCLTIKDCPLVGDQG  1115
               L  I     NL  L++    N+G +G   +G      KL+ +TI  C  + D+G
Sbjct  321   IVLAVIGHYGKNLIDLSLNGLQNVGEKGFWVMGNALGLQKLRSITINCCNGLTDKG  376



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 211/297 (71%), Gaps = 15/297 (5%)
 Frame = +3

Query  309   DLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQEKKPSIEALPDECLFEIFRRLSGG  476
             D  L LSLG H DVY P RKR+R++ P+V     +++K+ SIE LPDECLFEIF+RL   
Sbjct  26    DTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGEILKKKEASIEVLPDECLFEIFKRLPDR  85

Query  477   RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVEC  656
               RS  ACVSKRWLML+SS+  +E + +  +    I    N            ED ++  
Sbjct  86    ETRSLCACVSKRWLMLLSSISGNEFYSASENLKPKIVVTEN-----------LEDNQITN  134

Query  657   DGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSL  836
             +G LSR++EGKKATDVRLAAIAVGT+S GGLGKL +RG N    +TN+G+ A+  GCP+L
Sbjct  135   EGCLSRNLEGKKATDVRLAAIAVGTASCGGLGKLSIRGGNHGTEVTNLGLKAVAHGCPAL  194

Query  837   KVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESC  1016
             K +SLWN+ ++GDEG++EIA+ C  LEKLDL QCP ISNK L+ +A+ C NLT +TIE+C
Sbjct  195   KAISLWNLSSIGDEGMIEIAKGCQLLEKLDLSQCPGISNKALLELAKHCPNLTDITIEAC  254

Query  1017  PNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              NIGNE ++AIG+YC+ L+ ++I+DCPL+GDQG++SL SS S  L K KL  LN+TD
Sbjct  255   ANIGNESIQAIGQYCSNLKSISIRDCPLIGDQGISSLFSSTSYTLNKAKLQGLNVTD  311


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 73/152 (48%), Gaps = 11/152 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G+  TD+ L  +    S RG        GL KL     +S  G+T+VG+ +IG+GCP++K
Sbjct  321   GRAITDLTLTGLT-NVSERGFWAMGNGHGLQKLRSFTLSSCHGVTDVGLQSIGKGCPNMK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
                L     + D G++   +   S+E L L +C  I+  GL      C   L +L++ +C
Sbjct  380   KFCLRKCSFLSDNGMVSFVQAATSIENLQLEECHRITQLGLFGTILNCGAKLKALSLVNC  439

Query  1017  PNIGN-EGLRAIGRYCTKLQCLTIKDCPLVGD  1109
               I +          C  LQ L+I++CP  G+
Sbjct  440   LGIKDLSLNLPSLSSCKSLQSLSIRNCPGFGN  471



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 235/325 (72%), Gaps = 14/325 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV-----  401
             M  LV Y G+DD   G    +  D  L+LSLG  ADVY P  KR R+T P +        
Sbjct  1     MAALVKYGGNDDICPGPFYSNLTDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEKVI  60

Query  402   -QEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  575
              +EK+P SI+ LPDECLFEI RRL G +ERS++ACVSK WLML+SS+R+SE+       D
Sbjct  61    DEEKQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKHWLMLVSSIRSSELAACNKACD  120

Query  576   LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
              S+ +     +NDV +    ++ E E +GYL+R ++ ++ATD+RLA+IA+GT SRGGLGK
Sbjct  121   ESVKNPSLFLNNDVIV----DEQESENNGYLTRCLDAEEATDIRLASIALGTCSRGGLGK  176

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RGSNS R +T+VG+SAI RGCPSL+VLS+W VP V D GL EIA  CP LEKLDLCQ
Sbjct  177   LSIRGSNSTR-VTDVGLSAIARGCPSLRVLSMWKVPFVTDVGLSEIANGCPLLEKLDLCQ  235

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CP IS+KGL+A+A++C +LTSL+I+SC  IGNEGL+AIGR C KL+ +TI DC  VGD+G
Sbjct  236   CPLISDKGLIAVAQKCPDLTSLSIKSCSRIGNEGLQAIGRCCPKLKSVTINDCLQVGDKG  295

Query  1116  vasllssasavlTKVKLHALNITDF  1190
             +ASL+SSAS+ L +++L  LNI+D 
Sbjct  296   IASLVSSASSSLERIRLRTLNISDI  320


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 61/138 (44%), Gaps = 28/138 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL     N   G+T+  + AI +G P LK L +     + D GL+  A    +LE L
Sbjct  356   GLQKLKSISINCCNGLTDTALQAIAKGSPFLKQLFVCKSCYLSDAGLIAFAGTAKALEGL  415

Query  924   DLCQCPSISNKGLV-AIAER---------------------------CTNLTSLTIESCP  1019
              L  C  I+  G++ A+ +R                           C +L SLTI+ CP
Sbjct  416   HLEDCNHITLMGILGALLKRSAELKSLSLVRCLGLKDISFEFSQLPSCMSLRSLTIQDCP  475

Query  1020  NIGNEGLRAIGRYCTKLQ  1073
              + +  ++ +GR C +LQ
Sbjct  476   GVTSASIQVVGRICPQLQ  493



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 229/325 (70%), Gaps = 15/325 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARITGPFVVEVQEK-  410
             M  LVN  G+DD   G  L S  +   L L    + DVYCP RKR R+T P +    EK 
Sbjct  1     MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  411   -----KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  575
                  + SI+ LP+ECLFEI RRL G +ERS++ACVSKRWLML+SS+R+SE+ + K    
Sbjct  61    ADEKLQRSIDTLPEECLFEILRRLPGDKERSNSACVSKRWLMLLSSIRSSELAQKKPS--  118

Query  576   LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
                 + V     D+    A ++ E E +GYL+R ++ ++ATD+RLA+IA+GT SRGGLGK
Sbjct  119   ---VESVKKPVPDLNKDCALDEHESENNGYLTRRLDAEEATDIRLASIALGTYSRGGLGK  175

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RGSNS R +T+VG+SAI   CPSL VLS+W VP + D GL EIA  CP LE+LDLC+
Sbjct  176   LFIRGSNSTR-LTDVGLSAIAHACPSLHVLSMWKVPLITDAGLSEIADGCPLLERLDLCR  234

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CP IS+KGL+A+A++C NL SLTI+SC +IGNEGL+ IGR C KL+ ++IKDC  VGD+G
Sbjct  235   CPLISDKGLMAVAQKCPNLMSLTIDSCSSIGNEGLQVIGRCCPKLKSVSIKDCLHVGDRG  294

Query  1116  vasllssasavlTKVKLHALNITDF  1190
             +ASL+SSAS+ L ++KLH LNI+D 
Sbjct  295   IASLVSSASSSLERLKLHTLNISDI  319


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 27/122 (22%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +T+ G+ AI +G P LK LS+     + D+GL   A    +LE L L  C  I+  G+ A
Sbjct  370   LTDRGLEAIAKGSPFLKHLSVHKCYYLSDDGLKAFAETARALESLHLEDCNRITLMGVTA  429

Query  969   IAE---------------------------RCTNLTSLTIESCPNIGNEGLRAIGRYCTK  1067
             +                              C +LTSLTI  CP +    L+ +GR C++
Sbjct  430   LLACNSELKSLALVRCLGLKDLAFSPTRLPSCVSLTSLTIRDCPGVTGASLQVVGRICSQ  489

Query  1068  LQ  1073
             LQ
Sbjct  490   LQ  491



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   305 bits (780),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 165/314 (53%), Positives = 218/314 (69%), Gaps = 24/314 (8%)
 Frame = +3

Query  273   DDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQEKKPSIEALPD  437
             +DF  G+ +     D  L LSLG   DVY P RKR+R++ PFV   E+ +K+ SIE LPD
Sbjct  13    EDFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVPSGEILKKEASIEVLPD  72

Query  438   ECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDV  617
             ECLFEIF+RL     RS  ACVSKRWLML+SS+  +E +               GAS ++
Sbjct  73    ECLFEIFKRLPERETRSLCACVSKRWLMLLSSISGNEFY---------------GASENL  117

Query  618   E----MSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSAR  785
             +    ++   ED +   +G LSR++EGKKATDVRLAAIAVGT+S GGLGKL +RG N   
Sbjct  118   KPKNVVTENLEDNQTTNEGCLSRNLEGKKATDVRLAAIAVGTASCGGLGKLSIRGGNHGS  177

Query  786   GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV  965
              +TN+G+ A+  GCP LK +SLWN+ ++GDEGL+EIA+ C  LEKLDL QCP ISNK L+
Sbjct  178   EVTNLGLKAVAHGCPGLKAISLWNLSSIGDEGLIEIAKGCQLLEKLDLSQCPGISNKALL  237

Query  966   AIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasa  1145
              +A+ C NLT +T+E+C NIGNE ++AIG+YC+ L+ ++I+DCPL+GDQG++SL SS S 
Sbjct  238   ELAKNCPNLTDITVEACANIGNESVQAIGQYCSNLKSISIRDCPLIGDQGISSLFSSTSY  297

Query  1146  vlTKVKLHALNITD  1187
              L K KL  LN+TD
Sbjct  298   TLNKAKLQGLNVTD  311


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 87/205 (42%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G+  TD+ L  +    S RG        GL KL     +S  G+T+VG+ +IG+GCP+LK
Sbjct  321   GRAITDLTLTGLT-NVSERGFWAMGNGHGLQKLRSFTLSSCHGVTDVGLQSIGKGCPNLK  379

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
                L     + D G++   +   S+E L L +C  I+  GL                   
Sbjct  380   KFCLHKCSFLSDNGMVSFVQAATSIENLQLEECHRITQLGLFGTILNCGAKLKALSLVNC  439

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL+I +CP  GN  L  + + C +LQ +       + D G
Sbjct  440   LGIKDLSLNLPSLSSCKSLQSLSIRNCPGFGNASLTLLSKLCPQLQHVEFSGLNAITDSG  499

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  L  +  A L KV L   +N+TD
Sbjct  500   LLPLFMNCKAGLVKVNLSGCVNLTD  524



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   305 bits (780),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/324 (53%), Positives = 232/324 (72%), Gaps = 14/324 (4%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARIT------GPFVV  395
             M  LVN +G+DD   G  L S  +   L L    + D YCP  KR RIT      G    
Sbjct  1     MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  396   EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  575
             + +++  SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+ S+R+SE+   K H++
Sbjct  61    DEKQQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKRWLMLLCSIRSSELADRKKHRN  120

Query  576   LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
              S+   +   + DV    ++++ E E +G+L+R ++ ++ATD+RLA+IA+GT SRGGLGK
Sbjct  121   ESVKKPLPDLNKDV----SEDEQESENNGFLTRRLDAEEATDIRLASIALGTCSRGGLGK  176

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RGSNS R +T+VG+SAI  GCPSL+ LS+W VP + D GL EIA  CP LEKLDLCQ
Sbjct  177   LLIRGSNSTR-VTDVGLSAIAHGCPSLRALSMWKVPLITDAGLSEIADGCPLLEKLDLCQ  235

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CP IS++GL+A+A++C  LTSLTIESC ++GNEGL+AIGR C KL+ +TIK+C  VGDQG
Sbjct  236   CPQISDRGLIAVAQKCPKLTSLTIESCSSVGNEGLQAIGRCCPKLKSVTIKNCLHVGDQG  295

Query  1116  vasllssasavlTKVKLHALNITD  1187
             + SL+SSAS+ L ++KL  L+I+D
Sbjct  296   ITSLVSSASSSLERIKLQTLSISD  319



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   303 bits (777),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 233/336 (69%), Gaps = 31/336 (9%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARITGPFVVEVQEK-  410
             MP LV Y G DD      L S  +   L L  A   DV+CP RKR+R+T PFV +  EK 
Sbjct  1     MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  411   --KP-----SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  569
               KP     SI+ LPDECLFEI RRL G RERS++ACVSKRWLML+SS+R SEI      
Sbjct  61    AEKPKQKLCSIDVLPDECLFEILRRLPGSRERSNSACVSKRWLMLLSSIRASEI------  114

Query  570   QDLSIADKVNGASN-DVEMSP---------ADEDLEVECDGYLSRSVEGKKATDVRLAAI  719
                  A+K NG+SN D+  +P          DE+ E E  GYL+R ++ K+ATDVRLAA+
Sbjct  115   ----AANKKNGSSNGDLLKNPLPDLNDAVSTDEEEEPEKAGYLTRYLKAKEATDVRLAAM  170

Query  720   AVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIAR  899
             AVG    GGLGKL ++GSN+ R +T+ G+SA+   CPSL+VLS+WN+P + D GL EIA 
Sbjct  171   AVGVGGHGGLGKLYIQGSNATRPLTDTGLSAVAHACPSLRVLSMWNIPFISDVGLSEIAN  230

Query  900   ECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCL  1079
              CP LEKLDLC+CPSIS+KGL+A+A +C  LTSLTIESC +IGNEGL AIGR C KL+ +
Sbjct  231   GCPMLEKLDLCRCPSISDKGLIAVARKCPKLTSLTIESCSSIGNEGLHAIGRCCPKLKSI  290

Query  1080  TIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              IKDCP VGD+GVASL+S+AS+ L ++ L ++NI+D
Sbjct  291   IIKDCPGVGDRGVASLVSAASSSLARIDLQSINISD  326


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 70/148 (47%), Gaps = 11/148 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK   D+ L  +    S RG        GL KL     +S  G+T++G+ AI +GCPSLK
Sbjct  336   GKAVADLALTGLQY-VSERGFWVMSNALGLQKLKSITIDSCNGVTDLGLEAIAKGCPSLK  394

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
              L L     + D GL   A+   +LE L L +C  IS  G++     C     +L++  C
Sbjct  395   QLFLSRCCYLSDSGLKLFAQTARALENLHLEECNRISLIGVLGFLLSCNAKFRALSLVKC  454

Query  1017  PNIGNEGL-RAIGRYCTKLQCLTIKDCP  1097
               I +     +    C  L+ LTI+DCP
Sbjct  455   FGINDTSFCPSPLPSCMSLRSLTIRDCP  482



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score =   301 bits (772),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 217/319 (68%), Gaps = 41/319 (13%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYC--PSRK-RARITGPFVVEVQEKK  413
             MPTL+NY+GDD+F   S     D    L +      C  P+++ RA +  PF     +  
Sbjct  1     MPTLLNYTGDDEFHPTSM---EDFPCFLPVSSRINVCFQPNKRVRANLKIPF--RRDDTN  55

Query  414   PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  593
             PSI+ LPDECLFEIF+RL  G+ +SS ACVSKRWLML+SS+R                  
Sbjct  56    PSIDDLPDECLFEIFKRLYNGKSKSSCACVSKRWLMLLSSIR------------------  97

Query  594   VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGS  773
                    VE        E E +GYL+R +EGKKATD+RLAAIA+G +++GGLGKL ++G 
Sbjct  98    -------VE--------ETENNGYLTRHLEGKKATDIRLAAIAIGINNKGGLGKLSIKGL  142

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             NS   +TNVG+++I  GC SL+ LSLWN+  +GDEGLLEIA+EC  LEK D+CQCP ISN
Sbjct  143   NSICRVTNVGLTSIAYGCSSLRALSLWNIALIGDEGLLEIAKECHLLEKFDVCQCPLISN  202

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvaslls  1133
             K L+AIAE C NLT L+IESCPNIGNEG++AIGR C+KL+ ++IKDC L+GD GV+SL+S
Sbjct  203   KALIAIAEGCPNLTVLSIESCPNIGNEGMQAIGRSCSKLESISIKDCSLIGDSGVSSLIS  262

Query  1134  sasavlTKVKLHALNITDF  1190
             SA + L KVKL  LNITDF
Sbjct  263   SACSSLHKVKLQGLNITDF  281


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S +G+TNV + AIG GC SLK + L     +  E L   ++   +LE L L +C  I+  
Sbjct  328   SCQGVTNVSLEAIGNGCKSLKQICLQKCSFISGEELAAFSKAARTLESLQLEECNRITIS  387

Query  957   GLVA-IAERCTNLTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCPLVG  1106
             G++  +    +NL SL +  C  I +  L+  +  Y + L+ L+I++C   G
Sbjct  388   GIIGLLTNHESNLKSLVLVKCSGIKDTTLQFPLLSYSSSLRWLSIRNCTGFG  439



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score =   301 bits (771),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 218/319 (68%), Gaps = 41/319 (13%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYC--PSRK-RARITGPFVVEVQEKK  413
             MPTL+NY+GDD+F   S     D    L +      C  P+++ R  +  PF+ +  + K
Sbjct  1     MPTLLNYTGDDEFHPTSM---EDFPCFLPISSRINVCFQPNKRFRTNLKIPFLGD--DTK  55

Query  414   PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  593
             PSI+ LPDECLFEIF+RL  G+ +SS ACVSKRWLML+SS+R  +               
Sbjct  56    PSIDDLPDECLFEIFKRLDNGKSKSSCACVSKRWLMLLSSIRMEK---------------  100

Query  594   VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGS  773
                                E +GYL+R +EGKKATD+RLAAIA+G ++ GGLGKL ++G 
Sbjct  101   ------------------TENNGYLTRHLEGKKATDIRLAAIAIGINNNGGLGKLSIKGM  142

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             NS   +TNVG+++I  GC SL+ LSLWN+ ++GDEGLLEIA+EC  LEK D+CQCP ISN
Sbjct  143   NSICRVTNVGLTSIAYGCSSLRALSLWNIASIGDEGLLEIAKECHLLEKFDVCQCPLISN  202

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvaslls  1133
             + L+AIAE C+NLT L+IESCPNIGNEG++AIGR C+KL+ ++IKDC L+GD GV+SL+S
Sbjct  203   RALIAIAEGCSNLTVLSIESCPNIGNEGMQAIGRSCSKLESISIKDCSLIGDSGVSSLIS  262

Query  1134  sasavlTKVKLHALNITDF  1190
             SA + L KVKL  LNITDF
Sbjct  263   SACSSLHKVKLQGLNITDF  281


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             +G+TNV + AIG GC SLK + L     V  +GL   ++   +LE L L +C  I+  G+
Sbjct  330   QGVTNVSLEAIGNGCRSLKQICLQKCSFVSGDGLAAFSKAARTLESLQLEECNRITISGI  389

Query  963   VA-IAERCTNLTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCPLVGDQ  1112
             +  +    +NL SL +  C  I +  L+  +  Y + L+ ++I++C   G +
Sbjct  390   IGLLTNHESNLKSLVLVKCSGIKDTALQFPLPSYSSSLRWVSIRNCTGFGAE  441



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/325 (54%), Positives = 213/325 (66%), Gaps = 35/325 (11%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV--------E  398
             MP  VN SG+D+   G        G  +S  + DV+C   KR RI+ PF           
Sbjct  1     MPGRVNQSGNDELHPGCR------GYTIS-SNVDVHCSPTKRTRISAPFTFGPLPRALEH  53

Query  399   VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  578
              Q+ KPSIE+LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+R  EI         
Sbjct  54    GQDLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI---------  104

Query  579   SIADKVNGASNDVEMSPADEDLE-VECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
                       + VE   +DE  E  +  G+L+R +EG+KATDVRLAAIAVGT   GGLGK
Sbjct  105   ---------DSGVETISSDESEEDAKGGGWLTRRLEGRKATDVRLAAIAVGTGCCGGLGK  155

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RG+NS RG+T+ G+SA+  GCPSL+ LSLWNV ++GD+GL EIA+ C  LE LDL  
Sbjct  156   LYIRGNNSTRGVTDRGLSAVACGCPSLRSLSLWNVSSIGDKGLCEIAKGCHMLETLDLSH  215

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               SI+NKGL+AIAE C NLT+L IESC  IGNEGL+ + + C KL  + IKDCPLVGD G
Sbjct  216   SSSITNKGLIAIAEGCPNLTTLNIESCSMIGNEGLQTVAKLCPKLHSICIKDCPLVGDHG  275

Query  1116  vasllssasavlTKVKLHALNITDF  1190
               S L S ++ L+KVKL  LNITDF
Sbjct  276   -VSSLLSLASNLSKVKLQILNITDF  299


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 92/206 (45%), Gaps = 38/206 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S RG        GL KL      S +G+T+  I A+G+G P LK
Sbjct  308   GKAVTNLVLSGLQ-NVSERGFCVMGVAQGLQKLMSLTITSCQGVTDASIEAMGKGFPHLK  366

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
              + L     V D GL E A+   SL+ L L +C   +  G+                   
Sbjct  367   QMCLRRCSFVSDFGLAEFAKCTRSLQSLQLEECNRFTQCGIFYALSNIKTKLKSFTLVKC  426

Query  963   ---------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                      V++   C +L SLTI++CP  G+  +  +G+ C +LQ + +     + D G
Sbjct  427   MGIKDIDVEVSMLSPCKSLRSLTIQNCPGFGSASMAVVGKLCPQLQHVDLTGLCGITDAG  486

Query  1116  vasllssasavlTKVKLHA-LNITDF  1190
             +  LL +  A L +V L    N+TD+
Sbjct  487   LLPLLENCEAGLVEVNLTGCWNLTDY  512



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 222/319 (70%), Gaps = 26/319 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  413
             M  + +++G++DF    ++     D  L+LSLG   DVY P  KR+R+  P V    EKK
Sbjct  1     MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSGFEKK  60

Query  414   P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             P SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+             
Sbjct  61    PVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLKLVSSIRQKEL-------------  107

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
               +  SN  E    D D   +C+G LSRS++GKKATDVRLAAIAVGT+ RGGLGKL +RG
Sbjct  108   --DVPSNKTE----DGD---DCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSIRG  158

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             SNS   ++++G+++IGR CPSL  LSLWN+  + D GLLEIA  CP LEKLDL QC +I+
Sbjct  159   SNSGSKVSDIGLTSIGRSCPSLGSLSLWNLSTISDNGLLEIAEGCPQLEKLDLNQCSTIT  218

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGLVAIA+ C NL+ LT+E+C  IG+EGL+AI R C+KL+ ++IK+CPLV DQG+ASLL
Sbjct  219   DKGLVAIAKSCPNLSELTLEACSKIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASLL  278

Query  1131  ssasavlTKVKLHALNITD  1187
             S+ +  L K+KL  LN+TD
Sbjct  279   SNTTCSLAKLKLQMLNVTD  297


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 75/166 (45%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ LA ++   S +G        GL KL      + +G+T+ G+ ++G+GCP++K
Sbjct  307   GLSITDLVLAGLS-HVSEKGFWVMGNGVGLQKLNALTITACQGVTDTGLESVGKGCPNMK  365

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
                +   P + D GL+  A+   SLE L L +C  ++  G                    
Sbjct  366   KAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGEKLKAFSLVNC  425

Query  963   ---------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                      +  +  C+ L SL+I +CP  G+  L AIG+ C +L+
Sbjct  426   LSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLE  471



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 226/323 (70%), Gaps = 21/323 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHADVYCPSRKRARITGPFVVEVQ----  404
             M  + ++SG+DDF  G  +     +  L LSLG +  Y P +KR+R++  F +  +    
Sbjct  1     MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVDYFPLQKRSRVSVSFDINREWFDE  60

Query  405   -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
              ++K SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +E+          
Sbjct  61    PKQKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEVCS--------  112

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                  NG++ D  +   D+D     +GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL 
Sbjct  113   -----NGSTGDSNVG-GDDDQGFSNEGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLT  166

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG NS RG+TNVG+ AI  GCPSLKV S+++V  + DEGL+EIA  C  LEKLDLC+CP
Sbjct  167   IRGCNSGRGVTNVGLKAIAHGCPSLKVFSVFDVATIDDEGLIEIASGCHKLEKLDLCKCP  226

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+K L+A++++C NL  L+IESCPNIGN GL+AIG+ C KL+ ++IK C  VGDQGV 
Sbjct  227   NISDKTLIAVSKKCPNLAELSIESCPNIGNIGLQAIGKLCPKLRSISIKGCSGVGDQGVC  286

Query  1122  sllssasavlTKVKLHALNITDF  1190
              LLSS S VL+KVKL +L ++D 
Sbjct  287   GLLSSTSYVLSKVKLESLMVSDL  309


 Score = 67.8 bits (164),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL        +G+T+ GI AIG+GCP++K   L     + D+GL+   R   S+E L
Sbjct  345   GLQKLNSITIEGCQGLTDTGIEAIGKGCPNVKNFQLRKCAFLSDKGLVSFTRAALSIESL  404

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIG--NEGLRAIGRYCTKLQCLTIKDC  1094
              L +C  I+  GL  +   C   L  LT+ SC  I   N  L A+   C     LT++DC
Sbjct  405   QLQECHRITQIGLFGVFFHCAAKLKVLTLISCYGIKDLNADLPAMSP-CESFWSLTVRDC  463

Query  1095  PLVGD  1109
             P  GD
Sbjct  464   PEFGD  468



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 219/310 (71%), Gaps = 16/310 (5%)
 Frame = +3

Query  276   DFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-KPSIEALPDEC  443
             DF    + C  S D  L  +LG   D+Y   RKR+RI+ PF+   + K + SIEALPDEC
Sbjct  6     DFSDVHTFCPNSKDSNLSFTLGSRVDMYFLQRKRSRISAPFIAGKKSKMQSSIEALPDEC  65

Query  444   LFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEM  623
             LFEI RRL  GRE ++ ACVSKRWLML+SS++  E+  S++ + +           +++ 
Sbjct  66    LFEILRRLPRGRETNACACVSKRWLMLLSSMKKDEMCTSETTRFVG---------PEIQS  116

Query  624   SPAD--EDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITN  797
             +P    ED +V   GYLSR +EGKKATDVRLAAIAVGT+SRGGLGKL +RGSN  RG TN
Sbjct  117   NPPKPKEDDDVS-RGYLSRCLEGKKATDVRLAAIAVGTASRGGLGKLSIRGSNETRGPTN  175

Query  798   VGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAE  977
             +G+ AI RGCPSL+ LSLW+V  VGDEGL EIA  C SLE +    CP+I++KGLVAIA+
Sbjct  176   LGLKAISRGCPSLRALSLWDVSPVGDEGLCEIASACHSLEDIQFFHCPNITDKGLVAIAK  235

Query  978   RCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTK  1157
              C NLTS+ +ESC NIGNE L+A+G YC  L+ ++IK+CPLVGD+G+ASL SS   VLT+
Sbjct  236   NCPNLTSVAVESCLNIGNESLQALGNYCPDLKFVSIKNCPLVGDKGIASLFSSVGHVLTR  295

Query  1158  VKLHALNITD  1187
              KL  LNI+D
Sbjct  296   AKLQTLNISD  305


 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 69/126 (55%), Gaps = 2/126 (2%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G++++G+ ++G+GCP +K L+L   P V D G++  AR   SLE L
Sbjct  342   GLRKLKSLTVTSCPGVSDLGLESLGKGCPDIKTLALRKCPRVSDNGVVSFARAAESLESL  401

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLR-AIGRYCTKLQCLTIKDCP  1097
              L +C  I+ +G+  I   C   L ++ + +C    + G R  +   C  L+ LTI++CP
Sbjct  402   RLEECHVITQRGVFGILANCGKKLKAIVLVNCLGNRDLGFRFPLTSRCRSLRSLTIRNCP  461

Query  1098  LVGDQG  1115
               GD G
Sbjct  462   GFGDAG  467



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 165/318 (52%), Positives = 217/318 (68%), Gaps = 32/318 (10%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEKKP  416
             M  L  +SGD+DF  G SL        LS G   DVY P+ KR+RI  P +    ++ + 
Sbjct  1     MSGLFRFSGDEDFFPGGSL-------YLSPGSQIDVYYPAHKRSRIAAPAIFSGFEQNQV  53

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SI+ LPDECLFEIFR L  G+ERS+ ACVSKRWL L+S++R  E+  S+           
Sbjct  54    SIDVLPDECLFEIFRCLPSGQERSACACVSKRWLGLLSNIRGEEVSGSE-----------  102

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
                         D+  +V+ +G+LSRS+EGKKATD++LAAI+VGT+S GGLGKL + GS+
Sbjct  103   ------------DKSQKVDDEGHLSRSLEGKKATDLKLAAISVGTASHGGLGKLSIHGSD  150

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
              +  +T+VG+ AI  GCPSL+VLSLWN+P+VGD GL EIA+ CP+LEKLDL +CP I++K
Sbjct  151   FSSKVTDVGLRAIACGCPSLRVLSLWNLPSVGDSGLYEIAQSCPALEKLDLSRCPGITDK  210

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllss  1136
             GL AIA+ C NL  LTI+SC  +GNEGL+AI R CT L+ ++I++C  +GDQGVA LL+ 
Sbjct  211   GLAAIADNCPNLIDLTIDSCSGLGNEGLKAIARCCTNLRSISIRNCSQIGDQGVAFLLAQ  270

Query  1137  asavlTKVKLHALNITDF  1190
             A+  L KVKL  LNITD 
Sbjct  271   AAGSLNKVKLQMLNITDL  288


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 79/178 (44%), Gaps = 30/178 (17%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T+  + A+G GCP LK + L     V  +GL+ +A+   SLE L
Sbjct  324   GLKKLKSLSVMSCLGMTDGALEAVGSGCPDLKQVYLSKCLLVSGKGLVSLAKSALSLESL  383

Query  924   DLCQCPSISNKGLVAI-----------------------------AERCTNLTSLTIESC  1016
              L +C  I+  G                                 +  C++L SL+I  C
Sbjct  384   KLEECHRINQFGFFGFLVNCGLKLKAFSVVNCLGIRDINPGSPLPSTYCSSLRSLSIHCC  443

Query  1017  PNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             P  G+  L  +G++C +LQ + +     V D G+  LL   SA L KV L   +NITD
Sbjct  444   PGFGDSSLTLLGKFCHQLQEVELCGLSGVTDVGLLGLLQYNSAGLLKVNLSGCINITD  501



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   298 bits (763),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 168/319 (53%), Positives = 220/319 (69%), Gaps = 24/319 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  413
             M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P V    E+K
Sbjct  1     MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEEK  60

Query  414   P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             P SI+ LPDECLFEIFRRL G +ERSS A VSK WL L+SS+R  E+             
Sbjct  61    PVSIDVLPDECLFEIFRRLPGPQERSSCAFVSKHWLTLVSSIRQKEL-------------  107

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
                    DV  S   ED + +C+G LSRS++GKKATDVRLAAIAVGT+ RGGLGKL +RG
Sbjct  108   -------DVVPSNKSEDGDDDCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSIRG  160

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             S+S   ++++G+ +IGR CPSL  LSLWN+  V D GLLEIA  C  LEKLDL +C +I+
Sbjct  161   SSSVSKVSDIGLRSIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQLEKLDLNRCSTIT  220

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGLVAIA  C NLT LT+E+C  IG+EGL+AI R C+KL+ ++IK+CPLV DQG+ASLL
Sbjct  221   DKGLVAIARSCPNLTELTLEACSRIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASLL  280

Query  1131  ssasavlTKVKLHALNITD  1187
             S+ +  L K+KL  LN+TD
Sbjct  281   SNTTFSLAKLKLQMLNVTD  299


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T+ G+ ++G+GCP++K   +   P + D GL+  A+   SLE +
Sbjct  336   GLQKLNSLTITACQGVTDAGLESVGKGCPNMKKAIISRSPLLSDNGLVSFAKASVSLESV  395

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGN--EGLRAIGRYCTKLQCLTIKDC  1094
              L +C  ++  G       C   L + ++ +C  I +   GL A   +C+ L+ L+I++C
Sbjct  396   QLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLGIRDLTTGLPA-SPHCSALRSLSIRNC  454

Query  1095  PLVGD  1109
             P  GD
Sbjct  455   PGFGD  459



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 169/316 (53%), Positives = 214/316 (68%), Gaps = 35/316 (11%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFV-VEVQEKKP  416
             M  +  +SGD+DF  G S+        LS G    VY P+RKR RI  P V +  ++K+ 
Sbjct  1     MSGIFRFSGDEDFFPGGSM-------HLSPGSCPGVYFPARKRLRIAAPSVQIGFEQKQT  53

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SIE LPDECLFEI RRL  G+ERS+ ACVSK WL L+SS+  SE+  ++S QD       
Sbjct  54    SIEVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEV--NESVQD-------  104

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
                              VE +G+LSRS+EGKKATD+RL+AI+VGTS+RGGLGKL +RGS 
Sbjct  105   -----------------VEGEGFLSRSLEGKKATDLRLSAISVGTSTRGGLGKLQIRGSG  147

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +T+VG+ +I  GCPSL+VLSLWN+P V D GL EIAR CP +EKLDL +CP I++ 
Sbjct  148   FDSKVTDVGLGSIAHGCPSLRVLSLWNLPAVSDIGLSEIARSCPMIEKLDLSRCPGITDN  207

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllss  1136
              +VAIAE C +L+ LTI+SC  IGNEGLRAI R CT L+ ++I+ CP +GDQGVA LL+ 
Sbjct  208   AMVAIAENCLHLSDLTIDSCSGIGNEGLRAIARRCTNLRSISIRSCPRIGDQGVAFLLAQ  267

Query  1137  asavlTKVKLHALNIT  1184
             A + LTKVKL  LNIT
Sbjct  268   AGSYLTKVKLQMLNIT  283


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 93/206 (45%), Gaps = 39/206 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +  G + +G        G+ KL      S RG+T+VG+ A+G GCP LK
Sbjct  294   GAAVTDLVLHGLQ-GVNEKGFWVMANAKGMKKLKSLSVMSCRGMTDVGLEAVGNGCPDLK  352

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER-------------  980
              +SL     V  +GL+ +A+   SLE L L +C  I+  G +                  
Sbjct  353   HVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGFLGFLTNCGSKLKAFSLANC  412

Query  981   ----------------CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                             C+++ SL+I  CP  G+  L  +G++C +LQ + +     V D 
Sbjct  413   MGIQDLNPESPLQLTGCSSIRSLSIRCCPGFGDASLAFLGKFCHQLQDVELSGLNGVTDA  472

Query  1113  GvasllssasavlTKVKLHA-LNITD  1187
             GV  LL S +  L KV L   +N++D
Sbjct  473   GVLELLQSNNVGLVKVNLSGCINVSD  498



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 232/336 (69%), Gaps = 31/336 (9%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARITGPFVVEVQE--  407
             MP LV Y G DD      L S  +   L L  A   DV+CP RKR+R+T PF+ +  E  
Sbjct  1     MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  408   -KKP-----SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  569
              +KP     SI+ LPDECLFEI R L G RERS++ACVSKRWLML+SS+R SEI      
Sbjct  61    AEKPKQKLCSIDVLPDECLFEILRWLPGSRERSNSACVSKRWLMLLSSIRASEI------  114

Query  570   QDLSIADKVNGASN-DVEMSP---------ADEDLEVECDGYLSRSVEGKKATDVRLAAI  719
                  A+K NG+SN D+  +P         ADE+ E E  GYL+R ++ K+ATDVRLAA+
Sbjct  115   ----AANKKNGSSNGDLLKNPLPDLNDAVSADEEEEPEKAGYLTRYLKAKEATDVRLAAM  170

Query  720   AVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIAR  899
             AVG    GGLGKL ++GSN+ R +T+ G+SA+  GCPSL+VLS+WN+P + D GL EIA 
Sbjct  171   AVGVGGHGGLGKLYIQGSNATRPLTDTGLSAVAYGCPSLRVLSMWNIPFISDVGLSEIAN  230

Query  900   ECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCL  1079
              CP LEKLDLC+CP IS+KGL+A+A +C  LTSLTIESC +IGNEGL AIGR C KL+ +
Sbjct  231   GCPMLEKLDLCRCPLISDKGLIAVARKCPKLTSLTIESCSSIGNEGLHAIGRCCPKLKSI  290

Query  1080  TIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              IKDCP VGD+GVASL+S+AS  L ++ L +++I+D
Sbjct  291   IIKDCPGVGDRGVASLVSAASCSLARIDLQSISISD  326


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 69/166 (42%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK   D+ L  +    S RG        GL KL     +S  G+TN+G+ AI +GCPSLK
Sbjct  336   GKAVADLMLTGLQY-VSERGFWVMGNTLGLQKLKSITIDSCHGVTNLGLEAIAKGCPSLK  394

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              L L     + D GL   A+   +LE L L +C  IS  G++                  
Sbjct  395   QLFLRRCCYLSDAGLKIFAQTARALENLHLEECNRISLIGVLGCLLSCNAKFRALSLVKC  454

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                            C +L SLTI  CP   +  L  +G+ C +LQ
Sbjct  455   FGINDTSFCPSPLPSCMSLRSLTIRDCPGFTSTSLAVVGKICPQLQ  500



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 210/316 (66%), Gaps = 35/316 (11%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  416
             M  +  +SGD+DF  G S+        LS G    VY P+ KR RI  P V    ++K+ 
Sbjct  1     MSGIFGFSGDEDFFLGGSM-------YLSPGSCPGVYFPAHKRLRIAAPSVFSGFEQKQT  53

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L+SS+  +E+       D S+ D  
Sbjct  54    SIDVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRNEV-------DESVQD--  104

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
                              VE +G+LSRS+EGKKATD+RLAAIAVGTSSRGGLGKL +RGS 
Sbjct  105   -----------------VEGEGFLSRSLEGKKATDLRLAAIAVGTSSRGGLGKLQIRGSG  147

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +T+ G+ AI  GCPSL+VLSLWN+P V D GL EIAR CP +EKLDL +CP I++ 
Sbjct  148   FESKVTDAGLGAIAHGCPSLRVLSLWNLPAVSDMGLSEIARSCPMIEKLDLSRCPGITDS  207

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllss  1136
              LVAIAE C NL+ LTI+SC  +GNEGLRAI R CT L+ ++I+ CP +GDQGVA LL+ 
Sbjct  208   ALVAIAENCVNLSDLTIDSCSGVGNEGLRAIARRCTNLRSISIRSCPRIGDQGVAFLLAQ  267

Query  1137  asavlTKVKLHALNIT  1184
             A + LT+VKL  LN+T
Sbjct  268   AGSYLTRVKLQMLNVT  283


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 93/206 (45%), Gaps = 39/206 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +  G + +G        GL KL      S RG+T+VG+ A+G GCP LK
Sbjct  294   GAAVTDLVLQGLQ-GVNEKGFWVMGNAKGLKKLKSLSVVSCRGMTDVGLEAVGNGCPDLK  352

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              +SL     V  +GL+ +A+    LE L L +C  I+  GL+                  
Sbjct  353   HVSLNKCLLVSGKGLVALAKSALLLETLKLEECHRINQFGLLGFLMNSGLKLKAFSLANC  412

Query  972   -------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                          A  C++L SL+I  CP  G+  L  +G +C +LQ + +     V D 
Sbjct  413   LGISDINAESPLPAPSCSSLRSLSIRCCPGFGDASLAFLGNFCHQLQDVELCGLNGVTDA  472

Query  1113  GvasllssasavlTKVKLHA-LNITD  1187
             GV  LL S +  L KV L   +N++D
Sbjct  473   GVRELLQSNNVGLVKVNLSGCINVSD  498



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 169/319 (53%), Positives = 222/319 (70%), Gaps = 27/319 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  413
             M  + +++G++DF    ++     D  L+LSLG  ADVY P  KR+R+  P +    EKK
Sbjct  1     MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKK  60

Query  414   P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             P SI+ LPDECLFEIFRRLSG +ERS+ A VSK+WL L+SS+R  EI          +  
Sbjct  61    PVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQKEI---------DVPS  111

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             K+    +D             C+G LSRS++GKKATDVRLAAIAVGT+ RGGLGKL +RG
Sbjct  112   KITEDGDD-------------CEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSIRG  158

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             SNSA+ ++++G+ +IGR CPSL  LSLWNV  + D GLLEIA  C  LEKL+L +C +I+
Sbjct  159   SNSAK-VSDLGLRSIGRSCPSLGSLSLWNVSTITDNGLLEIAEGCAQLEKLELNRCSTIT  217

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGLVAIA+ C NLT LT+E+C  IG+EGL AI R C+KL+ ++IK+CPLV DQG+ASLL
Sbjct  218   DKGLVAIAKSCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLL  277

Query  1131  ssasavlTKVKLHALNITD  1187
             S+ +  L K+KL  LN+TD
Sbjct  278   SNTTCSLAKLKLQMLNVTD  296


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 76/166 (46%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ LA ++   S +G        GL KL      + +G+T++G+ ++G+GCP++K
Sbjct  306   GLSITDLVLAGLS-HVSEKGFWVMGNGVGLQKLNSLTITACQGVTDMGLESVGKGCPNMK  364

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
                +   P + D GL+  A+   SLE L L +C  ++  G                    
Sbjct  365   KAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGEKLKAFSLVNC  424

Query  963   ---------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                      +  +  C+ L SL+I +CP  G+  L AIG+ C +L+
Sbjct  425   LSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLE  470


 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 51/122 (42%), Gaps = 26/122 (21%)
 Frame = +3

Query  825   CPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER--------  980
             C +L+ LS+ N P  GD  L  I + CP LE +DLC    I+  G + + +         
Sbjct  440   CSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQSSLVKINFS  499

Query  981   -CTNLTS----------------LTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
              C+NLT                 L I+ C NI +  L +I   C  L  L I  C  + D
Sbjct  500   GCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCA-ISD  558

Query  1110  QG  1115
              G
Sbjct  559   SG  560



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 223/319 (70%), Gaps = 17/319 (5%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC---SADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKK  413
             M  + +++G+ DF    S+         L+      DVY P RK++R++ P V    E++
Sbjct  1     MSEIFSFAGESDFCPRGSIYPNPKETSLLLSLGSLVDVYFPPRKKSRVSAPLVARAFEQE  60

Query  414   P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             P SI+ LPDECLFEIFRR+ G +ER + A VSKRWL L+SS+   E+          I++
Sbjct  61    PVSIDVLPDECLFEIFRRMPGAQERCACASVSKRWLNLLSSIHQDELE--------VISN  112

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             KV   +     S  D + +VE +GYLSRS+EGKKATDVRLAAIAVGT+ RGGLGKL + G
Sbjct  113   KVKDGA-----SKGDGEDDVESNGYLSRSLEGKKATDVRLAAIAVGTTGRGGLGKLSICG  167

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             +NSA  ++++G+ AIGRGCPSL+VLSLWN+  + D GLLEIA+ C  LEKLDLC+CP+++
Sbjct  168   NNSASRVSDLGLRAIGRGCPSLRVLSLWNLSTISDNGLLEIAKGCSQLEKLDLCRCPTVT  227

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +K LVAIA+ C N++ L+IESC +IGNE L+A+ ++C KL+ ++IK+CPLV DQG+ SLL
Sbjct  228   DKALVAIAKCCPNMSELSIESCSSIGNECLQAVAQFCPKLKSVSIKNCPLVRDQGIVSLL  287

Query  1131  ssasavlTKVKLHALNITD  1187
             S A+  L K+KL  L ITD
Sbjct  288   SKATYSLMKLKLQMLKITD  306


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 80/177 (45%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T++ + A+G+G P+LK L L   P + D GL+  A+   S+E L
Sbjct  343   GLQKLNSLTVTSCPGLTDMSLEAVGKGSPNLKKLFLSKCPLLSDNGLVSFAKSSSSVESL  402

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C  ++  G                             + ++  C  L SL+I +CP
Sbjct  403   QLEECHRVTQFGFFGSLLYCGAKLRAFSLANCLGIRDLTTGLPVSSPCNTLRSLSIRNCP  462

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHAL-NITD  1187
               G+  L A+G+ C +LQ +       + D G+  L+ ++   L KV L    N+TD
Sbjct  463   GFGDANLAALGKLCPRLQDVVFCGLNGITDSGLLQLVQTSQLSLVKVNLSGCSNLTD  519



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 166/319 (52%), Positives = 221/319 (69%), Gaps = 22/319 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEK  410
             M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P V    +EK
Sbjct  1     MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEEK  60

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             + SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+            D
Sbjct  61    QVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL------------D  108

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
              V+  SN        ED + +C+G LSRS++GKKATDVRLAAIAVGT+ RGGLGKL +RG
Sbjct  109   VVSSNSNK------SEDGDDDCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSIRG  162

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             S S   ++++G+ +IGR CPSL  LSLWN+  V D GLLEIA  C  LEKLDL +C +I+
Sbjct  163   SGSVSKVSDIGLRSIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQLEKLDLNRCSTIT  222

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGLVAIA  C NL+ LT+E+C  IG+EGL+AI R C+KL+ ++IK+CPLV DQG+ASLL
Sbjct  223   DKGLVAIARSCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASLL  282

Query  1131  ssasavlTKVKLHALNITD  1187
             S+ +  L K+KL  LN+TD
Sbjct  283   SNTTFSLAKLKLQMLNVTD  301


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T+ G+ ++G+GCP++K   +   P + D GL+  A+   SLE +
Sbjct  338   GLQKLNSLTITACQGVTDAGLESVGKGCPNMKKAIISRSPLLSDNGLVSFAKASLSLESV  397

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGN--EGLRAIGRYCTKLQCLTIKDC  1094
              L +C  ++  G       C   L + ++ +C  I +   GL A   +C+ L+ L+I++C
Sbjct  398   QLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLGIRDLATGLPA-SPHCSALRSLSIRNC  456

Query  1095  PLVGD  1109
             P  GD
Sbjct  457   PGFGD  461


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +3

Query  825   CPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSL  1001
             C +L+ LS+ N P  GD  L  + + CP LE++DLC    I+  G + + +   N L  +
Sbjct  445   CSALRSLSIRNCPGFGDANLAALGKLCPQLEEIDLCGLKGITESGFLHLIQNSLNSLVKV  504

Query  1002  TIESCPNIGNEGLRAI-GRYCTKLQCLTIKDCPLVGD  1109
                 C N+ ++ + AI  R    L+ L I  C  + D
Sbjct  505   NFSGCSNLTDKVISAITARNGWTLEVLNIDGCSNISD  541



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 208/315 (66%), Gaps = 32/315 (10%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVE-VQEKKPS  419
             M  +  +SGD+DF  G S+ +   G         VY P+RKR RI    V    ++K+ S
Sbjct  1     MSGIFGFSGDEDFFLGGSMHNLSPG-----SCPGVYFPARKRLRIAATSVFSGFEQKQTS  55

Query  420   IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  599
             I+ LPDECLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+  S             
Sbjct  56    IDVLPDECLFEILRRLPSGKERSACACVSKHWLHLLTSITRNEVVESV------------  103

Query  600   GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNS  779
                         +DLE E  G+LSRS++GKKATD+RLAA++VGTSSRGGLGKL +RGS  
Sbjct  104   ------------QDLEGE--GFLSRSLDGKKATDLRLAAVSVGTSSRGGLGKLHIRGSGF  149

Query  780   ARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG  959
                +T+ G+ AI  GCPSL+VLSLWN+P V D G+ EIAR CP +EKLDL +CP I++ G
Sbjct  150   ESNVTDAGLGAIAHGCPSLRVLSLWNLPAVSDVGVSEIARSCPMIEKLDLSRCPGITDSG  209

Query  960   LVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssa  1139
             LVAIAE C NL+ LTI+SC  +GNEGLRAI R C  L+ ++I+ CP +GDQGVA LL+ A
Sbjct  210   LVAIAENCVNLSDLTIDSCSGVGNEGLRAIARRCINLRSISIRSCPRIGDQGVAFLLAQA  269

Query  1140  savlTKVKLHALNIT  1184
              + LTKVKL  LN+T
Sbjct  270   GSYLTKVKLQMLNVT  284


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 94/206 (46%), Gaps = 39/206 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +  G + +G        GL KL      S RG+T+VG+ A+G GCP LK
Sbjct  295   GAAVTDLVLQGLQ-GVNEKGFWVMGNAKGLKKLKYLSVVSCRGMTDVGLEAVGNGCPDLK  353

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              +SL     V  +GL+ +A+   SLE L L +C  I+  GL+                  
Sbjct  354   HVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLLGFLMNSGLKLKAFSLANC  413

Query  972   -------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                          +  C++L SL+I  CP  G+  L  +G +C +LQ + +     V D 
Sbjct  414   LGIGDFNSESPLPSTSCSSLRSLSIRCCPGFGDASLAFLGNFCHQLQDVELCGLDGVTDA  473

Query  1113  GvasllssasavlTKVKLHA-LNITD  1187
             GV  LL S +  L KV L   +N++D
Sbjct  474   GVRELLQSNNVGLVKVNLSGCINVSD  499



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 212/287 (74%), Gaps = 14/287 (5%)
 Frame = +3

Query  342   DVYCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLM  521
             DVY P  KR+R T     + ++KKPSIE LPDECLFEIFR L GGRERSS ACVSKRWL+
Sbjct  2     DVYFPLSKRSR-TSASGEKFEQKKPSIEVLPDECLFEIFRWLRGGRERSSCACVSKRWLI  60

Query  522   LMSSV-----RNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEG  686
             L+S++     R++ I  + + +D S   KV G  ++VE +      +V+ DGY +R++EG
Sbjct  61    LVSNICKYEIRDNNIIHALNPKDESTNKKV-GIVSEVEHN------DVDSDGYFTRNLEG  113

Query  687   KKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPN  866
             KKATD  LAAIAVGT+SRGGLGKL +RGSNS   +T VG+ AI RGCPSL+VLSLWN+ +
Sbjct  114   KKATDGGLAAIAVGTASRGGLGKLFIRGSNSWNRVTTVGLRAISRGCPSLRVLSLWNLSS  173

Query  867   VGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRA  1046
             +GD GL EIA  C  L  LDLC CP++++K L+AIA+ C  L  LTIESC N+GNEGL A
Sbjct  174   IGD-GLCEIANGCHRLVTLDLCHCPAVTDKSLLAIAKGCPKLNDLTIESCANVGNEGLLA  232

Query  1047  IGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             +  YC  L+ ++IK+CPLVGDQGVASLLSSAS  LTK+KL ALNITD
Sbjct  233   LACYCPNLKSVSIKNCPLVGDQGVASLLSSASYSLTKLKLQALNITD  279


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 91/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L ++    S +G        GL KL      S  G+T+ G+ A+G+GC +LK
Sbjct  289   GKSVTDLSLTSLP-NVSDKGFWIMGNSQGLQKLKSFTIASCLGLTDRGLEAVGKGCVNLK  347

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-----------  986
                ++    + D+GL+  A+   SLE L L  C  I+  GL      C+           
Sbjct  348   QFYIFKCDLLSDKGLVSFAKVAGSLESLQLEDCHRITQIGLFCSLLNCSAKLKVISLVNC  407

Query  987   -----------------NLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                              +L SL+I +CP   +  L  +G+ C +LQ + ++    + D G
Sbjct  408   LGVMDLTTGLPPLSPCESLQSLSIRNCPGFSDSSLAVMGKLCPQLQHVELRGLHGITDAG  467

Query  1116  vasllssasavlTKVKLH-ALNITD  1187
                LL S +A L KV L   +N++D
Sbjct  468   FLQLLKSRNAGLVKVNLKDCVNLSD  492



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 210/295 (71%), Gaps = 25/295 (8%)
 Frame = +3

Query  309   DLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRE  482
             D  L+LSLG  ADVY P  KR+R+  P +    EKKP SI+ LPDECLFEIFRRLSG +E
Sbjct  1     DASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKKPVSIDVLPDECLFEIFRRLSGPQE  60

Query  483   RSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDG  662
             RS+ A VSK+WL L+SS+R  EI          +  K+    +D             C+G
Sbjct  61    RSACAFVSKQWLTLVSSIRQKEI---------DVPSKITEDGDD-------------CEG  98

Query  663   YLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
              LSRS++GKKATDVRLAAIAVGT+ RGGLGKL +RGSNSA+ ++++G+ +IGR CPSL  
Sbjct  99    CLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSIRGSNSAK-VSDLGLRSIGRSCPSLGS  157

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPN  1022
             LSLWNV  + D GLLEIA  C  LEKL+L +C +I++KGLVAIA+ C NLT LT+E+C  
Sbjct  158   LSLWNVSTITDNGLLEIAEGCAQLEKLELNRCSTITDKGLVAIAKSCPNLTELTLEACSR  217

Query  1023  IGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             IG+EGL AI R C+KL+ ++IK+CPLV DQG+ASLLS+ +  L K+KL  LN+TD
Sbjct  218   IGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKLQMLNVTD  272


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 75/166 (45%), Gaps = 37/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ LA ++   S +G        GL KL      + +G+T++G+ ++G+GCP++K
Sbjct  282   GLSITDLVLAGLS-HVSEKGFWVMGNGVGLQKLNSLTITACQGVTDMGLESVGKGCPNMK  340

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA-----------------  968
                +   P + D GL+  A+   SLE L L +C  ++  G                    
Sbjct  341   KAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGEKLKAFSLVNC  400

Query  969   -----------IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                         +  C+ L SL+I +CP  G+  L AIG+ C +L+
Sbjct  401   LSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLE  446


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 51/122 (42%), Gaps = 26/122 (21%)
 Frame = +3

Query  825   CPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER--------  980
             C +L+ LS+ N P  GD  L  I + CP LE +DLC    I+  G + + +         
Sbjct  416   CSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQSSLVKINFS  475

Query  981   -CTNLTS----------------LTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
              C+NLT                 L I+ C NI +  L +I   C  L  L I  C  + D
Sbjct  476   GCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCA-ISD  534

Query  1110  QG  1115
              G
Sbjct  535   SG  536



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 211/316 (67%), Gaps = 33/316 (10%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP-FVVEVQEKKP  416
             M  +  +SGD+D L G S+        LS G    VY P+RKR R+    F    +EK+ 
Sbjct  1     MSGIFRFSGDEDCLLGGSM-------YLSPGSCPGVYYPARKRLRVAATSFYSGFEEKQT  53

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SI+ LP+ECLFEI RRL  G+ERS+ ACVSK WL L+SS+  SE+  S            
Sbjct  54    SIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEVNES------------  101

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
               +  DVE          E +G+LSRS+EGKKATD+RLAAIAVGTSSRGGLGKL +RGS 
Sbjct  102   --SVQDVE----------EGEGFLSRSLEGKKATDLRLAAIAVGTSSRGGLGKLQIRGSG  149

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +T+VG+ A+  GCPSL+++SLWN+P V D GL EIAR CP +EKLDL +CP I++ 
Sbjct  150   FESKVTDVGLGAVAHGCPSLRIVSLWNLPAVSDLGLSEIARSCPMIEKLDLSRCPGITDS  209

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllss  1136
             GLVAIAE C NL+ LTI+SC  +GNEGLRAI R C  L+ ++I+ CP +GDQGVA LL+ 
Sbjct  210   GLVAIAENCVNLSDLTIDSCSGVGNEGLRAIARRCVNLRSISIRSCPRIGDQGVAFLLAQ  269

Query  1137  asavlTKVKLHALNIT  1184
             A + LTKVKL  LN++
Sbjct  270   AGSYLTKVKLQMLNVS  285


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 93/206 (45%), Gaps = 39/206 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +  G + +G        GL KL      S RG+T+VG+ A+G GCP LK
Sbjct  296   GAAVTDLVLHGLQ-GVNEKGFWVMGNAKGLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLK  354

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN----------  989
              +SL     V  +GL+ +A+   SLE L L +C  I+  GL+     C +          
Sbjct  355   HVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLMGFLMNCGSKLKAFSLANC  414

Query  990   -------------------LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                                L SL+I  CP  G+  L  +G++C +LQ + +     V D 
Sbjct  415   LGISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLAFLGKFCHQLQDVELCGLNGVTDA  474

Query  1113  GvasllssasavlTKVKL-HALNITD  1187
             GV  LL S +  L KV L   +N++D
Sbjct  475   GVRELLQSNNVGLVKVNLSECINVSD  500



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score =   300 bits (767),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/325 (54%), Positives = 213/325 (66%), Gaps = 35/325 (11%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV--------E  398
             MP  VN SG+D+   G        G  +S  + DV+C   KR RI+ PF           
Sbjct  1     MPGRVNQSGNDELHPGCR------GYTIS-SNVDVHCSPTKRTRISAPFTFGPLPRALEH  53

Query  399   VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  578
              Q+ KPSIE+LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+R  EI         
Sbjct  54    GQDLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI---------  104

Query  579   SIADKVNGASNDVEMSPADEDLE-VECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
                       + VE   +DE  E  +  G+L+R +EG+KATDVRLAAIAVGT   GGLGK
Sbjct  105   ---------DSGVETISSDESEEDAKGGGWLTRRLEGRKATDVRLAAIAVGTGCCGGLGK  155

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L +RG+NS RG+T+ G+SA+  GCPSL+ LSLWNV ++GD+GL EIA+ C  LE LDL  
Sbjct  156   LYIRGNNSTRGVTDRGLSAVACGCPSLRSLSLWNVSSIGDKGLCEIAKGCHMLETLDLSH  215

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               SI+NKGL+AIAE C NLT+L IESC  IGNEGL+ + + C KL  + IKDCPLVGD G
Sbjct  216   SSSITNKGLIAIAEGCPNLTTLNIESCSMIGNEGLQTVAKLCPKLHSICIKDCPLVGDHG  275

Query  1116  vasllssasavlTKVKLHALNITDF  1190
               S L S ++ L+KVKL  LNITDF
Sbjct  276   -VSSLLSLASNLSKVKLQILNITDF  299


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 92/206 (45%), Gaps = 38/206 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T++ L+ +    S RG        GL KL      S +G+T+  I A+G+G P LK
Sbjct  308   GKAVTNLVLSGLQ-NVSERGFCVMGVAQGLQKLMSLTITSCQGVTDASIEAMGKGFPHLK  366

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
              + L     V D GL E A+   SL+ L L +C   +  G+                   
Sbjct  367   QMCLRRCSFVSDFGLAEFAKCTRSLQSLQLEECNRFTQCGIFYALSNIKTKLKSFTLVKC  426

Query  963   ---------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                      V++   C +L SLTI++CP  G+  +  +G+ C +LQ + +     + D G
Sbjct  427   MGIKDIDVEVSMLSPCKSLRSLTIQNCPGFGSASMAVVGKLCPQLQHVDLTGLCGITDAG  486

Query  1116  vasllssasavlTKVKLHA-LNITDF  1190
             +  LL +  A L +V L    N+TD+
Sbjct  487   LLPLLENCEAGLVEVNLTGCWNLTDY  512



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   291 bits (744),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 217/320 (68%), Gaps = 25/320 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV-EVQEK  410
             M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P  V    EK
Sbjct  1     MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAFEK  60

Query  411   KP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             KP S + LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+            
Sbjct  61    KPVSFDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL------------  108

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
                     DV  S   ED   +C+G LSRS++GKKATDVRLAAIAVGT+ RGGLGKL +R
Sbjct  109   --------DVVPSNTSEDGGDDCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSIR  160

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GS S   +++VG+ +IGR CPSL  LSLWN+  V D GLLEIA  C  LEKLDL +C +I
Sbjct  161   GSTSVSKVSDVGLRSIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQLEKLDLNRCSTI  220

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             ++KGLVAIA  C NL+ LT+E+C  IG+EGL+AI R C+KL+ ++IK+CPLV DQG+ASL
Sbjct  221   TDKGLVAIARSCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASL  280

Query  1128  lssasavlTKVKLHALNITD  1187
             LS+ +  L K+KL  LN+TD
Sbjct  281   LSNTTFSLAKLKLQMLNVTD  300


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T+ G+ ++G+GCP++K   +   P + D GL+  A+   SLE +
Sbjct  337   GLQKLNSLTITACQGVTDAGLESVGKGCPNMKKAIISRSPLLSDNGLVSFAKASVSLESV  396

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGN--EGLRAIGRYCTKLQCLTIKDC  1094
              L +C  ++  G       C   L + ++ +C  I +   GL A   +C+ L+ L+I++C
Sbjct  397   QLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLGIRDLATGLPA-SPHCSALRSLSIRNC  455

Query  1095  PLVGD  1109
             P  GD
Sbjct  456   PGFGD  460



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   290 bits (743),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 206/315 (65%), Gaps = 32/315 (10%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVE-VQEKKPS  419
             M  +  +SGD+DF  G S+ +   G         VY P+RKR RI    V    +EK+ S
Sbjct  1     MSGIFGFSGDEDFFLGGSMHNLSPG-----SCPGVYFPARKRLRIAATSVFSGFEEKQTS  55

Query  420   IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  599
             I+ LPDECLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+  S             
Sbjct  56    IDVLPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEVVESVQ-----------  104

Query  600   GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNS  779
                            +VE +G+LSRS++G KATD+RLAA+AVGTSSRGGLGKL +RGS  
Sbjct  105   ---------------DVEGEGFLSRSLDGVKATDLRLAAVAVGTSSRGGLGKLHIRGSGF  149

Query  780   ARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG  959
                +T+ G+ AI  GCPSL+VLSLWN+P V D G+ EIAR CP +EKLDL +CP I++ G
Sbjct  150   ESKVTDAGLGAIAHGCPSLRVLSLWNLPAVSDVGVSEIARSCPMIEKLDLSRCPGITDSG  209

Query  960   LVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssa  1139
             LVAIAE C NL+ LTI+SC  +GNEGLRAI R C  L+ ++I+ CP +GDQGVA LL+ A
Sbjct  210   LVAIAENCVNLSDLTIDSCSGVGNEGLRAIARRCINLRSISIRSCPRIGDQGVAFLLAQA  269

Query  1140  savlTKVKLHALNIT  1184
              + LTKVKL  LN+T
Sbjct  270   GSYLTKVKLQMLNVT  284


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 93/206 (45%), Gaps = 39/206 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +  G + +G        GL KL      S RG+T+VG+ A+G GCP LK
Sbjct  295   GAAVTDLVLQGLQ-GVNEKGFWVMGNAKGLKKLKSLSVVSCRGMTDVGLEAVGSGCPDLK  353

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER-------------  980
              +SL     V  +GL+ +A+   SLE L L +C  I+  GL+                  
Sbjct  354   HVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLLGFLMNSGLKLKAFSMANC  413

Query  981   ----------------CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                             C++L SL+I  CP  G+  L  +G +C +LQ + +     V D 
Sbjct  414   LGIRDFNSESPLPSTCCSSLRSLSIRCCPGFGDASLAFLGNFCHQLQDIELCGLDGVTDA  473

Query  1113  GvasllssasavlTKVKLHA-LNITD  1187
             GV  LL S +  L KV L   +N++D
Sbjct  474   GVRELLQSNNVGLVKVNLSGCINVSD  499



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   290 bits (742),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 223/323 (69%), Gaps = 29/323 (9%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  401
             M  +  ++GD DF  G SL     +  L LSLG H D+Y P+ KR+RI+ PFV       
Sbjct  1     MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+KK SI+ LPDECLFEIFRRL  G+ERS+ ACVSKRWLML+S++R  E+  +K+   L 
Sbjct  61    QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKTTLPLK  120

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
               D  N   N+ E+S  DE   ++ DGYL+R +EGKKATDVRLAAIAVGTSS GGLGKL 
Sbjct  121   RED--NPGENE-EIS-GDEPPAIKDDGYLTRVLEGKKATDVRLAAIAVGTSSHGGLGKLS  176

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG+NS RG+T++G+  + RGCPSLKVLS+WNV +VGDEGL+EIA  C  LEKL+L  C 
Sbjct  177   IRGNNSIRGVTDLGLRTVARGCPSLKVLSIWNVSSVGDEGLIEIANGCRQLEKLELRHCN  236

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             ++S+K L+++A+ C                  L+AIG+ C  L+ ++I +CP VGDQG+A
Sbjct  237   AVSDKALISLAKNC------------------LQAIGQNCPNLKSISINNCPHVGDQGIA  278

Query  1122  sllssasavlTKVKLHALNITDF  1190
             SLLS+ S VLTKVKL AL++TD 
Sbjct  279   SLLSNTSCVLTKVKLQALHVTDL  301


 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 81/156 (52%), Gaps = 19/156 (12%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ LA +    S RG        GL KL      S +G+T++G+ A+G+GCP+LK
Sbjct  310   GKAVTDLILANLQ-NVSERGFWVMGSGHGLQKLRSFAVTSCQGMTDMGLEALGKGCPNLK  368

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESC  1016
              L + N   + D GL   A+   SLE+L L +C  I+  GL  +   C + L SLT+  C
Sbjct  369   QLCVHNCAFLSDRGLDSFAKAALSLERLQLEECHRITQYGLFTVLANCGDKLKSLTLVHC  428

Query  1017  -----PNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
                   N+G+  L +    C  L+ L+++ CP  GD
Sbjct  429   LGMKDLNMGSPMLSS----CKSLRSLSVRHCPGFGD  460



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 214/318 (67%), Gaps = 32/318 (10%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-KP  416
             M  L  +SGD+ +  G S+C       LS G +  VY P+RKR+RI+ P +    E+ + 
Sbjct  1     MSGLFRFSGDEGYFPGGSMC-------LSPGSNIGVYYPARKRSRISAPSLFSGFERNQA  53

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SIE LPDECLFEIFRRL  G+ERS  ACVSK+WL L+S++R  E   SK           
Sbjct  54    SIEVLPDECLFEIFRRLPSGQERSVCACVSKQWLGLLSNIRREEASGSK-----------  102

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
                         DE  EVE +G+LSRS+EGKK TD++LAAI+VGT+SRGGLGKL ++G  
Sbjct  103   ------------DEFQEVEDEGHLSRSLEGKKVTDLKLAAISVGTASRGGLGKLLIQGDG  150

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +T+VG+ AI RGCPSL+VLSL N+ +VGD GL EIA+ C  LEKL+L +C  I++K
Sbjct  151   FTSKVTDVGLRAIARGCPSLRVLSLLNLSSVGDVGLCEIAQSCLLLEKLELSRCAGITDK  210

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllss  1136
             GLVAIAE C NL  LTI+SC  +GNEGL+AI R+CTKL+ ++I++C  +GDQGVA LL+ 
Sbjct  211   GLVAIAENCPNLIDLTIDSCSGLGNEGLKAIARHCTKLRSISIRNCSRIGDQGVAFLLAQ  270

Query  1137  asavlTKVKLHALNITDF  1190
                 L+KVKL  LNITD 
Sbjct  271   PGCSLSKVKLQMLNITDL  288


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 90/206 (44%), Gaps = 39/206 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +  G S +G        GL KL      S +G+T+ G+ A+G GCP LK
Sbjct  297   GASVTDIVLNGLR-GVSEKGFWVMGNGKGLKKLKSLSVTSCQGMTDGGLEAVGNGCPDLK  355

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              L L     V   GL+ +A+   SLE L L +C  I+  G  +                 
Sbjct  356   QLCLSKCLLVSGNGLVSLAKSAMSLESLKLEECHRINQYGFFSFLVNCGLKLKALSVVKC  415

Query  972   -------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                          + R  +L SL+I  CP I +  L  +G++C +LQ L +     V D 
Sbjct  416   LGIRDMNPGSPLPSTRSNSLRSLSISHCPGIRDSSLALLGKFCHQLQDLELCGLNGVTDS  475

Query  1113  GvasllssasavlTKVKLH-ALNITD  1187
             G+  L+   SA L KV L   LN+TD
Sbjct  476   GLLELIQFNSAGLLKVNLSCCLNLTD  501



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   290 bits (741),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 160/298 (54%), Positives = 206/298 (69%), Gaps = 14/298 (5%)
 Frame = +3

Query  336   HADVYCPSRKRARITGPFVVEVQEKK-PSIEALPDECLFEIFRRLSGGRERSSAACVSKR  512
             H + Y   RKR RI+ PFV   + K  PSIE LPDECLFEIFRRL G +E+S  ACVSKR
Sbjct  47    HFESYSLQRKRCRISAPFVAGREVKLLPSIEILPDECLFEIFRRLHGNKEKSVCACVSKR  106

Query  513   WLMLMSSVRNSEIFRSKS--HQDLSIADKVN--------GASNDVEMSPADEDLEV---E  653
             WLML+SS+R  E + ++S  H +  I    N        G    V+ S + E+ EV   +
Sbjct  107   WLMLLSSIRKDESYTTESVGHLEPEIGFNSNVADYSPTVGEKYGVDCSSSVEEPEVGEND  166

Query  654   CDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPS  833
             C G+LSR + GKKATDVRLA+IA+GT++RGGLGKL +RGS++  G+TN+G+ A  R CPS
Sbjct  167   CHGFLSRYLGGKKATDVRLASIAIGTAARGGLGKLYIRGSDATCGLTNLGLKATARSCPS  226

Query  834   LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIES  1013
             L VLSL NV ++ DEGL EIA  C SLEKL+LC CP I++K LV IA +C +L S+T+E 
Sbjct  227   LNVLSLSNVSSITDEGLCEIAHGCHSLEKLELCHCPGITDKALVEIASQCPSLKSVTLEC  286

Query  1014  CPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             C NIGNE L+A+GR+C  L  + I+ CPL+GDQG+ SL  SA  +L K KL +LNI+D
Sbjct  287   CKNIGNESLKALGRHCPNLNHIVIRSCPLIGDQGITSLFLSAGRILQKAKLQSLNISD  344


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 78/170 (46%), Gaps = 32/170 (19%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             +S  G ++ G+  I  GCPSLK+ +L N P V D+GL+  +    +LE L L +C SI+ 
Sbjct  391   SSCPGTSDFGLQVIAEGCPSLKLFALSNCPYVSDQGLITFSSAAGALENLRLNKCNSITL  450

Query  954   KGLVAI-------------AERCTNLTSL------------------TIESCPNIGNEGL  1040
              G+ ++              E C+ +  L                  TI  CP+ G+ GL
Sbjct  451   FGVFSMLVSSCARRVKALSIENCSGIKDLDFPLPIPSSSCRRSLRSLTIADCPHFGDIGL  510

Query  1041  RAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
                G  C  L  LT+ D P + D G+  L+ S+   L KV L    N+TD
Sbjct  511   GVFGGICPGLTHLTLNDLPDITDAGILPLVRSSKIGLVKVNLSGCYNVTD  560


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 58/139 (42%), Gaps = 28/139 (20%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             + I N  + A+GR CP+L  + + + P +GD+G+  +      + +    Q  +IS+  L
Sbjct  288   KNIGNESLKALGRHCPNLNHIVIRSCPLIGDQGITSLFLSAGRILQKAKLQSLNISDVSL  347

Query  963   VAIAERCTN----------------------------LTSLTIESCPNIGNEGLRAIGRY  1058
               I +  T                             L SL+I SCP   + GL+ I   
Sbjct  348   AVIGKYGTGMVDLTLGDLHNVKEKGFWVMGKAQGLQMLKSLSISSCPGTSDFGLQVIAEG  407

Query  1059  CTKLQCLTIKDCPLVGDQG  1115
             C  L+   + +CP V DQG
Sbjct  408   CPSLKLFALSNCPYVSDQG  426



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 205/307 (67%), Gaps = 32/307 (10%)
 Frame = +3

Query  267   GDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVE-VQEKKPSIEALPDEC  443
             GD+DF  G S+ +   G         VY P+RKR RI    V    ++K+ SI+ LPDEC
Sbjct  5     GDEDFFLGGSMHNLSPG-----SCPGVYFPARKRLRIAATSVFSGFEQKQTSIDVLPDEC  59

Query  444   LFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEM  623
             LFEI RRL  G+ERS+ ACVSK WL L++S+  +E+   +S QDL               
Sbjct  60    LFEILRRLPSGKERSACACVSKHWLNLLTSITRNEV--CESVQDL---------------  102

Query  624   SPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVG  803
                      E +G+LSRS++GKKATD+RLAA+AVGTSSRGGLGKL +RGS     +T+ G
Sbjct  103   ---------EGEGFLSRSLDGKKATDLRLAAVAVGTSSRGGLGKLHIRGSGFESNVTDAG  153

Query  804   ISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC  983
             + AI  GCPSL+VLSLWN+P V D G+ EIAR CP +EKLDL +CP I++ GLVAIAE C
Sbjct  154   LDAIAHGCPSLRVLSLWNLPAVSDVGVSEIARSCPMIEKLDLSRCPGITDSGLVAIAENC  213

Query  984   TNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVK  1163
              NL+ LTI+SC  +GNEGLRAI R C  L+ ++I+ CP +GDQGVA LL+ A + LTKVK
Sbjct  214   VNLSDLTIDSCSGVGNEGLRAIARRCINLRSISIRSCPRIGDQGVAFLLAQAGSYLTKVK  273

Query  1164  LHALNIT  1184
             L  LN+T
Sbjct  274   LQMLNVT  280


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 93/206 (45%), Gaps = 39/206 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +  G + +G        GL KL      S RG+T+VG+ A+G GCP LK
Sbjct  291   GAAVTDLVLQGLQ-GVNEKGFWVMGNAKGLKKLKSLSVVSCRGMTDVGLEAVGSGCPDLK  349

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              +SL     V  +GL+ +A+   SLE L L +C  I+  GL+                  
Sbjct  350   HVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLLGFLMNAGLKLKAFSLANC  409

Query  972   -------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                          +  C++L SL+I  CP  G+  L  +G +C +LQ + +     V D 
Sbjct  410   LGIRDFNAESPLPSTSCSSLRSLSIRCCPGFGDSSLAFLGNFCHQLQDVELCGLDGVTDA  469

Query  1113  GvasllssasavlTKVKLHA-LNITD  1187
             GV  LL   +  L KV L   +N++D
Sbjct  470   GVRELLQRNNVGLVKVNLSGCINVSD  495



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 223/324 (69%), Gaps = 22/324 (7%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHADVYCPSRKRARITGPFVV-----EV  401
             M  + ++SG+DDF  G  +     +  L LSLG +  Y   +KR+R++  F +     + 
Sbjct  1     MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVDYFSLQKRSRVSVSFDINREWFDE  60

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q+++ SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI  + S  D +
Sbjct  61    QKQEISIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEICSNGSTGDYN  120

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYL-SRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
             +                D+D     +GYL SRS+EGKKATDVRLAAIAVGT+SRGGLGKL
Sbjct  121   VG--------------GDDDQGFSNEGYLLSRSLEGKKATDVRLAAIAVGTASRGGLGKL  166

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RG NS RG+TNVG+ AI  GCPSLKV S+++V  + DEGL+EIA  C  LEKLDLC+C
Sbjct  167   TIRGCNSGRGVTNVGLKAIAHGCPSLKVFSVFDVATIDDEGLIEIASGCRKLEKLDLCKC  226

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             P+IS+K L+A++++C NL  L+IESCPNIGN GL+AIG+    L+ ++IK C  VGDQGV
Sbjct  227   PNISDKTLIAVSKKCPNLGELSIESCPNIGNIGLQAIGKLGPNLRSISIKGCSGVGDQGV  286

Query  1119  asllssasavlTKVKLHALNITDF  1190
               LL+S S VL+K+KL +L ++D 
Sbjct  287   CGLLTSTSYVLSKMKLESLMVSDL  310


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL        +G+T+ GI AIG+GCP++K   L     + D+GL+   R   S+E L
Sbjct  346   GLQKLNSITIEGCQGLTDTGIEAIGKGCPNVKNFQLRKCAFLSDKGLVSFTRASLSIESL  405

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIG--NEGLRAIGRYCTKLQCLTIKDC  1094
              L +C  I+  GL  +   C   L  LT+ SC  I   N  L A+   C     LTI+DC
Sbjct  406   QLQECHRITQIGLFGVFFHCAAKLKVLTLISCYGIKDLNADLPAMSP-CESFWSLTIRDC  464

Query  1095  PLVGD  1109
             P  GD
Sbjct  465   PGFGD  469



>ref|XP_006842065.1| PREDICTED: EIN3-binding F-box protein 1 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 227/324 (70%), Gaps = 19/324 (6%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSA---DLGLMLSLG-HADVYCPSRKRARITGPFVVEVQ--  404
             M TLV YSGDD    G  L S+   D  L LSL  + DVYCP RKR+R+T PFV+     
Sbjct  1     MSTLVKYSGDDRH--GGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNT  58

Query  405   --EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR-SKSHQD  575
               ++KPS++ LPDECLFEI RR++  R+RS+ ACVSK WLML S+++  E+   SK    
Sbjct  59    NFQRKPSLDNLPDECLFEILRRVNTSRDRSACACVSKHWLMLQSTIKRVEVVADSKLTCS  118

Query  576   LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
              ++A++ + AS ++E +        + +GYLSRS+ G KATDVRLAAIAVGT  RGGLGK
Sbjct  119   DALANQEDVASFEIEENG-------DSNGYLSRSLRGNKATDVRLAAIAVGTGGRGGLGK  171

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L V GSN  RG+T++G+SAI  GCP+LK LSLWN P V DEGL EIA  CP LEKLDLCQ
Sbjct  172   LLVGGSNPTRGVTDLGLSAIAHGCPALKALSLWNTPFVSDEGLSEIADGCPQLEKLDLCQ  231

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CP I++KGL+A+A++C +LT++ +ESC  IGN  L+AI + C  L+ ++I  CPL+GDQG
Sbjct  232   CPRITDKGLIAVAKKCPSLTTMNLESCEKIGNGALKAIAQSCPNLRSVSIHGCPLIGDQG  291

Query  1116  vasllssasavlTKVKLHALNITD  1187
               + L S +  ++K+KL +LNITD
Sbjct  292   -VASLVSLATHVSKIKLQSLNITD  314


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 90/205 (44%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK+  D+ L  +    S RG        GL KL +       GIT++G+ AIGRGCP+LK
Sbjct  324   GKEIEDLGLVGLH-NVSERGFWALGNALGLQKLKLCSIALCMGITDLGLEAIGRGCPNLK  382

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI----------------  971
              L L    ++ D+GL    +    L+ L L +C  I+  GL+A                 
Sbjct  383   QLCLRRCSSLSDKGLEAFTQSAVLLKSLQLEECNKITQMGLLASLFNCRGNLNSLSLVKC  442

Query  972   ------------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                            C +L SL++  C   GN  L  +G+ C +LQ L +     V D G
Sbjct  443   MGIRDSLVGLAPLSTCNSLKSLSVRHCSGFGNGCLDILGKACPQLQNLDLSGLCGVTDDG  502

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
               +LL S  A+L K  L   +N+TD
Sbjct  503   FVALLESREALLLKANLSGCINLTD  527



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   283 bits (723),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 219/319 (69%), Gaps = 27/319 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  413
             M  + +++G+++F    ++     D  L+LSLG   DVY P  KR+R+  P V    EKK
Sbjct  1     MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSFEKK  60

Query  414   P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             P SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+            D
Sbjct  61    PVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL------------D  108

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
               +  + D +          +C+G LSRS++GKKATDVRLAAIAVGT+ RGGLGKL VRG
Sbjct  109   VTSNKTEDCD----------DCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSVRG  158

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             S+S++ +++VG+ +IGR C SL  LSLWN+ +V D GLLEIA  C  LEKL+L +C +I+
Sbjct  159   SSSSK-VSDVGLRSIGRSCASLGSLSLWNLSSVTDNGLLEIAEGCSQLEKLELNRCSTIT  217

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGLVAIA  C NL+ LT+E+C  IG+EGL+AI R C+KL+ + IK+CPLV DQG+A+LL
Sbjct  218   DKGLVAIARSCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVLIKNCPLVRDQGIAALL  277

Query  1131  ssasavlTKVKLHALNITD  1187
             S+ +  L K+KL  LN+TD
Sbjct  278   SNTTFSLAKLKLQMLNVTD  296


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/138 (27%), Positives = 64/138 (46%), Gaps = 28/138 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T+ G+ ++G+GCP++K   +   P + D GL+  A+   SLE +
Sbjct  333   GLQKLNSLTITACQGVTDTGLESVGKGCPNMKKAIISRSPLLSDNGLVSFAKASLSLESV  392

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C  ++  G                             +  +  C+ L SL+I +CP
Sbjct  393   QLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLGIRDLTTGLPASPHCSALRSLSIRNCP  452

Query  1020  NIGNEGLRAIGRYCTKLQ  1073
               G+  L AIG+ C +L+
Sbjct  453   GFGDANLAAIGKLCPQLE  470



>gb|AFZ84555.1| f-box transcription factor, partial [Populus alba]
Length=285

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTSSRGGLGKL +RGSNS RG
Sbjct  3     NDVEMVTCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSSRGGLGKLLIRGSNSVRG  62

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CPSISNKGL+A
Sbjct  63    VTNHGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIA  122

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAE C NL+SL IESC  IGNEGL+AIG+ C +L  ++IKDCPL+GD GV+SLLSSAS+V
Sbjct  123   IAENCPNLSSLNIESCSKIGNEGLQAIGKLCPRLHSISIKDCPLLGDHGVSSLLSSASSV  182

Query  1149  lTKVKLHALNITDF  1190
             LT+VKL  LNITDF
Sbjct  183   LTRVKLQGLNITDF  196



>gb|AFZ84556.1| f-box transcription factor, partial [Populus tremula]
Length=285

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTSSRGGLGKL +RGSNS RG
Sbjct  3     NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSSRGGLGKLLIRGSNSVRG  62

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CPSISNKGL+A
Sbjct  63    VTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIA  122

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAE C NL+SL IESC  IGNEGL+AIG+ C +L  ++IKDCPL+GD GV+SLLSSAS+V
Sbjct  123   IAENCPNLSSLNIESCSKIGNEGLQAIGKLCPRLHSISIKDCPLLGDHGVSSLLSSASSV  182

Query  1149  lTKVKLHALNITDF  1190
             LT+VKL  LNITDF
Sbjct  183   LTRVKLQGLNITDF  196



>gb|AEX34712.2| f-box transcription factor, partial [Populus balsamifera]
Length=285

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +3

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTSSRGGLGKL +RGSNS RG
Sbjct  3     NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSSRGGLGKLLIRGSNSVRG  62

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CPSISNKGL+A
Sbjct  63    VTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIA  122

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAE C NL+SL IESC  IGNEGL+AIG+ C +L  ++IKDCPL+GD GV+SLLSSAS+V
Sbjct  123   IAENCPNLSSLNIESCSKIGNEGLQAIGKLCPRLHSISIKDCPLLGDHGVSSLLSSASSV  182

Query  1149  lTKVKLHALNITDF  1190
             LT+VKL  LNITDF
Sbjct  183   LTRVKLQGLNITDF  196



>gb|AFZ84553.1| f-box transcription factor, partial [Populus trichocarpa]
Length=285

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = +3

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTSSRGGLGKL +RGSNS RG
Sbjct  3     NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSSRGGLGKLLIRGSNSVRG  62

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CPSISNKGL+A
Sbjct  63    VTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIA  122

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAE C NL+SL IESC  IGNEGL+AIG+ C +L  ++IKDCPL GD GV+SLLSSAS+V
Sbjct  123   IAENCPNLSSLNIESCSKIGNEGLQAIGKLCPRLHSISIKDCPLXGDHGVSSLLSSASSV  182

Query  1149  lTKVKLHALNITDF  1190
             LT+VKL  LNITDF
Sbjct  183   LTRVKLQGLNITDF  196



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score =   281 bits (720),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 193/263 (73%), Gaps = 21/263 (8%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             + ++ SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI    S     
Sbjct  104   RSQRTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYGS-----  158

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                              +E+ E+  +GYLSRS+EGKKATDVRLAAIAVGT+SRGGLGKL 
Sbjct  159   ---------------TGNENQEISDEGYLSRSLEGKKATDVRLAAIAVGTASRGGLGKLT  203

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG NS RG+TNVG+ AI  GCPSLKV SLW+V  VGD GL+EIA  C  LEKLDLC+CP
Sbjct  204   IRGCNSDRGVTNVGLKAIAHGCPSLKVCSLWDVATVGDVGLIEIASGCHQLEKLDLCKCP  263

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +IS+K L+A+A+ C NL  L+IESCPNIGNEGL+AIG+ C  L+ ++IK+C  VGDQGVA
Sbjct  264   NISDKTLIAVAKNCPNLAELSIESCPNIGNEGLQAIGK-CPNLRSISIKNCSGVGDQGVA  322

Query  1122  sllssasavlTKVKLHALNITDF  1190
              LLSSAS  LTKVKL +L ++D 
Sbjct  323   GLLSSASFALTKVKLESLTVSDL  345


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 83/178 (47%), Gaps = 30/178 (17%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL     N  +G+T+VG+  IGRGCP+++ L L     + D+GL+  AR  PS+E L
Sbjct  381   GLQKLTSITINCCQGVTDVGLEPIGRGCPNVQNLKLRKSAFLSDKGLVSFARAAPSVESL  440

Query  924   DLCQCPS-ISNKGLVAIAERC----------------------------TNLTSLTIESC  1016
              L +    I+  GL  +   C                             ++ SLTI  C
Sbjct  441   QLAKSAHRITQIGLFGVFFNCGAKLKVLTLISCYGIKDLNMDLPAISPSESIWSLTIHDC  500

Query  1017  PNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             P  GN  L  +G+ C +LQ + +     V D G   LL S+ A L KV L+  +N++D
Sbjct  501   PGFGNANLALLGKLCPRLQHVELSGLQGVTDAGFLPLLESSEAGLVKVNLNGCVNLSD  558



>gb|AEX34715.2| f-box transcription factor, partial [Populus nigra]
Length=285

 Score =   269 bits (688),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = +3

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT SRGGLGKL +RGSNS RG
Sbjct  3     NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTXSRGGLGKLLIRGSNSVRG  62

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CPSISNKGL+A
Sbjct  63    VTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIA  122

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAE C NL+SL IESC  IGNEGL+AIG+ C +L  ++IKDCPL+GD GV+SLLSSAS+V
Sbjct  123   IAENCPNLSSLNIESCSKIGNEGLQAIGKLCPRLHSISIKDCPLLGDHGVSSLLSSASSV  182

Query  1149  lTKVKLHALNITDF  1190
             LT+VKL  LNITDF
Sbjct  183   LTRVKLQGLNITDF  196



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 207/316 (66%), Gaps = 38/316 (12%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP-FVVEVQEKKP  416
             M  + ++SGD++F  G S+        LS G  + VY P RKR R+  P       +K+ 
Sbjct  1     MSGIFSFSGDEEFFNGGSM-------YLSTGSCSGVYLPPRKRLRVAAPSLYSSFNQKQT  53

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54    SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESLQ-------------  100

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
                             EVE +G+LSRS+EG KATD+RLAAI+VGTSSRGGLGKL +RGS 
Sbjct  101   ----------------EVESEGFLSRSLEGNKATDLRLAAISVGTSSRGGLGKLQIRGSG  144

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +T+ GI +I  GCPSLK LSLWN+P V D+GL EIAR CP LE+LDL +CP +++K
Sbjct  145   FESRVTDAGIESIAYGCPSLKSLSLWNLPAVSDKGLSEIARCCPMLERLDLSRCPGVTDK  204

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllss  1136
             GLVA+AE C NL  LTI+SC  +GNEGLRA+ R C+ L+ ++++ CP VGDQGVA LL+ 
Sbjct  205   GLVAVAESCRNLNDLTIDSCSGVGNEGLRAVARGCSSLRSISLRSCPRVGDQGVAFLLAQ  264

Query  1137  asavlTKVKLHALNIT  1184
             A + LTKVKL  +N+T
Sbjct  265   AGSYLTKVKLQMVNVT  280


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 83/176 (47%), Gaps = 28/176 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             G+ KL      S RG+T+VG+ A+G GCP LK +SL     V  +GL+ +A+   +LE L
Sbjct  318   GMKKLKSLSVTSCRGMTDVGVEAVGSGCPDLKHVSLNKCLLVSGKGLVSLAKSALALESL  377

Query  924   DLCQCPSISNKGLVAIAE------------RCTNLTSLTIES---------------CPN  1022
              L +C  I++ G +                 C  +  L  ES               CP 
Sbjct  378   KLEECHRINHFGFLGFLMNCGEKLKAFSLVNCLGIQDLNSESHLTSTSSLRSLSVRCCPG  437

Query  1023  IGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
              G+  L  +G++C +LQ + +     V D GV SLL S +  L K+ L+  +N++D
Sbjct  438   FGDASLTFLGKFCHQLQDVELCGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNVSD  493



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 159/319 (50%), Positives = 218/319 (68%), Gaps = 25/319 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFL--AGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQEKK  413
             M  + ++SG++DF     +     D+ L+LSLG   D Y P  KR+R+  P      E+K
Sbjct  1     MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAFEEK  60

Query  414   P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             P SI+ LP+ECLFEIFRRLSG +ER++ A VS+ WL L++S+R SE+             
Sbjct  61    PVSIDVLPEECLFEIFRRLSGSQERTACASVSRHWLTLVTSIRQSEL-------------  107

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
                    DV  S   ED E +C+G LSRS++GKKATDVRLAAIAVGT+SRGGLGKL +RG
Sbjct  108   -------DVVPSSKTEDGE-DCEGCLSRSLDGKKATDVRLAAIAVGTASRGGLGKLSIRG  159

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             ++    ++++G+ +I R CPSL+ +SLWN+  + D GL EIA  C  LEKLDL +C  I+
Sbjct  160   NDFTSKVSDLGLRSIARSCPSLRSVSLWNLSTITDNGLSEIAEGCSQLEKLDLNRCSMIT  219

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGLVAIA+ C NLT LT+E+C  IG+EGL+A+ R C KL+ ++IK+CPLV DQG+A+LL
Sbjct  220   DKGLVAIAKSCPNLTELTLETCLKIGDEGLQAVARSCPKLKSVSIKNCPLVRDQGIAALL  279

Query  1131  ssasavlTKVKLHALNITD  1187
             S+ ++ L K+KL  LN+TD
Sbjct  280   SNTTSSLGKLKLQLLNVTD  298


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T++G+ ++G+GCP++K+  +   P + D GL+  A+   SLE L
Sbjct  335   GLQKLNSLTITACQGVTDMGLESVGKGCPNMKMAVVSKCPLLSDNGLVSFAKASLSLESL  394

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGN--EGLRAIGRYCTKLQCLTIKDC  1094
              L +C  ++  G       C T L + ++ +C  + +   GL A   +C  L+ L+I++C
Sbjct  395   QLVECHRVTQFGFFGSLLNCGTKLKAFSLVNCLGVRDLTTGLPA-SSHCIALRSLSIRNC  453

Query  1095  PLVGD  1109
             P  GD
Sbjct  454   PGFGD  458



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 204/323 (63%), Gaps = 68/323 (21%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ---  404
             M TLVNYSGDDDF  G S      D GL++S+G   DVYCP RKR+RIT P++       
Sbjct  3     MSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLE  62

Query  405   -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
              EK+PSI+ LPDECLFEI RRL GG+ERSS A VSKRWLML+SS+R +EI   KS Q L 
Sbjct  63    LEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSL-  121

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                      ND              DGYL+R +EGKKATD+ LAAIAVGTSSRGGLGKL 
Sbjct  122   ---------ND--------------DGYLTRCLEGKKATDISLAAIAVGTSSRGGLGKLS  158

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +R S+S+RG+TN+G+S I  GC                          PSL  L L    
Sbjct  159   IRESSSSRGVTNLGLSKIAHGC--------------------------PSLRVLSLWN--  190

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
                      ++  C NLT+LTIESC NIGNE L+AIG  C KLQ ++IKDCPLVGDQGVA
Sbjct  191   ---------VSANCPNLTALTIESCANIGNESLQAIGSLCPKLQSISIKDCPLVGDQGVA  241

Query  1122  sllssasavlTKVKLHALNITDF  1190
              LLSSA+++L++VKL +LNITDF
Sbjct  242   GLLSSATSILSRVKLQSLNITDF  264


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 2/123 (2%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL  L      S RGIT+V + A+G+GCP+LK + L     V D GL+  A+   SLE L
Sbjct  300   GLQTLISLTITSCRGITDVSLEAMGKGCPNLKQMCLRKCCFVSDNGLIAFAKAAGSLEGL  359

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGL-RAIGRYCTKLQCLTIKDCP  1097
              L +C  ++  G++     C + L SL++  C  I +  +   +   C  L+ L+I++CP
Sbjct  360   QLEECNRVTQLGVIGSLSNCGSKLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCP  419

Query  1098  LVG  1106
               G
Sbjct  420   GFG  422



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score =   278 bits (710),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 162/324 (50%), Positives = 213/324 (66%), Gaps = 25/324 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHAD-VYCPSRKRARITGPFVVEVQ---  404
             M  +++++G DDF  G S  L   +  L LSLG  +  Y P +KR+R   PF    +   
Sbjct  1     MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  405   EKKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  578
             + KP  SIE LPDECLFEI RRL  G++RS  A VSKRWL L+SS+  +EI         
Sbjct  61    DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEI---------  111

Query  579   SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
                      SN    +   ++ E   +GYLSRS+EGKKATDVRLAAIAVGT SRGGLGKL
Sbjct  112   --------CSNASSGNKDSDNQEFGDEGYLSRSLEGKKATDVRLAAIAVGTQSRGGLGKL  163

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              + GSN  R +T+VG+ A+  GCPSLK  +LW+V  + D GL+EIA  C  +E LDLC+ 
Sbjct  164   SIHGSNPDRALTDVGLKAVAHGCPSLKSFTLWDVATISDAGLIEIANGCHQIENLDLCKL  223

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             P+IS+K L+A+A+ C NLT L+IESCP+IGNEGL AIG+ C  L+ ++IK+CP V DQG+
Sbjct  224   PTISDKALIAVAKHCPNLTELSIESCPSIGNEGLHAIGKLCPNLRSVSIKNCPGVRDQGI  283

Query  1119  asllssasavlTKVKLHALNITDF  1190
             A LL SAS +L K+ L +L ++D+
Sbjct  284   AGLLCSASIILKKLTLESLAVSDY  307


 Score = 67.8 bits (164),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 77/163 (47%), Gaps = 29/163 (18%)
 Frame = +3

Query  786   GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV  965
             G+T++G+ A+G+GCP++K   L     + D GL+   +  PS+  L L +C  I+  G+ 
Sbjct  357   GVTDIGLHAVGKGCPNVKNFQLRRCSFLSDNGLVSFTKAAPSIVSLQLEECHRITQFGVA  416

Query  966   -AIAER---------------------------CTNLTSLTIESCPNIGNEGLRAIGRYC  1061
              AI  R                           C  ++SL+I +CP +GN  L  +G+ C
Sbjct  417   GAILNRGTKLKVLTLVSCYGIKDLNLNLPAVPPCQTISSLSIRNCPGVGNFTLNVLGKLC  476

Query  1062  TKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               LQCL +     + D G  SLL  + A L  V L   +N+TD
Sbjct  477   PTLQCLELIGLEGITDPGFISLLQRSKASLGNVNLSGCINLTD  519



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 203/319 (64%), Gaps = 38/319 (12%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP---FVVEVQEK  410
             M  +   SGDD+F  G    S    + LS G    VY P+RKR R+T     F    +EK
Sbjct  1     MSGIFRVSGDDEFFTGGGGSS----MHLSPGSCPGVYLPARKRLRVTAAATSFYSSFEEK  56

Query  411   KPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             + SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+   E       +     
Sbjct  57    QASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRDESVEEVESE-----  111

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
                                     G+LSRS+EG KATD+RLAAI+VGTS+RGGLGKL +R
Sbjct  112   ------------------------GFLSRSLEGNKATDLRLAAISVGTSARGGLGKLQIR  147

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GS     +T+ G+ A+ RGC SLKVLSLWN+P V D G+ EIAR CP +EKLDL +CP I
Sbjct  148   GSGFESKVTDAGLGAVARGCASLKVLSLWNLPAVSDVGVSEIARSCPMIEKLDLSRCPGI  207

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             ++KGLVAIAE C NL+ LTI+SC  +GNEGLRA+ R C  L+ ++IK CP +GDQGV+ L
Sbjct  208   TDKGLVAIAENCKNLSELTIDSCSGVGNEGLRAVARGCGNLRSISIKSCPRIGDQGVSFL  267

Query  1128  lssasavlTKVKLHALNIT  1184
             L+ A + LTKVKL  +N+T
Sbjct  268   LAQAGSYLTKVKLQMVNVT  286


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 79/176 (45%), Gaps = 28/176 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             G+ KL      + RG+T+VG+ A+G GC  LK +SL     V  +GL+ +A+   SLE L
Sbjct  324   GMKKLKSLSVTACRGMTDVGLEAVGNGCTDLKHVSLNKCLLVSGKGLVALAKSASSLESL  383

Query  924   DLCQCPSISNKGLVAIAERC---------TNLTSLT------------------IESCPN  1022
              L +C  I+  G +     C         TN   ++                  I  CP 
Sbjct  384   KLEECHRINQFGFLGFLMNCGVKLKSFSLTNCLGISEAPLPSSSTSCSSLRSLSIRHCPG  443

Query  1023  IGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
              G+  L  +G+ C +LQ + +     V D GV  L+ S S  L KV L   +N++D
Sbjct  444   FGDASLSFLGKLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVNLSGCINVSD  499



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score =   277 bits (708),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 205/316 (65%), Gaps = 38/316 (12%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGPF-VVEVQEKKP  416
             M  + ++SGD+DF  G ++        LS G    VY P RKR R+  P       +K+ 
Sbjct  1     MSGIFSFSGDEDFFNGGTM-------HLSPGSCPGVYLPPRKRLRVAAPSPYSAFNQKQT  53

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54    SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESVQ-------------  100

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
                             EVE +G+LSRS+EG KATD+RLAAI+VGTS+RGGLGKL +RGS 
Sbjct  101   ----------------EVESEGFLSRSLEGNKATDLRLAAISVGTSARGGLGKLQIRGSG  144

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +T+ GI +I  GCPSLK LSLWN+P V D+GL EIAR CP LEKLDL +CP +++K
Sbjct  145   FESRVTDAGIESIAYGCPSLKALSLWNLPAVSDKGLSEIARCCPMLEKLDLSRCPGVTDK  204

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllss  1136
             GLVAIAE C NL  LTI+SC  +GNEGLR I R C+ L+ ++++ CP VGDQGVA LL+ 
Sbjct  205   GLVAIAENCRNLNDLTIDSCSGVGNEGLRGIARRCSSLRSISLRSCPRVGDQGVAFLLAQ  264

Query  1137  asavlTKVKLHALNIT  1184
             A + LTKVKL  +N+T
Sbjct  265   AGSYLTKVKLQMVNVT  280


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 94/204 (46%), Gaps = 37/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L+ +  G + +G        G+ KL      S RG+T+VG+ A+G GCP LK
Sbjct  291   GVAVTDLVLSGLQ-GVNEKGFWVMGNAKGMKKLKSLSVTSCRGMTDVGVEAVGSGCPDLK  349

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAE------------RC  983
              +SL     V  +GL+ +A+   +LE L L +C  I++ G +                 C
Sbjct  350   HVSLNKCLLVSGKGLVSLAKSALALESLKLEECHRINHFGFLGFLMSCGSKLKAFSLVNC  409

Query  984   TNLTSLTIES---------------CPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
               +  L  ES               CP  G+  L  +G++C +LQ + +     V D GV
Sbjct  410   LGIQDLNSESHLTSTSSLRSLSVRCCPGFGDASLTFLGKFCHQLQDVELCGLNGVTDAGV  469

Query  1119  asllssasavlTKVKLHA-LNITD  1187
              SLL S +  L K+ L+  +N+TD
Sbjct  470   LSLLQSNNVGLVKLNLNGCVNVTD  493



>gb|AEX34714.2| f-box transcription factor, partial [Populus laurifolia]
Length=285

 Score =   267 bits (682),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = +3

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTS+RGGLGKL +RGSNS  G
Sbjct  3     NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSTRGGLGKLLIRGSNSVLG  62

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CPSISNKGL+A
Sbjct  63    VTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIA  122

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAE C NL+SL IESC  IGNEGL+AIG+ C +L  ++IKDCPL+GD GV+SLLSSAS+V
Sbjct  123   IAENCPNLSSLNIESCSKIGNEGLQAIGKLCPRLHSISIKDCPLLGDHGVSSLLSSASSV  182

Query  1149  lTKVKLHALNITDF  1190
             LT+VKL  LNITDF
Sbjct  183   LTRVKLQGLNITDF  196



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score =   277 bits (709),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 162/324 (50%), Positives = 213/324 (66%), Gaps = 25/324 (8%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHAD-VYCPSRKRARITGPFVVEVQ---  404
             M  +++++G DDF  G S  L   +  L LSLG  +  Y P +KR+R   PF    +   
Sbjct  1     MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  405   EKKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  578
             + KP  SIE LPDECLFEI RRL  G++RS  A VSKRWL L+SS+  +EI         
Sbjct  61    DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEI---------  111

Query  579   SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
                      SN    +   ++ E   +GYLSRS+EGKKATDVRLAAIAVGT SRGGLGKL
Sbjct  112   --------CSNASSGNKDSDNQEFGDEGYLSRSLEGKKATDVRLAAIAVGTQSRGGLGKL  163

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              + GSN  R +T+VG+ A+  GCPSLK  +LW+V  + D GL+EIA  C  +E LDLC+ 
Sbjct  164   SIHGSNPDRALTDVGLKAVAHGCPSLKSFTLWDVATISDAGLIEIANGCHQIENLDLCKL  223

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             P+IS+K L+A+A+ C NLT L+IESCP+IGNEGL AIG+ C  L+ ++IK+CP V DQG+
Sbjct  224   PTISDKALIAVAKHCPNLTELSIESCPSIGNEGLHAIGKLCPNLRSVSIKNCPGVRDQGI  283

Query  1119  asllssasavlTKVKLHALNITDF  1190
             A LL SAS +L K+ L +L ++D+
Sbjct  284   AGLLCSASIILKKLTLESLAVSDY  307


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 77/163 (47%), Gaps = 29/163 (18%)
 Frame = +3

Query  786   GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV  965
             G+T++G+ A+G+GCP++K   L     + D GL+   +  PS+  L L +C  I+  G+ 
Sbjct  357   GVTDIGLHAVGKGCPNVKNFQLRRCSFLSDNGLVSFTKAAPSIVSLQLEECHRITQFGVA  416

Query  966   -AIAER---------------------------CTNLTSLTIESCPNIGNEGLRAIGRYC  1061
              AI  R                           C  ++SL+I +CP +GN  L  +G+ C
Sbjct  417   GAILNRGTKLKVLTLVSCYGIKDLNLNLPAVPPCQTISSLSIRNCPGVGNFTLNVLGKLC  476

Query  1062  TKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
               LQCL +     + D G  SLL  + A L  V L   +N+TD
Sbjct  477   PTLQCLELIGLEGITDPGFISLLQRSKASLGNVNLSGCINLTD  519



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   276 bits (707),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 207/316 (66%), Gaps = 38/316 (12%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP-FVVEVQEKKP  416
             M  + +++GD++F  G S+        LS G  + VY P RKR R++ P       +K+ 
Sbjct  1     MSGIFSFNGDEEFFNGGSM-------YLSPGSCSGVYLPPRKRLRVSTPSLYSSFNQKQT  53

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54    SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESLQ-------------  100

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
                             EVE +G+LSRS+EG KATD+RLAAI+VGTSSRGGLGKL +RGS 
Sbjct  101   ----------------EVESEGFLSRSLEGNKATDLRLAAISVGTSSRGGLGKLQIRGSG  144

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +T+ GI +I  GCPSLK LSLWN+P V D+GL EIAR CP LE+LDL +CP +++K
Sbjct  145   FESRVTDAGIESIAYGCPSLKALSLWNLPAVSDKGLSEIARCCPMLERLDLSRCPGVTDK  204

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllss  1136
             GLVA+AE C NL  LTI+SC  +GNEGLR I R C+ L+ ++++ CP VGDQGVA LL+ 
Sbjct  205   GLVAVAENCRNLNDLTIDSCSGVGNEGLRGIARGCSSLRSISLRSCPRVGDQGVAFLLAQ  264

Query  1137  asavlTKVKLHALNIT  1184
             A + LTKVKL  +N+T
Sbjct  265   AGSYLTKVKLQMVNVT  280


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 87/176 (49%), Gaps = 28/176 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             G+ KL      S RG+T+VG+ A+G GCP LK +SL     V  +GL+ +A+   +LE L
Sbjct  318   GMKKLKSLSVTSCRGMTDVGVEAVGSGCPDLKHVSLNKCLLVSGKGLVGLAKSALALESL  377

Query  924   DLCQCPSISNKG----LVAIAER--------CTNLTSLTIES---------------CPN  1022
              L +C  I++ G    L++  E+        C  +  L  ES               CP 
Sbjct  378   KLEECHRINHFGFLRFLMSCGEKLKAFSLVNCLGIQDLNSESHLTSTSSLRSLSVRCCPG  437

Query  1023  IGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
              G+  L  +G++C +LQ + +     V D GV SLL S +  L K+ L+  +N++D
Sbjct  438   FGDASLTFLGKFCHQLQDVELCGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNVSD  493



>gb|AEX34713.2| f-box transcription factor, partial [Populus deltoides]
Length=285

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = +3

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTS RGGLGKL +RGSNS RG
Sbjct  3     NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSCRGGLGKLLIRGSNSVRG  62

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CPSISNKGL+A
Sbjct  63    VTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIA  122

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAE C NL+SL IESC  IGNEGL+ IG+ C +L  ++IKDCPL+GD GV+SLLSSAS+V
Sbjct  123   IAENCPNLSSLNIESCSKIGNEGLQVIGKLCPRLHSVSIKDCPLLGDHGVSSLLSSASSV  182

Query  1149  lTKVKLHALNITDF  1190
             LT+VKL  LNITDF
Sbjct  183   LTRVKLQGLNITDF  196



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   275 bits (704),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 222/322 (69%), Gaps = 28/322 (9%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHAD--VYCPSRKRARI--TGPFVVEVQ  404
             M  + +++G++DF    ++     +  L+LSL       Y P  KR+R+  T P +    
Sbjct  1     MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  405   EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             E KP SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L++S++ +EI          
Sbjct  61    EAKPVSIDVLPDECLFEIFRRLPGPQERSACASVSKHWLTLVTSIKQNEI----------  110

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                   GA    ++S   ED + +C+G LSRS++GKKATDVRLAAIAVGT+ RGGLGKL 
Sbjct  111   ------GA----DLSNKTEDGD-DCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLS  159

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RG++S   ++++G+ +IGR CPSLK +SLWN+  + D GL EIA+ CP LEKLDL +C 
Sbjct  160   IRGNDSTSKVSDLGLRSIGRSCPSLKAVSLWNLSTITDNGLSEIAQGCPQLEKLDLSRCN  219

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I+NKGLVAIA+ C NL+ LT+E+C  IG+EGL+A+ R C+KL+ ++IK+CPLV DQG+A
Sbjct  220   TITNKGLVAIAKCCPNLSELTLEACSRIGDEGLQAVARSCSKLKSVSIKNCPLVRDQGIA  279

Query  1122  sllssasavlTKVKLHALNITD  1187
             +LLS+ +  L K+KL  LN+TD
Sbjct  280   ALLSNTTYSLAKLKLQMLNVTD  301


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 69/152 (45%), Gaps = 33/152 (22%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T+ G+ ++G+GCP++K   +   P + D GL+  A+   SLE L
Sbjct  338   GLQKLNSLTITACQGVTDTGLESVGKGCPNMKKALVSKSPLLSDNGLVSFAKASLSLESL  397

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              + +C  ++  G                             +  +  C+ L SL++ +CP
Sbjct  398   QIEECHRVTQFGFFGSLLNCGAKLKAFSLVKCLGIRDLTTGLPASTHCSALRSLSVRNCP  457

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               G+  L A+G+ C KL+     D  L G +G
Sbjct  458   GFGDANLAALGKLCPKLE-----DIELYGLKG  484



>gb|AFZ84554.1| f-box transcription factor, partial [Populus maximowiczii]
Length=285

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = +3

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGTS RGGLGKL +RGSNS  G
Sbjct  3     NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGTSXRGGLGKLLIRGSNSVXG  62

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN G+SAI RGCPSL+ LSLWNVP VGDEGL EIA+EC  LEKLDL  CPSISNKGL+A
Sbjct  63    VTNRGLSAIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIA  122

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasav  1148
             IAE C NL+SL IESC   GNEGL+AIG+ C +L  ++IKDCPL+GD GV+SLLSSAS+V
Sbjct  123   IAENCPNLSSLNIESCSKXGNEGLQAIGKLCPRLHSISIKDCPLLGDHGVSSLLSSASSV  182

Query  1149  lTKVKLHALNITDF  1190
             LT+VKL  LNITDF
Sbjct  183   LTRVKLQGLNITDF  196



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 205/321 (64%), Gaps = 42/321 (13%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP----FVVEVQE  407
             M  +   SGDD+F  G         + LS G    VY P+RKR R+       F    +E
Sbjct  1     MSGIFRISGDDEFFTG-----GGSSMHLSPGSCPGVYLPARKRLRVASAAATSFYSSFEE  55

Query  408   KKPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSV-RNSEIFRSKSHQDLS  581
             K+ SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+ RN  +   +S     
Sbjct  56    KQTSIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSIARNESVEEVES-----  110

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                                      +G+LSRS+EG KATD+RLAAI+VGTS+RGGLGKL 
Sbjct  111   -------------------------EGFLSRSLEGNKATDLRLAAISVGTSARGGLGKLQ  145

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +RGS     +T+ G+ A+ RGC SLKVLSLWN+P V D G+ EIAR CP +EKLDL +CP
Sbjct  146   IRGSGFESKVTDAGLGAVARGCASLKVLSLWNLPAVSDVGVSEIARSCPLIEKLDLSRCP  205

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
              I++KGLVAIAE C NL+ LTI+SC  +GNEGLRA+ R C  L+ ++IK CP +GDQGV+
Sbjct  206   GITDKGLVAIAENCKNLSELTIDSCSGVGNEGLRAVARGCGNLRSISIKSCPRIGDQGVS  265

Query  1122  sllssasavlTKVKLHALNIT  1184
              LL+ A + LTKVKL  +N+T
Sbjct  266   FLLAQAGSYLTKVKLQMVNVT  286


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 79/175 (45%), Gaps = 27/175 (15%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             G+ KL      S RG+T+VG+ A+G GCP LK + L     V  +GL+ +A+   SLE L
Sbjct  324   GMKKLKSLSVTSCRGMTDVGLEAVGNGCPDLKHVCLNKCLLVSGKGLVALAKSASSLESL  383

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLT-------------------------IESCPNI  1025
              L +C  ++  G +     C + + S +                         I  CP  
Sbjct  384   KLEECHRVNQFGFLGFLMNCGSTMKSFSMANCLGISEAPLPSSTSCSSLRSLSIRHCPGF  443

Query  1026  GNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             G+  L  +G+ C +LQ + +     V D GV  L+ S S  L KV L   +N++D
Sbjct  444   GDASLSFLGKLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVNLSGCINVSD  498



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   273 bits (697),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/283 (54%), Positives = 201/283 (71%), Gaps = 15/283 (5%)
 Frame = +3

Query  342   DVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWL  518
             D Y P  KR R++ P    V E+ P SI+ LPDECLFE+FRRL G +ERS  A VSKRWL
Sbjct  37    DAYFPPCKRTRVSAPTAFSVFEQDPVSIDVLPDECLFEVFRRLPGAQERSVCASVSKRWL  96

Query  519   MLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKAT  698
              L+S +R  E+            D ++  + D  M   ++D++ +  GYLSRS+EGKKA+
Sbjct  97    NLLSGIRPDEL------------DDISKKAKDASMEDCEDDVDCD--GYLSRSLEGKKAS  142

Query  699   DVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDE  878
             DVRLAAIAVGT+  GGLGKL + G+NSA  ++++G+ AIGRGCPSL+VLSLW++  + D 
Sbjct  143   DVRLAAIAVGTAGCGGLGKLSICGNNSACRVSDLGLRAIGRGCPSLRVLSLWDLSTISDT  202

Query  879   GLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRY  1058
             GLLEIA+ C  LEKLDL +CP+I++K L+AIA+ C  L+ LTIESC  IGN  L+A+ R+
Sbjct  203   GLLEIAKGCSQLEKLDLSRCPTITDKALIAIAKSCLGLSELTIESCSRIGNASLQAVARF  262

Query  1059  CTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             C KL+ + IK+CPLV DQG+ASLLS ++  L K+KL  LNITD
Sbjct  263   CPKLKSVCIKNCPLVRDQGIASLLSKSTCSLMKLKLQMLNITD  305


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 81/177 (46%), Gaps = 29/177 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T++G+ A+G+GCP+LK L L   P + D GL+  A+   S+E L
Sbjct  342   GLQKLNSLSITSCPGVTDMGLEAVGKGCPNLKKLLLSKCPLLSDNGLVSFAKASLSVESL  401

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C  +++ G                             +  +  C  + SL+I +CP
Sbjct  402   QLEECHRVTHLGFFGSLLNCGAKLRAFSLVNCFGIRDLTTCLPPSSPCNTIRSLSIRNCP  461

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHAL-NITD  1187
               G+  L A+G+ C +++ L +     + D G   LL S    L KV L    N+TD
Sbjct  462   GFGDANLSALGQLCPQIENLELCGLNGITDSGFLQLLHSTQLSLVKVNLAGCSNLTD  518


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 59/126 (47%), Gaps = 28/126 (22%)
 Frame = +3

Query  816   GRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLT  995
             G G   L  LS+ + P V D GL  + + CP+L+KL L +CP +S+ GLV+ A+   ++ 
Sbjct  340   GVGLQKLNSLSITSCPGVTDMGLEAVGKGCPNLKKLLLSKCPLLSDNGLVSFAKASLSVE  399

Query  996   SLTIESCPNIGNEG-----------LRAIGRY-----------------CTKLQCLTIKD  1091
             SL +E C  + + G           LRA                     C  ++ L+I++
Sbjct  400   SLQLEECHRVTHLGFFGSLLNCGAKLRAFSLVNCFGIRDLTTCLPPSSPCNTIRSLSIRN  459

Query  1092  CPLVGD  1109
             CP  GD
Sbjct  460   CPGFGD  465



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score =   272 bits (695),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 159/319 (50%), Positives = 202/319 (63%), Gaps = 38/319 (12%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP---FVVEVQEK  410
             M  +   SGDD+F  G    S    + LS G    VY P+RKR R+T     F    +EK
Sbjct  1     MSGIFRVSGDDEFFTGGGGSS----MHLSPGSCPGVYLPARKRLRVTAAATSFYSSFEEK  56

Query  411   KPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             + SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+   E       +     
Sbjct  57    QASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRDESVEEVESE-----  111

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
                                     G+LSRS+EG KATD+RLAAI+VGTS+ GGLGKL +R
Sbjct  112   ------------------------GFLSRSLEGNKATDLRLAAISVGTSACGGLGKLQIR  147

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GS     +T+ G+ A+ RGC SLKVLSLWN+P V D G+ EIAR CP +EKLDL +CP I
Sbjct  148   GSGFESKVTDAGLGAVARGCASLKVLSLWNLPAVSDVGVSEIARSCPMIEKLDLSRCPGI  207

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             ++KGLVAIAE C NL+ LTI+SC  +GNEGLRA+ R C  L+ ++IK CP +GDQGV+ L
Sbjct  208   TDKGLVAIAENCKNLSDLTIDSCSGVGNEGLRAVARGCGNLRSISIKSCPRIGDQGVSFL  267

Query  1128  lssasavlTKVKLHALNIT  1184
             L+ A + LTKVKL  +N++
Sbjct  268   LAQAGSYLTKVKLQMVNVS  286


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 79/176 (45%), Gaps = 28/176 (16%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             G+ KL      + RG+T+VG+ A+G GC  LK +SL     V  +GL+ +A+   SLE L
Sbjct  324   GMKKLKSLSVTACRGMTDVGLEAVGNGCTDLKHVSLNKCLLVSGKGLVALAKSASSLESL  383

Query  924   DLCQCPSISNKGLVAIAERC---------TNLTSLT------------------IESCPN  1022
              L +C  I+  G +     C         TN   ++                  I  CP 
Sbjct  384   KLEECHRINQFGFLGFLMNCGVKLKSFSLTNCLGISEAPLPSSSTSCSSLRSLSIRHCPG  443

Query  1023  IGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
              G+  L  +G+ C +LQ + +     V D GV  L+ S S  L KVKL   +N+ D
Sbjct  444   FGDASLSFLGKLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVKLSGCINVAD  499



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/282 (54%), Positives = 197/282 (70%), Gaps = 22/282 (8%)
 Frame = +3

Query  345   VYCPSRKRARITGPFVVEVQEK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLM  521
             VY   RKR R+  PFV   + K  PSI+ALPDECLFEI RRL G  E+S+ ACVSKRWLM
Sbjct  1     VYSLQRKRCRVNAPFVASREFKLPPSIDALPDECLFEILRRLPGINEKSACACVSKRWLM  60

Query  522   LMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATD  701
             L+SS+   E + +++ ++              E SP          G+LSRSVEGK A+D
Sbjct  61    LLSSISRDESYTTEALREFE------------ESSPR---------GFLSRSVEGKNASD  99

Query  702   VRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEG  881
             VRLAAIA+GT++RGGLGKL VRGS S   +T++GI AI R CPSL+VLSLWN+ ++ DEG
Sbjct  100   VRLAAIAIGTAARGGLGKLSVRGSKSTPKLTDLGIKAIARCCPSLRVLSLWNLSSISDEG  159

Query  882   LLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYC  1061
             L EIA  C SLEKL+L  CP I+++ LV IA +C +LTS+T+ESC NIG+  L+A G  C
Sbjct  160   LCEIAHGCRSLEKLELYHCPLITDRALVDIAAKCPDLTSVTLESCKNIGDGSLKAFGSCC  219

Query  1062  TKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              KL+ ++I+ CPLVGD+G+++L SSA  +L K KL +L+ITD
Sbjct  220   PKLKHVSIRSCPLVGDRGISNLFSSAGNILEKAKLQSLSITD  261


 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 75/178 (42%), Gaps = 29/178 (16%)
 Frame = +3

Query  741   GGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEK  920
             GGL  L      S R  ++  +  +  GCP +   +L +V NV D+GL+  +    SLE 
Sbjct  297   GGLQNLKSLSITSCREASDAALQVVAEGCPLMNFFALCDVSNVSDQGLIAFSNSAKSLET  356

Query  921   LDLCQCPSISNKGLVAI----------------------------AERCTNLTSLTIESC  1016
             L + +C +I+  G+ ++                               C +L SL I +C
Sbjct  357   LHIGRCDNITQYGVFSVLSNCGRRLKALSIENCLGMKDLNFTLPLTSSCDSLRSLAIVNC  416

Query  1017  PNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHAL-NITD  1187
             P  G+ GL  + R C +L  L     P + D G+  ++  +   L KV L    N+TD
Sbjct  417   PGFGDSGLGMVARICLRLTSLDFSGLPDITDAGILPVVQVSGFGLVKVNLSGCHNLTD  474



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 218/321 (68%), Gaps = 36/321 (11%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGHADVYCPSRKRARITGP----FVVEVQE  407
             M  + +++G+ +F   GS+   A++ L L     D Y P  KR+R+       F    +E
Sbjct  1     MSQIYSFAGESEFYRRGSNPKEANIFLSL----VDCYYPPCKRSRVVAAAPSLFSAFEEE  56

Query  408   KKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             +KP SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+           
Sbjct  57    EKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL-----------  105

Query  585   ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
                      DV +    ED   +C+G LSRS++GKKATDVRLAA+AVGT+ RGGLGKL V
Sbjct  106   ---------DVVVDNKTED---DCEGCLSRSLDGKKATDVRLAAVAVGTAGRGGLGKLSV  153

Query  765   RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPS  944
             RGS+    ++++G+ +IGR CPSL  LSL N+  V D GLLEIA  CP LEKLDL +CP+
Sbjct  154   RGSDK---VSDLGLRSIGRSCPSLGSLSLCNLSAVTDVGLLEIAEGCPQLEKLDLSRCPA  210

Query  945   ISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
             I++KGLVAIA+ C NL+ LT+E+C  IG+EGL+A+ R C+KL+ ++IK+CPLV DQGVA+
Sbjct  211   ITDKGLVAIAKSCPNLSELTLEACLRIGDEGLQAVARSCSKLKSVSIKNCPLVRDQGVAA  270

Query  1125  llssasavlTKVKLHALNITD  1187
             LLS+ +  LTK+KL  LN+TD
Sbjct  271   LLSNTTCSLTKLKLQMLNVTD  291


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 30/149 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T+ G+ ++G+GCP++K   +   P + D GL+  A+   SLE +
Sbjct  328   GLQKLNSLTIIACQGVTDAGLESVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESI  387

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C  ++  G                             +  +  C+ L SL++ +CP
Sbjct  388   QLEECHRVTQFGFFGSLLNCGAKLKAFSMVNCLGIRDLATGLPASSHCSGLRSLSVRNCP  447

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVG  1106
               G+  L A+G+ C +L+   I+ C L G
Sbjct  448   GFGDANLAALGKLCPQLE--DIELCGLKG  474



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 165/326 (51%), Positives = 212/326 (65%), Gaps = 34/326 (10%)
 Frame = +3

Query  243   MPTLVNYSGDDDFL-AGSSLCSADLGLMLSLGHAD----VYCPSRKRARITGPFV-----  392
             MP L NY G  +   AG S+C   L L   L   D     Y P  KRARI+   +     
Sbjct  1     MPALANYCGTGELHNAGGSICKTQLNLGKLLYTGDNAGVYYYPPNKRARISSSVLSVESE  60

Query  393   VEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  572
              EV E++ SIE LPDECLFEI RRL   +ER  + CVSKRWL +++S+R SE        
Sbjct  61    TEVSEQQ-SIEILPDECLFEILRRLPRVKERCLSLCVSKRWLNVLTSMRLSEF-------  112

Query  573   DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLG  752
                       A NDV+M  +++D     DG   R +EGKKATD+ L  +AVG +   GL 
Sbjct  113   ---------SACNDVDMVLSEDDD----DGSRVRCLEGKKATDMTLFGLAVGRNLCNGLV  159

Query  753   KLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLC  932
             KL + GS+ A   +N G+SA+ R C SL+ LSLWNVP+VGD+GL E+A+EC  LEKLDL 
Sbjct  160   KLSITGSSMA---SNFGVSAVARSCTSLRALSLWNVPHVGDKGLPEVAKECHLLEKLDLS  216

Query  933   QCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
              CPS+++KGL+++A+ C NLT+L +ESCP IGNE L AIGRYC KL+ +T+KDCPLVGD 
Sbjct  217   HCPSVTSKGLISVAQNCPNLTTLKLESCPRIGNEALLAIGRYCPKLESITVKDCPLVGDH  276

Query  1113  GvasllssasavlTKVKLHALNITDF  1190
             G++SL+SSAS VL+KV LH L+ITDF
Sbjct  277   GISSLISSASPVLSKVNLHGLSITDF  302


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 92/205 (45%), Gaps = 38/205 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  T + L+ + +  + RG        GL KL   G  S RG+T++ + A+G+ C +LK
Sbjct  311   GKSITSLMLSNL-LNVTERGFWVMGNARGLHKLVSLGVTSCRGVTDLSLEALGKCCITLK  369

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAE------------RC  983
              + L     + D GL+  ++   SLE L L +C  I   G+  +              RC
Sbjct  370   QVCLRKCGFISDNGLVAFSKAMGSLETLKLEECNGIGQSGICGVLSSCGGKLKFLSLLRC  429

Query  984   T----------------NLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             T                +L SL+++SCP  GN GL  +G+ C  LQ L +       D G
Sbjct  430   TGIRDLAFKSSDLYPCNSLRSLSVQSCPGFGNGGLANLGKLCPNLQHLDLSGLYGTTDAG  489

Query  1116  vasllssasavlTKVKLHA-LNITD  1187
             +  L+ +  A L  V L +  N+TD
Sbjct  490   LLPLIENNRAGLVTVNLTSCFNLTD  514



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 210/328 (64%), Gaps = 43/328 (13%)
 Frame = +3

Query  243   MPTLVNYSGDDDFL-AGSSLCSADLGLMLSL---GHADVYCPSRKRARITGPFVVEVQEK  410
             MP L N  G  +F  A  S+C   L L  S     + DVY P  KRAR++        E 
Sbjct  1     MPALANCCGAGEFHNATGSICKTQLNLGKSRFVGNNVDVYYPPGKRARLS--------ES  52

Query  411   KP------SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  572
             +P      SIE LPDECLFEI RRL G +ER  ++CVS+RWL +++ +R SE        
Sbjct  53    EPEATDRSSIEILPDECLFEILRRLPGVKERCVSSCVSRRWLSVLTMIRLSEF-------  105

Query  573   DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG--TSSRGG  746
                       A NDV+M P+D+D     DG   R +EGKKATD+ L+AIAVG   S+  G
Sbjct  106   ---------SACNDVDMVPSDDDE----DGCRVRCLEGKKATDMTLSAIAVGRRISNCDG  152

Query  747   LGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLD  926
             L KL +RGS+    +++ G+SAI R CPSL+ LSLWNV  VGD+GL E+A+EC  LEKLD
Sbjct  153   LVKLSIRGSSM---VSDFGVSAIARSCPSLRSLSLWNVLRVGDKGLSEVAKECRLLEKLD  209

Query  927   LCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVG  1106
             LC CPS+S+ GL+AIA  C NLT+L IESCP IGNE L+A+G+ C KL   ++KDCPL+G
Sbjct  210   LCHCPSVSSLGLIAIARYCPNLTTLHIESCPKIGNEALQAVGQCCPKLASTSVKDCPLIG  269

Query  1107  DQGvasllssasavlTKVKLHALNITDF  1190
             D G++SL+SSAS  L+KV +H L ITDF
Sbjct  270   DHGISSLVSSASPTLSKVNIHGLGITDF  297


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 65/142 (46%), Gaps = 28/142 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL   G  S +GIT++   A+G+   +LK + L     V D GL+E ++   SLE L
Sbjct  333   GLCKLMSLGITSCKGITDLSFGALGKCGIALKHVFLRKCCFVSDNGLVEFSKAIGSLETL  392

Query  924   DLCQCPSISNKGLVAIAE------------RCT----------------NLTSLTIESCP  1019
              L +C  ++  G+  +              RCT                +L SLT+ +CP
Sbjct  393   QLEECNRVTQSGICGVLSSSGANLKSLSLLRCTGMKDLTLGSMDLSPCNSLRSLTVCNCP  452

Query  1020  NIGNEGLRAIGRYCTKLQCLTI  1085
               GN GL  +G+   +LQ L +
Sbjct  453   GFGNVGLTILGKLSPQLQNLDL  474



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 217/322 (67%), Gaps = 39/322 (12%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGHADVYCPSRKRARITGP----FVVEVQE  407
             M  + +++G+ +F   GS+   A++ L L     D Y P  KR+R+       F    +E
Sbjct  1     MSQIYSFAGESEFYRRGSNPKEANIFLSL----VDCYYPPCKRSRVVAAAPSLFSAFEEE  56

Query  408   KKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  584
             +KP SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+           
Sbjct  57    EKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL-----------  105

Query  585   ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKK-ATDVRLAAIAVGTSSRGGLGKLC  761
                      DV     D   E +C+G LSRS++GKK ATDVRLAA+AVGT+ RGGLGKL 
Sbjct  106   ---------DV-----DNKTEDDCEGCLSRSLDGKKKATDVRLAAVAVGTAGRGGLGKLS  151

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             VRGS+    ++++G+ +IGR CPSL  LSL N+  V D GLLEIA  CP LEKLDL +CP
Sbjct  152   VRGSDK---VSDLGLRSIGRSCPSLGSLSLCNLSAVTDIGLLEIAEGCPQLEKLDLSRCP  208

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
             +I++KGLVAIA+ C NL+ L++E+C  IG+EGL+A+ R C+KL+ ++IK+CPLV DQGVA
Sbjct  209   AITDKGLVAIAKSCPNLSELSLEACLRIGDEGLQAVARSCSKLRSVSIKNCPLVRDQGVA  268

Query  1122  sllssasavlTKVKLHALNITD  1187
             +LLS+ +  LTK+KL  LN+TD
Sbjct  269   ALLSNTTCSLTKLKLQMLNVTD  290


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 30/149 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T+ G+ ++G+GCP++K   +   P + D GL+  A+   SLE +
Sbjct  327   GLQKLNSLTITACQGVTDTGLESVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESI  386

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C  ++  G                             +  +  C+ L SL++ +CP
Sbjct  387   QLEECHRVTQFGFFGSLLNCGAKLKAFSMVNCLGIRDLATGLPASSHCSGLRSLSVRNCP  446

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVG  1106
               G+  L A+G+ C +L+   I+ C L G
Sbjct  447   GFGDANLAALGKLCPQLE--DIELCGLKG  473



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 199/295 (67%), Gaps = 25/295 (8%)
 Frame = +3

Query  309   DLGLMLSL-GHADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRE  482
             D  L+LSL    DVY P  KR R+  P +    EKKP SI+ LPDECLFEIFRRLSG +E
Sbjct  25    DASLLLSLISFGDVYFPPSKRQRVVLPTLFSAFEKKPVSIDVLPDECLFEIFRRLSGPQE  84

Query  483   RSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDG  662
             RS+ A VSK+WL  +SS+R  EI         ++  K+          P D D    C+G
Sbjct  85    RSACAFVSKQWLTTVSSIRQKEI---------TVPSKI----------PEDGD---NCEG  122

Query  663   YLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
              LSRS++GKK TDVRLAA AVGT+ RG LGKL +RGSNS + ++++ + +IGR CPSL  
Sbjct  123   TLSRSLDGKKRTDVRLAANAVGTAGRGILGKLSIRGSNSGK-VSDLPLRSIGRSCPSLGS  181

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPN  1022
             LSLWNV  + D G+LEIA  C  LEKLDL +C  I++K LV IA+ C NLT +T+E+C  
Sbjct  182   LSLWNVSTITDNGILEIAAGCAQLEKLDLNRCSPITDKNLVDIAKSCPNLTDVTLEACSR  241

Query  1023  IGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             IG+EGL AI R  +KL+ ++IK+CPLV DQG+ASLLS+ +  L K+KL  LN+TD
Sbjct  242   IGDEGLLAIARSRSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKLQMLNVTD  296


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 73/166 (44%), Gaps = 36/166 (22%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+    IA   S +G        GL KL      + +G+ ++G+ ++G+GCP++K
Sbjct  306   GLSITDLAPRWIAHAVSEKGFWVMGNGVGLQKLNSLTIPACQGVADMGLESVGKGCPNMK  365

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL-------------------  962
                +   P + D GL+  A+   SL+ L L +C   +  G                    
Sbjct  366   KAIISKSPLLSDNGLVSFAKASLSLDSLQLEECHRNTQFGFFGSLLNCGEKLKAFSLVNC  425

Query  963   ---------VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
                      +  +  C+ L SL+I +CP IG+  L AIG+ C +L+
Sbjct  426   LSIRHLTTGLPASSHCSALRSLSIRNCPGIGDANLAAIGKLCPQLE  471



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score =   257 bits (656),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 188/264 (71%), Gaps = 10/264 (4%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q  +PS++ALPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+ ++ +    S
Sbjct  66    QPPQPSLDALPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRASELGQATAAAPPS  125

Query  582   IAD--KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGK  755
             + D  +      D + SP D  +E        R +EGK+ATDVRLAA+AV   SRGGL K
Sbjct  126   LPDLNEEFVMEEDTDDSPVDPCVE--------RVLEGKEATDVRLAAMAVVAGSRGGLEK  177

Query  756   LCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             L VRGS+  RG+T+ G+ A+ RG P+L  L+LW+VP V D  L EIA  CP LE+LD+  
Sbjct  178   LAVRGSHPTRGVTDQGLLAVARGSPNLCSLALWDVPLVTDSALAEIAAGCPLLERLDITS  237

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CP I++KGL A+A+ C NL SLTIE+C  + NEGLRAIGR C+KLQ ++IK+C  VGDQG
Sbjct  238   CPLITDKGLTAVAQGCPNLVSLTIEACSGVANEGLRAIGRCCSKLQAVSIKNCARVGDQG  297

Query  1116  vasllssasavlTKVKLHALNITD  1187
             ++SL+ SASA L K++L  LNITD
Sbjct  298   ISSLVCSASASLAKIRLQGLNITD  321


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 74/151 (49%), Gaps = 9/151 (6%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ LA +A VG       ++  GL KL     NS  GIT++ +++I + C SLK 
Sbjct  331   GKSVTDLTLARLAAVGERGFWVMANASGLQKLRCISVNSCPGITDLALASIAKFCSSLKQ  390

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESCP  1019
             L L    +V D GL   A     LE L L +C  ++  G++A    C+    +L++  C 
Sbjct  391   LCLKKSGHVSDAGLKAFAESAKLLENLQLEECNRVTLVGVLACLINCSQKFRTLSLVKCL  450

Query  1020  NIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
              + +     A    C  L+ LTIKDCP   D
Sbjct  451   GVKDICSAPAQLPVCKSLRFLTIKDCPGFTD  481



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 191/262 (73%), Gaps = 4/262 (2%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q   PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+         +
Sbjct  59    QLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL----GQAAAA  114

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
              AD  +    + E    +++ E   D  + R +EGK+ATDVRLAA+AV   SRGGL KL 
Sbjct  115   AADTPSLPDLNEEFVMEEDNEESPADRCVDRVLEGKEATDVRLAAMAVVAGSRGGLEKLA  174

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             VRGS+  RG+T+ G+SA+ RG P+L  L+LW+VP + D GL EIA  CPSLE+LD+C+CP
Sbjct  175   VRGSHPTRGVTDQGLSAVARGSPNLSSLALWDVPLITDAGLAEIAAGCPSLERLDICRCP  234

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
              I++KGLVA+A+ C NL SLTIE+CP + NEGLRAIGR C KLQ + IK+CPLVGDQG++
Sbjct  235   LITDKGLVAVAQGCPNLVSLTIEACPGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGIS  294

Query  1122  sllssasavlTKVKLHALNITD  1187
             SL+ SA+A LTK++L  LNITD
Sbjct  295   SLVCSATAALTKIRLQGLNITD  316


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 85/204 (42%), Gaps = 36/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +A VG       ++  GL  L      S  G+T++ +++I + CP+LK 
Sbjct  326   GKAITDLTLTRLAAVGERGFWVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFCPNLKQ  385

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI-----------------  971
             L L     V D GL          E L L +C  +S  G++A                  
Sbjct  386   LYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSLVGILAFLLNCREKFRALSLVKCM  445

Query  972   -----------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
                           C +L  LTI+ CP   +  L A+G  C +L+ + +     V D G+
Sbjct  446   GIKDICSAPAQLPLCRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDLSGLGEVTDNGL  505

Query  1119  asllssasavlTKVKLHAL-NITD  1187
               L+ S+ A L KV L    NITD
Sbjct  506   LPLIQSSEAGLVKVDLSGCKNITD  529



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 189/266 (71%), Gaps = 15/266 (6%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI----FRSKSH  569
             Q  +PS++ LPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+      + S 
Sbjct  61    QPPQPSLDGLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRVSELGHAALAAPSL  120

Query  570   QDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGL  749
              DL+    +   ++D   SPAD  +E        R +EG +ATDVRLAA+AV   SR GL
Sbjct  121   PDLNEEFVMEEGTDD---SPADPCVE--------RVLEGNEATDVRLAAMAVVAGSRRGL  169

Query  750   GKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDL  929
              KL +RGS+  RG+T+ G+ A+ RG P+L  L+LW+VP V D GL EIA  CPSLE+LD+
Sbjct  170   EKLAIRGSHPTRGVTDQGLLAVARGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDI  229

Query  930   CQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
               CP I++KGL AIA+ C NL SLTIE+C  +GNEGLRAIGR C KLQ ++IK+C  VGD
Sbjct  230   TSCPLITDKGLAAIAQGCPNLVSLTIEACSGVGNEGLRAIGRCCLKLQAVSIKNCMHVGD  289

Query  1110  QGvasllssasavlTKVKLHALNITD  1187
             QG++SL+ SASA LTK++L  LNITD
Sbjct  290   QGISSLVCSASASLTKIRLQGLNITD  315


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 69/146 (47%), Gaps = 9/146 (6%)
 Frame = +3

Query  684   GKKATDVRLAAI-AVG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  T++ LA + AVG       ++  GL KL      S  G+T++ I+ I + CP LK 
Sbjct  325   GKAVTELTLARLSAVGERGFWVMANAAGLQKLRCMSVTSCLGVTDLAITCIAKFCPGLKQ  384

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESCP  1019
             L L    +V D GL         LE L L +C  ++  G++A    C+    +L++  C 
Sbjct  385   LCLRKCGHVSDAGLKAFTESAKVLENLQLEECNRVTLVGVLACLINCSQKFRALSLVKCT  444

Query  1020  NIGNE-GLRAIGRYCTKLQCLTIKDC  1094
              + +     A    C  L+ LTIKDC
Sbjct  445   GVRDVCSAPAQLPVCKSLRFLTIKDC  470



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 187/262 (71%), Gaps = 7/262 (3%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q + PS++ALPDECLFEI RR+ G   R +AACVS+RWL L+ S+R SE  ++ +  D  
Sbjct  56    QRQLPSLDALPDECLFEILRRVPG--RRGAAACVSRRWLALLGSIRVSEFGQAAAAADTP  113

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
                 +N      E    ++  EV  D  + R +EGK+ATDVRLAA+AV   S GGL KL 
Sbjct  114   SLPDLNE-----EFVMEEDKEEVPADRCVDRVLEGKEATDVRLAAMAVVAGSCGGLEKLS  168

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             VRGS+ ARG+T+ G+SA+ RG P+L  L+LW+VP + D GL+EIA  CP LE+LD+ +CP
Sbjct  169   VRGSHPARGVTDQGLSAVARGSPNLSSLALWDVPLITDAGLVEIAAGCPLLERLDISRCP  228

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
              I++KGL A A+ C +L SLTIE+C ++G+EGLRAIGR C KLQ + IK+CPLVGDQG++
Sbjct  229   LITDKGLAAFAQGCPDLVSLTIEACSSVGDEGLRAIGRSCMKLQAVNIKNCPLVGDQGIS  288

Query  1122  sllssasavlTKVKLHALNITD  1187
             SL+ SA+A L K++L  LNITD
Sbjct  289   SLVCSATASLAKIRLQGLNITD  310


 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 85/202 (42%), Gaps = 34/202 (17%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +A VG       ++  GL  L      S  G+T++ +++I + CPSLK 
Sbjct  320   GKAITDLSLTRLATVGERGFWVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFCPSLKK  379

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAE---------------  977
             L L    +V D GL          E L L +C  ++  G++A                  
Sbjct  380   LYLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTLVGILAFLNCSQKFRALSLVKCMG  439

Query  978   -----------RCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
                         C +L  LTI+ CP   N  L  +G  C +L+ + +     V D G+  
Sbjct  440   IKDICSVPQLPFCRSLRFLTIKDCPGFTNASLAVVGMICPQLEQVDLSGLGEVTDNGLLP  499

Query  1125  llssasavlTKVKLHAL-NITD  1187
             L+ S+ + L KV L    NITD
Sbjct  500   LIQSSESGLIKVDLSGCKNITD  521



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score =   255 bits (652),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 191/262 (73%), Gaps = 4/262 (2%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  581
             Q   PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+         +
Sbjct  162   QLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL----GQAAAA  217

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
              AD  +    + E    +++ E   D  + R +EGK+ATDVRLAA+AV   SRGGL KL 
Sbjct  218   AADTPSLPDLNEEFVMEEDNEESPADRCVDRVLEGKEATDVRLAAMAVVAGSRGGLEKLA  277

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             VRGS+  RG+T+ G+SA+ RG P+L  L+LW+VP + D GL EIA  CPSLE+LD+C+CP
Sbjct  278   VRGSHPTRGVTDQGLSAVARGSPNLSSLALWDVPLITDAGLAEIAAGCPSLERLDICRCP  337

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
              I++KGLVA+A+ C NL SLTIE+CP + NEGLRAIGR C KLQ + IK+CPLVGDQG++
Sbjct  338   LITDKGLVAVAQGCPNLVSLTIEACPGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGIS  397

Query  1122  sllssasavlTKVKLHALNITD  1187
             SL+ SA+A LTK++L  LNITD
Sbjct  398   SLVCSATAALTKIRLQGLNITD  419


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 85/204 (42%), Gaps = 36/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +A VG       ++  GL  L      S  G+T++ +++I + CP+LK 
Sbjct  429   GKAITDLTLTRLAAVGERGFWVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFCPNLKQ  488

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI-----------------  971
             L L     V D GL          E L L +C  +S  G++A                  
Sbjct  489   LYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSLVGILAFLLNCREKFRALSLVKCM  548

Query  972   -----------AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
                           C +L  LTI+ CP   +  L A+G  C +L+ + +     V D G+
Sbjct  549   GIKDICSAPAQLPLCRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDLSGLGEVTDNGL  608

Query  1119  asllssasavlTKVKLHAL-NITD  1187
               L+ S+ A L KV L    NITD
Sbjct  609   LPLIQSSEAGLVKVDLSGCKNITD  632



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score =   251 bits (641),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 216/320 (68%), Gaps = 34/320 (11%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP---FVVEVQE  407
             M  + +++G+ +F   GS+   A++   LSLG   D Y P  KR+R+      F    +E
Sbjct  1     MSQIYSFAGESEFYRRGSNPKEANI--FLSLGSLVDCYYPPCKRSRVVAAPSLFSAFEEE  58

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             K  SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+            
Sbjct  59    KPVSIDVLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL------------  106

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
                     DV     D   E + +G LSRS++GKKATDVRLAAIAVGT+ RGGLGKL VR
Sbjct  107   --------DV----VDHKTEDDSEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSVR  154

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GS+    ++++G+ +IGR CPSL  LSL ++  V D GLLEIA  CP LEKLDL +CP+I
Sbjct  155   GSDK---VSDLGLRSIGRSCPSLGSLSLCSLSAVTDIGLLEIAEGCPQLEKLDLSRCPAI  211

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             ++K LVAIA+ C NL+ LT+E+C +IG+EGL+A+ R C+KL+ ++IK+CPLV DQG+A+L
Sbjct  212   TDKCLVAIAKSCPNLSELTLEACSSIGDEGLQAVARSCSKLKSVSIKNCPLVRDQGIAAL  271

Query  1128  lssasavlTKVKLHALNITD  1187
             LS+ +  LTK+KL  +N+TD
Sbjct  272   LSNTTCSLTKLKLQMVNVTD  291


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 67/149 (45%), Gaps = 30/149 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      + +G+T+ G+ ++G+GCP++K   +   P + D GL+  A+   SLE +
Sbjct  328   GLQKLNSLTITACQGVTDAGLESVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESI  387

Query  924   DLCQCPSISNKGLVAIAERC----------------------------TNLTSLTIESCP  1019
              L +C  ++  G       C                            + L SL++ +CP
Sbjct  388   QLEECHRVTQFGFFGSLLNCGAKLKAFSMVNCLGIRDLATGLPASSHRSGLRSLSVRNCP  447

Query  1020  NIGNEGLRAIGRYCTKLQCLTIKDCPLVG  1106
               G+  L A+G+ C +L+   I+ C L G
Sbjct  448   GFGDANLAALGKLCPQLE--DIELCGLKG  474



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score =   252 bits (643),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 188/271 (69%), Gaps = 16/271 (6%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK------  563
             Q + PS++ALPDECLFE+ RRL GGRER ++ACVS+RWL L+ S+R SE+ ++       
Sbjct  62    QRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASELNQATAAAAAA  121

Query  564   ---SHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTS  734
                S  DL+    +     + E SP         D  + R +EGK+ATDVRLAA+AV   
Sbjct  122   APPSLPDLNEEFVMEEDDEEEESSPV-------VDPCVERVLEGKEATDVRLAAMAVVAG  174

Query  735   SRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSL  914
             SR GL KL VRGS+  RG+T+ G+ A+ RG P+L  L+LW+VP V D GL EIA  CPSL
Sbjct  175   SRRGLEKLAVRGSHPTRGVTDRGLLAVARGSPNLCSLALWDVPLVTDAGLAEIAAGCPSL  234

Query  915   EKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDC  1094
             E+LD+ +CP I++KGL A+A  C NL SLT+ESC  +GN+GLRAIGR C+K+Q L IK+C
Sbjct  235   ERLDITRCPLITDKGLAAVAHGCPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNC  294

Query  1095  PLVGDQGvasllssasavlTKVKLHALNITD  1187
               +GDQG++SL+ SA+A LTK++L  LNITD
Sbjct  295   ARIGDQGISSLVCSATASLTKIRLQGLNITD  325


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 68/152 (45%), Gaps = 11/152 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  + V  + RG        GL  L      S  G+TN+ ++AI + CPSL+
Sbjct  335   GKAVTDLTLVRLPV-VAERGFWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLR  393

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
              LS     ++ D GL         LE L L +C  ++  G++     C     SL++  C
Sbjct  394   QLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTLVGILDFLVNCGPKFRSLSLVKC  453

Query  1017  PNIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
               I +     A    C  LQ LTIKDCP   D
Sbjct  454   MGIKDICSTPAQLPLCKSLQFLTIKDCPDFTD  485



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score =   249 bits (637),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 188/271 (69%), Gaps = 15/271 (6%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK------  563
             Q + PS++ALPDECLFE+ RRL GGRER ++ACVS+RWL L+ S+R SE+ ++       
Sbjct  54    QRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASELNQATAAAAAA  113

Query  564   ---SHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTS  734
                S  DL+    +     + + S    D  VE      R +EGK+ATDVRLAA+AV   
Sbjct  114   APPSLPDLNEEFVMEEDDEEEKESSPVVDPCVE------RVLEGKEATDVRLAAMAVVAG  167

Query  735   SRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSL  914
             SR GL KL VRGS+  RG+T+ G+ A+ RG P+L  L+LW+VP V D GL EIA  CPSL
Sbjct  168   SRRGLEKLAVRGSHPTRGVTDRGLLAVARGSPNLCSLALWDVPLVTDAGLAEIAAGCPSL  227

Query  915   EKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDC  1094
             E+LD+ +CP I++KGL A+A  C NL SLT+ESC  +GN+GLRAIGR C+K+Q L IK+C
Sbjct  228   ERLDITRCPLITDKGLAAVAHGCPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNC  287

Query  1095  PLVGDQGvasllssasavlTKVKLHALNITD  1187
               +GDQG++SL+ SA+A LTK++L  LNITD
Sbjct  288   ARIGDQGISSLVCSATASLTKIRLQGLNITD  318


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 68/152 (45%), Gaps = 11/152 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  + V  + RG        GL  L      S  G+TN+ ++AI + CPSL+
Sbjct  328   GKAVTDLTLVRLPV-VAERGFWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLR  386

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
              LS     ++ D GL         LE L L +C  ++  G++     C     SL++  C
Sbjct  387   QLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTLVGILDFLVNCGPKFRSLSLVKC  446

Query  1017  PNIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
               I +     A    C  LQ LTIKDCP   D
Sbjct  447   MGIKDICSTPARLPLCKSLQFLTIKDCPDFTD  478



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score =   249 bits (636),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 188/262 (72%), Gaps = 11/262 (4%)
 Frame = +3

Query  414   PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  593
             PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ ++ +  D      
Sbjct  66    PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAADTPSLPD  125

Query  594   VNGA----SNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             +N        D E SPAD      C   + R +EGK+ATDVRLAA+AV   SRGGL KL 
Sbjct  126   LNEEFVMEEEDKEESPADR-----C--AVDRVLEGKEATDVRLAAMAVVAGSRGGLEKLA  178

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             VRGS+  RG+T+ G+SA+ RG P+L  L+LW+VP + D GL EIA  CPSLE+LD+ +CP
Sbjct  179   VRGSHPTRGVTDQGLSAVARGSPNLGSLALWDVPLITDAGLAEIAAGCPSLERLDISRCP  238

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGva  1121
              I++KGL A+A+ C NL SLTIE+C  + NEGLRAIGR C KLQ + IK+CPLVGDQG++
Sbjct  239   LITDKGLAAVAQGCPNLVSLTIEACSGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGIS  298

Query  1122  sllssasavlTKVKLHALNITD  1187
             SL+ SA+A L K++L  LNITD
Sbjct  299   SLVCSATASLAKIRLQGLNITD  320


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 9/151 (6%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +A VG       ++  GL  L      S  G+T++ +++I + CPSLK 
Sbjct  330   GKAVTDLTLTRLATVGERGFWVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFCPSLKQ  389

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESCP  1019
             L L    +V D GL          E L L +C  ++  G++A    C+    +L++  C 
Sbjct  390   LCLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTLVGILAFLLNCSQKFRALSLVKCM  449

Query  1020  NIGNEG-LRAIGRYCTKLQCLTIKDCPLVGD  1109
              I + G   A    C  L+ LTIKDCP   D
Sbjct  450   GIKDIGSAPAQLPLCRSLRFLTIKDCPGFTD  480



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score =   251 bits (642),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 186/263 (71%), Gaps = 9/263 (3%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-FRSKSHQDL  578
             Q  +PS++ LPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+   + +   L
Sbjct  351   QPPQPSLDVLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRISELGHAAAAAPSL  410

Query  579   SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
                ++      D + SPAD  +E        R +EG +ATDVRLAA+AV   SR GL KL
Sbjct  411   PDLNEEFVMEEDTDDSPADPCVE--------RVLEGNEATDVRLAAMAVVAGSRRGLEKL  462

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              +RGS+ +RG+T+ G+ A+  G P+L  LSLW+VP V D GL EIA  CPSLE+LD+  C
Sbjct  463   AIRGSHPSRGVTDQGLLAVACGSPNLCSLSLWDVPLVTDAGLAEIAAGCPSLERLDITSC  522

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             P I++KGL AIA+ C NL SLTIE+C  +GNEGLRAIGR C KLQ ++IK+C  VGDQG+
Sbjct  523   PLITDKGLAAIAQGCPNLVSLTIEACSGVGNEGLRAIGRCCLKLQAVSIKNCVHVGDQGI  582

Query  1119  asllssasavlTKVKLHALNITD  1187
             +SL+ SASA L K++L  LNITD
Sbjct  583   SSLVCSASASLAKIRLQGLNITD  605


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 9/151 (6%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ LA +A VG       ++  GL KL      S  G+T++ I+ I + CP LK 
Sbjct  615   GKAVTDLTLARLAAVGERGFWVMANAAGLQKLRCMSVTSCLGVTDLAITCIAKFCPGLKQ  674

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESCP  1019
             L L    +V D GL         +E L L +C  ++  G++A    C+    +L++  C 
Sbjct  675   LCLRKCGHVSDAGLKAFTESAKVMENLQLEECNRVTLVGVLACLINCSQKFRALSLVKCT  734

Query  1020  NIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
              + +     A    C  L+ LTIKDCP   D
Sbjct  735   GVKDVCSAPAQLPVCKSLRFLTIKDCPGFTD  765



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   244 bits (624),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 169/260 (65%), Gaps = 34/260 (13%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  416
             M  +  +SGD+DF  G S       + LS G    VY P+RKR RI  P V    +EK+ 
Sbjct  1     MSGIFRFSGDEDFFLGGS------SMYLSPGSCPGVYFPARKRLRIAAPSVFSGFEEKQT  54

Query  417   SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  596
             SI+ LPDECLFEI RRL  G ERS+ ACVSK WL L+SS+  SE+  ++S QD       
Sbjct  55    SIDVLPDECLFEILRRLPSGEERSACACVSKHWLNLLSSISRSEV--NESVQD-------  105

Query  597   NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN  776
                              VE +G+LSR +EGKKATD+RLAAIAVGTSSRGGLGKL +RGS 
Sbjct  106   -----------------VEGEGFLSRRLEGKKATDLRLAAIAVGTSSRGGLGKLQIRGSG  148

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +T+ G+ A+  GCPSL+VLSLWN+P V D GL EI+R CP +EKLDL +CP I++ 
Sbjct  149   FDSKVTDAGLGAVAHGCPSLRVLSLWNLPAVSDMGLSEISRSCPMIEKLDLSRCPGITDN  208

Query  957   GLVAIAERCTNLTSLTIESC  1016
             GLVAIAE C NL+ LTI+SC
Sbjct  209   GLVAIAENCVNLSDLTIDSC  228


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 82/178 (46%), Gaps = 30/178 (17%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S RG+T++G+ A+G GCP LK +SL     V  +GL+ +A+   SLE L
Sbjct  290   GLKKLKSLSVMSCRGMTDIGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESL  349

Query  924   DLCQCPSISNKGLVAIAERC-TNLTSLT----------------------------IESC  1016
              L +C  I+  GL+     C + L + +                            I  C
Sbjct  350   KLEECHRINQVGLMGFLMNCGSKLKAFSLANCLGISDFNLESPLSSPSCSSLRSLSIRCC  409

Query  1017  PNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKL-HALNITD  1187
             P  G+  L  +G++C +LQ + +     V D GV  LL S +  L KV L   +N++D
Sbjct  410   PGFGDASLAFLGKFCHQLQDVELCGLNGVTDAGVRELLQSNNVGLVKVNLSECINVSD  467


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 58/112 (52%), Gaps = 3/112 (3%)
 Frame = +3

Query  783   RGITNVGISAIG--RGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             +G+   G   +G  +G   LK LS+ +   + D GL  +   CP L+ + L +C  +S K
Sbjct  275   QGVNEKGFWVMGNAKGLKKLKSLSVMSCRGMTDIGLEAVGNGCPDLKHVSLNKCLLVSGK  334

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYC-TKLQCLTIKDCPLVGD  1109
             GLVA+A+   +L SL +E C  I   GL      C +KL+  ++ +C  + D
Sbjct  335   GLVALAKSALSLESLKLEECHRINQVGLMGFLMNCGSKLKAFSLANCLGISD  386



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score =   241 bits (614),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 191/316 (60%), Gaps = 55/316 (17%)
 Frame = +3

Query  255   VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  422
             VN S D +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  5     VNQSSDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  60

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  61    EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  109

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
              S+D      D D + E DGYL+R +EG+KATDVRLAAIAVGT  RGGLGKL +RG+N  
Sbjct  110   VSSD------DSDEDAEGDGYLTRRLEGRKATDVRLAAIAVGTGYRGGLGKLSIRGNNPV  163

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             R        A+  GCPSL+ LSLWNV ++GD+GL EIA+ C  LE LDLC   SI+NKGL
Sbjct  164   R--------AVAHGCPSLRSLSLWNVSSIGDKGLSEIAKGCHMLETLDLCLSSSITNKGL  215

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             +AI                     GL+A+ + C KL  ++I DCPLVGD G    L S++
Sbjct  216   IAI---------------------GLQAVAKLCPKLHSISIMDCPLVGDPG-VCSLLSSA  253

Query  1143  avlTKVKLHALNITDF  1190
             + L++VKLH LNITD 
Sbjct  254   SDLSRVKLHNLNITDI  269


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 58/138 (42%), Gaps = 28/138 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T+  I A+GRG P+LK + L     V D GL+  A+    L  L
Sbjct  305   GLQKLVALTITSCEGVTDKSIEAMGRGFPNLKQICLRRCCVVSDNGLVAFAKSAIFLGTL  364

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C   +  G+                            V++   C  L S+TI +CP
Sbjct  365   QLEECNRFTQCGIFYALSFIKTKLKSLTLVKCLGIQDIDVEVSMLSPCRYLRSVTIRNCP  424

Query  1020  NIGNEGLRAIGRYCTKLQ  1073
               G+  L  IG+ C +LQ
Sbjct  425   GFGSASLAVIGKLCPQLQ  442



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score =   240 bits (613),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 192/316 (61%), Gaps = 55/316 (17%)
 Frame = +3

Query  255   VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  422
             +++ GD +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  1     MDFPGDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  56

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  57    EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  105

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
              S+D      D D + E DGYL+R +EG+KATDVRLAAIAVGT  RGGLGKL +RG+N  
Sbjct  106   VSSD------DSDEDAEGDGYLTRRLEGRKATDVRLAAIAVGTGYRGGLGKLSIRGNNPV  159

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             R        A+  GCPSL+ LSLWNV ++GD+GL EIA+ C  LE LDLC   SI+NKGL
Sbjct  160   R--------AVAHGCPSLRSLSLWNVSSIGDKGLSEIAKGCHMLETLDLCLSSSITNKGL  211

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             +AI                     GL+A+ + C KL  ++I DCPLVGD G    L S++
Sbjct  212   IAI---------------------GLQAVAKLCPKLHSISIMDCPLVGDPG-VCSLLSSA  249

Query  1143  avlTKVKLHALNITDF  1190
             + L++VKLH LNITD 
Sbjct  250   SDLSRVKLHNLNITDI  265


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 58/138 (42%), Gaps = 28/138 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T+  I A+GRG P+LK + L     V D GL+  A+    L  L
Sbjct  301   GLQKLVALTITSCEGVTDKSIEAMGRGFPNLKQICLRRCCVVSDNGLVAFAKSAIFLGTL  360

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C   +  G+                            V++   C  L S+TI +CP
Sbjct  361   QLEECNRFTQCGIFYALSFIKTKLKSLTLVKCLGIQDIDVEVSMLSPCRYLRSVTIRNCP  420

Query  1020  NIGNEGLRAIGRYCTKLQ  1073
               G+  L  IG+ C +LQ
Sbjct  421   GFGSASLAVIGKLCPQLQ  438



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score =   241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 191/316 (60%), Gaps = 55/316 (17%)
 Frame = +3

Query  255   VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  422
             VN S D +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  56    VNQSSDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  111

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  112   EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  160

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
              S+D      D D + E DGYL+R +EG+KATDVRLAAIAVGT  RGGLGKL +RG+N  
Sbjct  161   VSSD------DSDEDAEGDGYLTRRLEGRKATDVRLAAIAVGTGYRGGLGKLSIRGNNPV  214

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             R        A+  GCPSL+ LSLWNV ++GD+GL EIA+ C  LE LDLC   SI+NKGL
Sbjct  215   R--------AVAHGCPSLRSLSLWNVSSIGDKGLSEIAKGCHMLETLDLCLSSSITNKGL  266

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
             +AI                     GL+A+ + C KL  ++I DCPLVGD G    L S++
Sbjct  267   IAI---------------------GLQAVAKLCPKLHSISIMDCPLVGDPG-VCSLLSSA  304

Query  1143  avlTKVKLHALNITDF  1190
             + L++VKLH LNITD 
Sbjct  305   SDLSRVKLHNLNITDI  320


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 58/138 (42%), Gaps = 28/138 (20%)
 Frame = +3

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL KL      S  G+T+  I A+GRG P+LK + L     V D GL+  A+    L  L
Sbjct  356   GLQKLVALTITSCEGVTDKSIEAMGRGFPNLKQICLRRCCVVSDNGLVAFAKSAIFLGTL  415

Query  924   DLCQCPSISNKGL----------------------------VAIAERCTNLTSLTIESCP  1019
              L +C   +  G+                            V++   C  L S+TI +CP
Sbjct  416   QLEECNRFTQCGIFYALSFIKTKLKSLTLVKCLGIQDIDVEVSMLSPCRYLRSVTIRNCP  475

Query  1020  NIGNEGLRAIGRYCTKLQ  1073
               G+  L  IG+ C +LQ
Sbjct  476   GFGSASLAVIGKLCPQLQ  493



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score =   235 bits (599),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 178/263 (68%), Gaps = 10/263 (4%)
 Frame = +3

Query  402   QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE-IFRSKSHQDL  578
             + ++PS++ALPDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE +    +    
Sbjct  41    RREEPSLDALPDECLFEVLRRVRGARARCASACVSRRWLALLAGIRASEAVLAPPAPAVP  100

Query  579   SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKL  758
              +  +  G  +D E    D D +        R++EGK+ATD RL A AV     G L  +
Sbjct  101   DLNQEYLGGEDDDEADLMDHDGDAR-----ERTLEGKEATDARLTAAAVA----GRLSAV  151

Query  759   CVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              VRGS+ ARG+T+ G+SA+ RGCP+L+ LSLW+VP V D GL EIA EC +LE+LD+  C
Sbjct  152   SVRGSHPARGVTDAGVSALARGCPALRSLSLWDVPQVTDAGLAEIAAECHALERLDVTGC  211

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
             P +++K L+A+A+ C  L SLTIE+C  + NEGL+AIGR CTKLQ + IK+C  V DQGV
Sbjct  212   PLVTDKALIAVAQGCPELKSLTIEACSGVANEGLKAIGRSCTKLQAVNIKNCAHVDDQGV  271

Query  1119  asllssasavlTKVKLHALNITD  1187
             + L+ SA+A L KV+L  L+ITD
Sbjct  272   SGLVCSATASLAKVRLQGLSITD  294


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 74/151 (49%), Gaps = 9/151 (6%)
 Frame = +3

Query  684   GKKATDVRLAAI-AVG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ LA + AVG       ++  GL KL      S  G+T++ ++++ +  PSLK+
Sbjct  304   GKAITDLTLARLPAVGERGFWVMANAMGLQKLRCMTVTSCPGLTDLALASVAKFSPSLKL  363

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-NLTSLTIESCP  1019
             ++L     V D  L E A     LE L + +C  ++  G++A    C+    +L++  C 
Sbjct  364   VNLKKCSKVSDGCLKEFAESARVLENLQIEECNKVTLMGILAFLLNCSPKFKALSLVKCI  423

Query  1020  NIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
              I +     A    C  L+ LTIKDCP   D
Sbjct  424   GIKDICSAPAQLPVCKSLRSLTIKDCPGFTD  454



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 189/266 (71%), Gaps = 7/266 (3%)
 Frame = +3

Query  396   EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  575
             + Q   PS++ALPD CLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ ++ +   
Sbjct  59    QQQLPLPSLDALPDGCLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELAQAAAAAA  118

Query  576   LS--IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGL  749
              +  + D      N+  +   D+D E   D  + R +EGK+ATDVRLAA+AV   SRGGL
Sbjct  119   DTPALPDL-----NEEFVMEEDKDDETPADSCVERVLEGKEATDVRLAAMAVVAGSRGGL  173

Query  750   GKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDL  929
              KL VRGS+  RG+T+ G+SA+ RG P+L  L+LW+VP + D GL E+A  CPSLE+LD+
Sbjct  174   EKLAVRGSHPTRGVTDQGLSAVARGSPNLSSLALWDVPLITDAGLAEVAAGCPSLERLDI  233

Query  930   CQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
              +CP I++KGL AIA+ C NL SLTIE+C  + NEGLRAIGR CTKLQ + IK+C  VGD
Sbjct  234   SRCPLITDKGLAAIAQGCPNLVSLTIEACSGVANEGLRAIGRCCTKLQAVNIKNCAHVGD  293

Query  1110  QGvasllssasavlTKVKLHALNITD  1187
             QG++SL+ SA+A L K++L  LNITD
Sbjct  294   QGISSLVCSATASLAKIRLQGLNITD  319


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (46%), Gaps = 9/151 (6%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +A VG       ++  GL  L      S  G+T++ +S+I + CPSLK 
Sbjct  329   GKAVTDLTLTRLATVGERGFWVMANAAGLQNLRCMSITSCPGVTDLALSSIAKFCPSLKQ  388

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESCP  1019
             L L     V D GL          E L L +C  ++  G+++    C+    +L++  C 
Sbjct  389   LYLRKCGYVSDAGLTAFTESAKVFENLQLEECNRVTLVGILSFLRNCSQKFRALSLVKCM  448

Query  1020  NIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
              I +     A    C  L+ LTIKDCP   D
Sbjct  449   GIKDICSAPAQLPLCKSLRFLTIKDCPGFTD  479



>emb|CDP13516.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +3

Query  636   EDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAI  815
             EDL++  DGYLSR +EGKKATDVRLAAIAVGT SRGGLGKL +RGSN+ RG+TN GI AI
Sbjct  22    EDLDIVEDGYLSRCLEGKKATDVRLAAIAVGTGSRGGLGKLSIRGSNARRGVTNFGIKAI  81

Query  816   GRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLT  995
               GCPSL+VLSLWN   + DEGL+EIA  C  LEKLDL  C ++++K L+AIA+ C NLT
Sbjct  82    AHGCPSLRVLSLWNTSAISDEGLIEIASGCHRLEKLDLFHCNAVTDKALLAIAKNCPNLT  141

Query  996   SLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHAL  1175
             SLTIESCPNIGN  L A+G YC+ L+ +TIK+C LVGD G+ASL S A  VL KV+L +L
Sbjct  142   SLTIESCPNIGNGSLEAVGHYCSSLKSVTIKNCSLVGDHGIASLFSKAGNVLAKVRLESL  201

Query  1176  NITD  1187
             NI+D
Sbjct  202   NISD  205


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 57/111 (51%), Gaps = 2/111 (2%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             +G+T+VG+ A+G+G P+LK + L     + D GL+   +   SLE   L +C  I+  G 
Sbjct  255   QGVTDVGLEAVGKGSPNLKRVCLKKCAFLSDNGLVSFVKAAASLEIFQLDECHRITQSGF  314

Query  963   VA-IAERCTNLTSLTIESCPNIGNEGLRAIGRYC-TKLQCLTIKDCPLVGD  1109
                +   C  L +L + +C  I +    +  R   + ++ L +++CP  GD
Sbjct  315   FGMLINSCGKLKALALANCFGIKDLVFGSHFRALPSSIRSLAVRNCPGFGD  365



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score =   232 bits (592),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/260 (50%), Positives = 176/260 (68%), Gaps = 2/260 (1%)
 Frame = +3

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             + PS++ALPDECLFEI RR+ G R R ++A VS+RWL L+  +R+SEI R  +   +   
Sbjct  73    EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEIKREPAAAAVPDL  132

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
             ++V    ++ E    +  L   C     R +EG++ATDV L A+AV  + RG L  L +R
Sbjct  133   NQVFVDEDEEEEDEFEVPLGGGCSS--ERCLEGREATDVGLMAVAVADALRGSLESLVIR  190

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GS+  RG+T+ GISA  RGCPSL  L+LW+VP V D GL EIA  CPSL +LD+  CP I
Sbjct  191   GSHPTRGVTDAGISAAARGCPSLLSLALWHVPQVTDAGLAEIAAGCPSLARLDITGCPLI  250

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasl  1127
             ++KGL AIA+ C +L  +T+E+CP + +EGL+AIGR C KLQ + IK+C  VGDQGV+ L
Sbjct  251   TDKGLAAIAQGCPDLKVVTVEACPGVADEGLKAIGRCCAKLQSVNIKNCAHVGDQGVSGL  310

Query  1128  lssasavlTKVKLHALNITD  1187
             + SA+A L KV+L  L+ITD
Sbjct  311   VCSAAASLAKVRLQGLSITD  330


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 75/151 (50%), Gaps = 9/151 (6%)
 Frame = +3

Query  684   GKKATDVRLAAI-AVG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ LA + AVG       ++  GL KL     +S  G+T++ +++I + CPSLK 
Sbjct  340   GKAITDLTLARLPAVGERGFWVMANALGLQKLRFMSVSSCPGVTDLALASIAKFCPSLKQ  399

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-NLTSLTIESCP  1019
             L+L     V D  L + A     LE L + +C  ++  G++A    C+    +L++  C 
Sbjct  400   LNLKKCGQVSDGRLKDFAESAKVLESLQIEECNKVTLMGILAFLLNCSPKFKALSLVKCN  459

Query  1020  NIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
              I +     A    C  L+ LTIKDCP   D
Sbjct  460   GIKDICSAPAQLPLCKSLRSLTIKDCPGFTD  490



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score =   231 bits (589),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/291 (48%), Positives = 182/291 (63%), Gaps = 26/291 (9%)
 Frame = +3

Query  360   RKRARITG--PFVV------------EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAA  497
             RKRAR+T   P V             +   + PS++ALPDECLFEI RR+ G R R ++A
Sbjct  29    RKRARVTAVPPCVYAAVAAAAAAAKKQKLRETPSLDALPDECLFEILRRVQGARARGASA  88

Query  498   CVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASND-VEMSPADEDLEVECDGYLSR  674
             CVS+RWL L+  +R SEI R+++     +     G   D   +SP          G   R
Sbjct  89    CVSRRWLALLGGIRASEIKRAEAPAVPDLNQVFVGEDEDEAALSPRP--------GCSER  140

Query  675   SVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLW  854
             S+EG+ ATDV L A AV  S    L  + +RGS+  RG+T+ G+SA+ RG PSL+ L+LW
Sbjct  141   SLEGEGATDVALTAAAVANSH---LKSVVIRGSHPTRGVTDSGLSAVARGSPSLRSLALW  197

Query  855   NVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNE  1034
             +VP V D GL EIA  CPSLEKLD+  CP I++KGL A+A+ C  L +LTIE+C  + NE
Sbjct  198   DVPQVTDAGLAEIAAGCPSLEKLDITGCPLITDKGLAAVAQGCPELKTLTIEACSGVANE  257

Query  1035  GLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             GLRAIGR C KLQ + IK+C  VGDQGV+ L+ S++A L KV L  L+ITD
Sbjct  258   GLRAIGRCCPKLQAVNIKNCAHVGDQGVSGLICSSTASLAKVCLQGLSITD  308



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score =   228 bits (580),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 173/259 (67%), Gaps = 10/259 (4%)
 Frame = +3

Query  411   KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
             +PS++A+PDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE   + +   +   +
Sbjct  43    EPSLDAVPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASEAVLAPAAPAVPDLN  102

Query  591   KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG  770
             +    S D E    D D +        R++EG  ATD RL A AV     G L  + VRG
Sbjct  103   Q-EYLSEDDEADLMDHDGDAR-----ERTLEGMLATDARLTAAAVA----GRLASVSVRG  152

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             S+ ARG+T+ G+ A+ RGCP L+ L+LW+VP V D GL EIA EC SLE+LD+  CP I+
Sbjct  153   SHPARGVTDAGVCALARGCPELRSLTLWDVPQVTDAGLAEIAAECHSLERLDITGCPMIT  212

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasll  1130
             +KGLVA+A+ C  L SLTIE+C  + NEGL+AIGR C KLQ +++K+C  V DQGV+ L+
Sbjct  213   DKGLVAVAQGCPELKSLTIEACSGVANEGLKAIGRCCAKLQAVSVKNCAHVDDQGVSGLV  272

Query  1131  ssasavlTKVKLHALNITD  1187
              SA+A L KV+L  LNITD
Sbjct  273   CSATASLAKVRLQGLNITD  291



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 180/292 (62%), Gaps = 28/292 (10%)
 Frame = +3

Query  318   LMLSLGHA-DVYCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSA  494
             L LS G   +V  P RKR  +T       Q   PSIE L DECLF++F+ L  G+ERS  
Sbjct  14    LFLSRGQNRNVNFPPRKRICVTTASKNFEQRNHPSIEILLDECLFKVFKHLPSGKERSVC  73

Query  495   ACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSR  674
             ACVSKRWL L+SS+R  +I  S            NG               +E  G L R
Sbjct  74    ACVSKRWLTLLSSIRKDKIPES------------NG---------------IEGKGSLVR  106

Query  675   SVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLW  854
             S+ G++ATDVRLAAIAVG S+  GL KL + G N+   +++ G+ AI R CP+L+ LSL 
Sbjct  107   SLVGREATDVRLAAIAVGASNYKGLSKLSIGGDNTCHSVSDGGLKAIARCCPTLRDLSLS  166

Query  855   NVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNE  1034
             N+  VG+EGL EIA  C  LEKL L QCP I++  L+ IA+ C+++TSLTI+SC  IGNE
Sbjct  167   NMAFVGNEGLSEIANGCHLLEKLYLFQCPKITDSSLLDIAKNCSHMTSLTIDSCFKIGNE  226

Query  1035  GLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITDF  1190
               +A+G YC KL+ + +K+CPL+GD+G+  L  SA   LT+V+L AL+ +D 
Sbjct  227   VPKAVGLYCPKLKVIILKNCPLIGDRGIEDLFLSAGHSLTEVELQALHTSDI  278



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score =   219 bits (558),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 182/289 (63%), Gaps = 26/289 (9%)
 Frame = +3

Query  357   SRKRARITG---PFVVEVQEKKPS----IEALPDECLFEIFRRLSGGRERSSAACVSKRW  515
             SRKR   T    P     + +K      ++ALPDECLFE+ RR+ G R R ++ACVS+RW
Sbjct  18    SRKRVFATAAAEPVTAAPKRQKRGDEMPLDALPDECLFEVLRRVQGTRARCASACVSRRW  77

Query  516   LMLMSSVRNSEIFRSKSHQ---DLSIADKVNGASNDVEMSPADEDLEVECDG-YLSRSVE  683
             L L++ +R SE   + +     DL          N   +S  DE   ++ DG    R++E
Sbjct  78    LALLAGIRASEAVLAPAAPAVPDL----------NQEYLSEDDEADLMDLDGDARERTLE  127

Query  684   GKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVP  863
             G +ATD RL A AV          + VRGS+ ARG+T+ GISA+ RGCP L+ L+LW+VP
Sbjct  128   GMEATDARLTAAAVAGRLA----AVSVRGSHPARGVTDAGISALARGCPELRSLTLWDVP  183

Query  864   NVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLR  1043
              V D GL E+A EC SLE+LD+  CP I++KGL A+A+ C  L SLTIE C  + NEGL+
Sbjct  184   QVTDAGLAEVAAECHSLERLDISGCPMITDKGLAAVAQGCPELKSLTIEGCSGVANEGLK  243

Query  1044  AIGRYCTKLQCLTIKDCPLVGDQGvasll-ssasavlTKVKLHALNITD  1187
             A+GR+C KLQ ++IK+C LV DQGV+ L+ S+ ++ LTKV+L  LNITD
Sbjct  244   AVGRFCAKLQAVSIKNCALVDDQGVSGLVCSATASSLTKVRLQGLNITD  292



>ref|NP_001145991.1| uncharacterized protein LOC100279520 [Zea mays]
 gb|ACL52991.1| unknown [Zea mays]
Length=522

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 147/192 (77%), Gaps = 8/192 (4%)
 Frame = +3

Query  612   DVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGI  791
             D E SPAD  ++        R +EGK+ATDVRLAA+AV   SRGGL KL VRGS+  RG+
Sbjct  4     DNEESPADRCVD--------RVLEGKEATDVRLAAMAVVAGSRGGLEKLAVRGSHPTRGV  55

Query  792   TNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAI  971
             T+ G+SA+ RG P+L  L+LW+VP + D GL EIA  CPSLE+LD+C+CP I++KGLVA+
Sbjct  56    TDQGLSAVARGSPNLSSLALWDVPLITDAGLAEIAAGCPSLERLDICRCPLITDKGLVAV  115

Query  972   AERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavl  1151
             A+ C NL SLTIE+CP + NEGLRAIGR C KLQ + IK+CPLVGDQG++SL+ SA+A L
Sbjct  116   AQGCPNLVSLTIEACPGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGISSLVCSATAAL  175

Query  1152  TKVKLHALNITD  1187
             TK++L  LNITD
Sbjct  176   TKIRLQGLNITD  187


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 85/204 (42%), Gaps = 36/204 (18%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +A VG       ++  GL  L      S  G+T++ +++I + CP+LK 
Sbjct  197   GKAITDLTLTRLAAVGERGFWVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFCPNLKQ  256

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER--------------  980
             L L     V D GL          E L L +C  +S  G++A                  
Sbjct  257   LYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSLVGILAFLLNCREKFRALSLVKCM  316

Query  981   --------------CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGv  1118
                           C +L  LTI+ CP   +  L A+G  C +L+ + +     V D G+
Sbjct  317   GIKDICSAPAQLPLCRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDLSGLGEVTDNGL  376

Query  1119  asllssasavlTKVKLHAL-NITD  1187
               L+ S+ A L KV L    NITD
Sbjct  377   LPLIQSSEAGLVKVDLSGCKNITD  400



>gb|ACR35519.1| unknown [Zea mays]
Length=520

 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  645   EVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRG  824
             EV  D  + R +EGK+ATDVRLAA+AV   S GGL KL VRGS+ ARG+T+ G+SA+ RG
Sbjct  7     EVPADRCVDRVLEGKEATDVRLAAMAVVAGSCGGLEKLSVRGSHPARGVTDQGLSAVARG  66

Query  825   CPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLT  1004
              P+L  L+LW+VP + D GL+EIA  CP LE+LD+ +CP I++KGL A A+ C +L SLT
Sbjct  67    SPNLSSLALWDVPLITDAGLVEIAAGCPLLERLDISRCPLITDKGLAAFAQGCPDLVSLT  126

Query  1005  IESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNIT  1184
             IE+C ++G+EGLRAIGR C KLQ + IK+CPLVGDQG++SL+ SA+A L K++L  LNIT
Sbjct  127   IEACSSVGDEGLRAIGRSCMKLQAVNIKNCPLVGDQGISSLVCSATASLAKIRLQGLNIT  186

Query  1185  D  1187
             D
Sbjct  187   D  187


 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 85/202 (42%), Gaps = 34/202 (17%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ L  +A VG       ++  GL  L      S  G+T++ +++I + CPSLK 
Sbjct  197   GKAITDLSLTRLATVGERGFWVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFCPSLKK  256

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAE---------------  977
             L L    +V D GL          E L L +C  ++  G++A                  
Sbjct  257   LYLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTLVGILAFLNCSQKFRALSLVKCMG  316

Query  978   -----------RCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvas  1124
                         C +L  LTI+ CP   N  L  +G  C +L+ + +     V D G+  
Sbjct  317   IKDICSVPQLPFCRSLRFLTIKDCPGFTNASLAVVGMICPQLEQVDLSGLGEVTDNGLLP  376

Query  1125  llssasavlTKVKLHAL-NITD  1187
             L+ S+ + L KV L    NITD
Sbjct  377   LIQSSESGLIKVDLSGCKNITD  398



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score =   188 bits (478),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/278 (40%), Positives = 167/278 (60%), Gaps = 15/278 (5%)
 Frame = +3

Query  354   PSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSS  533
             P++KR+R     + +    +  I  LPDEC++EIFR L   R+R   A VSK+WL + + 
Sbjct  55    PNKKRSRHQETSISDKISTQDLISYLPDECIWEIFRYLPSTRDRCCCAAVSKKWLAIQAK  114

Query  534   VRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLA  713
             +R SE F+SK              S+++  S    D       + SR +EGKKA D RLA
Sbjct  115   MRISE-FKSKPK------------SSNIITSALGLDHHKGSQKF-SRCLEGKKANDTRLA  160

Query  714   AIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEI  893
             A+AVG    GGL +LCVRGS   +GIT+VG+S I + CP L+ +SLW+   VG++G++ +
Sbjct  161   AMAVGICLHGGLSELCVRGSFPTQGITDVGLSVISQACPGLRSISLWDCIKVGNKGIVSV  220

Query  894   ARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             A  C SLEKLDL   P + +K L +IA+ C +L+SL IE CP +G+  L A  RY +K++
Sbjct  221   ATSCSSLEKLDLVNLPLVDDKALASIAKNCPSLSSLVIELCPLVGDTSLEAFARYSSKIE  280

Query  1074  CLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              +++  C L+ +     L+ S+   LTK+KL +++I+D
Sbjct  281   FVSLAKCQLI-NASAVILIISSLPKLTKLKLSSVSISD  317



>ref|XP_002986021.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
 gb|EFJ12840.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
Length=647

 Score =   185 bits (470),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 162/278 (58%), Gaps = 25/278 (9%)
 Frame = +3

Query  363   KRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRN  542
             KR RI      EV     S++ +PDE L  IF  +   R+RSS A V +RWLML++ +  
Sbjct  57    KRPRIDE----EVGSSCSSMDGIPDEILVVIFGSILSARDRSSCASVCRRWLMLLTHMPR  112

Query  543   SEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIA  722
              E+ R    +D   A + + A  D                 LSR +EGKKATDVRLAAIA
Sbjct  113   QELPREVCSEDSDDAKQPHWALGD-----------------LSRCLEGKKATDVRLAAIA  155

Query  723   VGTSSRGGLGKLCVRG---SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEI  893
             VGT + GGLGKL +RG     SA+G+T++G++ IG  C +L+ L+LW+ PNVGD  L  I
Sbjct  156   VGTGAHGGLGKLVIRGGPGERSAKGVTDIGLTTIGICCNALRGLTLWDCPNVGDSSLESI  215

Query  894   ARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             AR C  L+ LDL +CP++S+ GL A++  C  L++L+IESC  IGN G++AI + C  LQ
Sbjct  216   ARGCRLLQSLDLLKCPNVSDAGLEAVSRGCLRLSNLSIESCDGIGNAGIKAIAKSCCYLQ  275

Query  1074  CLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              L++  C  +    + S+     A+  K+KL  + I D
Sbjct  276   TLSLSRCSNINSHAITSVSKHCVALK-KLKLEKIGIND  312



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score =   183 bits (465),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 160/264 (61%), Gaps = 12/264 (5%)
 Frame = +3

Query  420   IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  599
             ++ +PDE L  IF  +   R+RSS A V +RWLML++ +   E+ R    +D    D VN
Sbjct  1     MDGIPDEILVVIFGSILSARDRSSCASVCRRWLMLLTHMPRQELPREVCSEDSD--DAVN  58

Query  600   GASNDVEMSPADEDLEVECD-----GYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
                     +P +E   +E       G LSR +EGKKATDVRLAAIAVGT + GGLGKL +
Sbjct  59    QPCR-AGSAPQEEVWTLEKQPHWALGDLSRCLEGKKATDVRLAAIAVGTGAHGGLGKLVI  117

Query  765   RG---SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
             RG     SA+G+T++G++ IG  C +L+ L+LW+ PNVGD  L  IAR C  L+ LDL +
Sbjct  118   RGGPGERSAKGVTDIGLTTIGICCNALRGLTLWDCPNVGDSSLESIARGCRLLQSLDLLK  177

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             CP++S+ GL A++  C  L++L+IESC  IGN G++AI + C  LQ L++  C  +    
Sbjct  178   CPNVSDAGLEAVSRGCLRLSNLSIESCDGIGNAGIKAIAKSCCYLQTLSLSRCSNINSHA  237

Query  1116  vasllssasavlTKVKLHALNITD  1187
             + S+     A+  K+KL  + I D
Sbjct  238   ITSVSKHCVALK-KLKLEKIGIND  260



>ref|XP_002974778.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
 gb|EFJ24298.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
Length=630

 Score =   184 bits (466),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 170/292 (58%), Gaps = 31/292 (11%)
 Frame = +3

Query  330   LGHADVY-CPSRKRARITGPFVVEVQEKKPS--IEALPDECLFEIFRRLSGGRERSSAAC  500
             +G+ ++Y  P R         V   ++ +P   I ALPDE L E+FR ++   +R + A 
Sbjct  54    IGNTEIYNAPKRFLPTPPPTAVPAAKKYQPKDLINALPDELLVEVFRYVAAPADRYACAS  113

Query  501   VSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSV  680
             V  RWLML S + +SEI      Q+LS+                DE         L RS+
Sbjct  114   VCTRWLMLQSHLHSSEI--KDDEQELSLG-------------SGDE---------LKRSL  149

Query  681   EGKKATDVRLAAIAVGTSSRGGLGKLCVRG---SNSARGITNVGISAIGRGCPSLKVLSL  851
             EGK+ATDVRLA +A+GT SRGGLGKL ++G      ++ ++NVG+S++G  C +LKVLS+
Sbjct  150   EGKRATDVRLAVVALGTQSRGGLGKLIIKGGPRQKLSKAVSNVGMSSVGICCGNLKVLSV  209

Query  852   WNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGN  1031
             W+ PN+ D G   I + CP L+ L++  CP   +  L AIA  C  L+SLT++ C  +G+
Sbjct  210   WDCPNIDDVGFSWIGKGCPQLKVLNIMNCPGFGDAALRAIAAGCPLLSSLTLDGCDKVGD  269

Query  1032  EGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             EGL+A+G+ C++L CL++  C  VGD GV +++SS   +   +KL  L+I D
Sbjct  270   EGLQAVGKRCSQLSCLSVSRCNKVGDVGVTAVVSSCKVLKA-MKLEKLSIND  320


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN  ++A+   CPSL +L+L    +V D+G+  +A+   ++++L L  C  +++ G+VA
Sbjct  507   LTNRALAAVASFCPSLGLLTLDGCASVTDQGIRYVAQGPQAVQELSLAGC-DVTDDGMVA  565

Query  969   IA-ERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDC  1094
             +   + ++L +L++  C  + +  L A+   C  L+ L +KDC
Sbjct  566   LVLAKGSSLKTLSLAGCGRVTDRSLLAMKTACNTLEALNVKDC  608



>ref|XP_006849175.2| PREDICTED: EIN3-binding F-box protein 1 [Amborella trichopoda]
Length=630

 Score =   180 bits (456),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 143/241 (59%), Gaps = 11/241 (5%)
 Frame = +3

Query  396   EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  575
             E  +    I  LPD+CL EIFR L    + S  A VSK+WL+L + +     F    H+ 
Sbjct  70    ETSDSTDLIGRLPDDCLTEIFRFLPVPLDHSLCAMVSKKWLLLQAQMHAFR-FTPTMHEP  128

Query  576   LSIADKVNGASNDVEMSPADEDLEV-ECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLG  752
                   VN      ++       E+ E  GYL+R +EGKKATD RLAAIAVGT +RGGLG
Sbjct  129   -----TVNAMVTTYDVLEPWLSYELGERPGYLTRRLEGKKATDTRLAAIAVGTQARGGLG  183

Query  753   KLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLC  932
             +LC+RG       ++ G+  I   CP L+ LSLW   ++GD GL  IA  C  L KLDL 
Sbjct  184   RLCIRGGRP----SDAGLRLIALSCPGLESLSLWECGSIGDAGLEAIAMGCTLLRKLDLR  239

Query  933   QCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
              CP +++KGLVAIA+  +NL+SLT+E+CPN+G+  L A  +    ++ L++ +CP +GD+
Sbjct  240   NCPLVTDKGLVAIAKTSSNLSSLTLEACPNVGDPALEATSKCSNNIKSLSLNNCPCIGDE  299

Query  1113  G  1115
             G
Sbjct  300   G  300



>gb|ERN10756.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
Length=620

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 143/241 (59%), Gaps = 11/241 (5%)
 Frame = +3

Query  396   EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  575
             E  +    I  LPD+CL EIFR L    + S  A VSK+WL+L + +     F    H+ 
Sbjct  60    ETSDSTDLIGRLPDDCLTEIFRFLPVPLDHSLCAMVSKKWLLLQAQMHAFR-FTPTMHEP  118

Query  576   LSIADKVNGASNDVEMSPADEDLEV-ECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLG  752
                   VN      ++       E+ E  GYL+R +EGKKATD RLAAIAVGT +RGGLG
Sbjct  119   -----TVNAMVTTYDVLEPWLSYELGERPGYLTRRLEGKKATDTRLAAIAVGTQARGGLG  173

Query  753   KLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLC  932
             +LC+RG       ++ G+  I   CP L+ LSLW   ++GD GL  IA  C  L KLDL 
Sbjct  174   RLCIRGGRP----SDAGLRLIALSCPGLESLSLWECGSIGDAGLEAIAMGCTLLRKLDLR  229

Query  933   QCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
              CP +++KGLVAIA+  +NL+SLT+E+CPN+G+  L A  +    ++ L++ +CP +GD+
Sbjct  230   NCPLVTDKGLVAIAKTSSNLSSLTLEACPNVGDPALEATSKCSNNIKSLSLNNCPCIGDE  289

Query  1113  G  1115
             G
Sbjct  290   G  290



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 159/281 (57%), Gaps = 30/281 (11%)
 Frame = +3

Query  348   YCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLM  527
             Y   +K  +   P        K  I  LPDEC+ EIFR L   R+R S   VSKRWL L 
Sbjct  51    YSARKKPRQHKEPVRKSTSSNKDLINTLPDECILEIFRFLPSSRDRCSCVTVSKRWLALQ  110

Query  528   SSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVR  707
             +++R SE+             K +  S + ++S        EC       ++GK A D R
Sbjct  111   ATMRISEL-------------KSDPKSRNNKIS--------EC-------LQGKNANDTR  142

Query  708   LAAIAVGTSSRGGLGKLCVRGSN-SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGL  884
             LAAIAVGT  RGGL +LC+ GS+ + +GIT++G+  I   CP LK LSLWN   VG++G+
Sbjct  143   LAAIAVGTCLRGGLSELCIDGSSPNTQGITDIGLGIIALACPGLKTLSLWNCTKVGNKGI  202

Query  885   LEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCT  1064
               IAR C SLEKLDL   P + +  L+AIA+ C +++ L I+SCP +G+  L A  RY +
Sbjct  203   ESIARGCNSLEKLDLVNLPIVDDGCLLAIAKNCPSISCLAIDSCPLVGDTSLEAFARYSS  262

Query  1065  KLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             K++ L++  CP +   G   L+ S+   ++K+KL +L ++D
Sbjct  263   KIESLSVSKCPQINASG-VILIVSSLPKISKLKLVSLTLSD  302



>ref|XP_002963689.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
 gb|EFJ35560.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
Length=542

 Score =   171 bits (433),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 138/228 (61%), Gaps = 27/228 (12%)
 Frame = +3

Query  420   IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  599
             I ALP+E L E+FR ++   +R + A V  RWLML S + +SEI      Q+LS+     
Sbjct  1     INALPEELLVEVFRYVAAPADRYACASVCTRWLMLQSHLHSSEI--KDDEQELSLG----  54

Query  600   GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRG---  770
                        DE         L R +EGK+ATDVRLA +A+GT SRGGLGKL ++G   
Sbjct  55    ---------SGDE---------LKRILEGKRATDVRLAVVALGTQSRGGLGKLIIKGGPR  96

Query  771   SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
                ++ ++NVG+S++G  C +LKVLS+W+ PN+ D G   I + CP L+ L++  CP   
Sbjct  97    QKLSKAVSNVGMSSVGICCGNLKVLSVWDCPNIDDVGFSWIGKGCPQLKVLNIMNCPGFG  156

Query  951   NKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDC  1094
             +  L AIA  C  L+SLT++ C  +G+EGL+A+G+ C++L CL++  C
Sbjct  157   DAALRAIAAGCPLLSSLTLDGCDKVGDEGLQAVGKRCSQLSCLSVSRC  204


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 60/103 (58%), Gaps = 2/103 (2%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +TN  ++A+   CPSL +L+L    +V D+G+  +A+   ++++L L  C  +++ G+VA
Sbjct  421   LTNRALAAVASFCPSLGLLTLDGCASVTDQGIRYVAQGPQAVQELSLAGC-DVTDDGMVA  479

Query  969   IA-ERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDC  1094
             +   + ++L +L++  C  + +  L  +   C  L+ L +KDC
Sbjct  480   LVLAKGSSLKTLSLAGCGRVTDRSLLVMKTACNALEALNVKDC  522



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 131/196 (67%), Gaps = 8/196 (4%)
 Frame = +3

Query  624   SPADEDLEVECDGYLSRSVEGKKA------TDVRLAAI--AVGTSSRGGLGKLCVRGSNS  779
             +P+ + L  EC   + R V+G +A         R  A+  A G S RG L  L +RGS+ 
Sbjct  61    APSLDALPDECLFEILRRVKGARARCASGAVSRRWLALLGAFGDSLRGHLESLVIRGSHP  120

Query  780   ARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG  959
              RG+T+ G+SA  RGCPSL  L+LW+VP V D GL EIA  CPSL +LD+  CP I++KG
Sbjct  121   TRGVTDAGLSAAARGCPSLLSLALWHVPQVTDAGLAEIAAGCPSLARLDITGCPLITDKG  180

Query  960   LVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssa  1139
             L A+A+ C +L ++TIE+CP + +EGL+AIGR C KLQ + IK+C  VGDQGV+ L+ SA
Sbjct  181   LTAVAQGCPDLKAVTIEACPGVADEGLKAIGRCCAKLQAVNIKNCAHVGDQGVSGLVCSA  240

Query  1140  savlTKVKLHALNITD  1187
             +A L KV+L  L+ITD
Sbjct  241   AASLAKVRLQGLSITD  256


 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/296 (30%), Positives = 130/296 (44%), Gaps = 57/296 (19%)
 Frame = +3

Query  357   SRKRARITG----PFVVEVQEK------------KPSIEALPDECLFEIFRRLSGGRERS  488
             SRKRAR+T      F   V+E+             PS++ALPDECLFEI RR+ G R R 
Sbjct  27    SRKRARVTAVPPCAFAEAVEEEVTAASKRQKRREAPSLDALPDECLFEILRRVKGARARC  86

Query  489   SAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYL  668
             ++  VS+RWL L+ +  +S   R      +           D  +S A       C   L
Sbjct  87    ASGAVSRRWLALLGAFGDS--LRGHLESLVIRGSHPTRGVTDAGLSAAARG----CPSLL  140

Query  669   SRSV-EGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVL  845
             S ++    + TD  LA IA G  S   L +L + G      IT+ G++A+ +GCP LK +
Sbjct  141   SLALWHVPQVTDAGLAEIAAGCPS---LARLDITGCPL---ITDKGLTAVAQGCPDLKAV  194

Query  846   SLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG----------------------  959
             ++   P V DEGL  I R C  L+ +++  C  + ++G                      
Sbjct  195   TIEACPGVADEGLKAIGRCCAKLQAVNIKNCAHVGDQGVSGLVCSAAASLAKVRLQGLSI  254

Query  960   ----LVAIAERCTNLTSLTIESCPNIGNEGLRAIGRY--CTKLQCLTIKDCPLVGD  1109
                 L  I      +T LT+   P +G  G   +       KL+C+++  CP V D
Sbjct  255   TDASLAVIGYYGKAITDLTLARLPTVGERGFWVMANALGLQKLRCMSVSSCPGVTD  310


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 11/152 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ LA +      RG        GL KL     +S  G+T++ +++I + CPSLK
Sbjct  266   GKAITDLTLARLPT-VGERGFWVMANALGLQKLRCMSVSSCPGVTDLALASIAKFCPSLK  324

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-NLTSLTIESC  1016
              LSL     V D  L + A     LE L + +C  ++  G++A    C+    +L++  C
Sbjct  325   QLSLKKCSQVSDGRLKDFAESAMVLESLQIEECNKVTLMGILAFLLNCSPKFKALSLVKC  384

Query  1017  PNIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
               I +     A    C  L+ LTIKDCP   D
Sbjct  385   NGIKDICSAPAQLPLCKSLRSLTIKDCPGFTD  416



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 143/415 (34%), Positives = 189/415 (46%), Gaps = 102/415 (25%)
 Frame = +3

Query  243   MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRAR--ITGPF--VVEVQE  407
             MPTLV++ GD+DF         D  L LSL    +V CP RKR R  +T PF      QE
Sbjct  1     MPTLVSFRGDEDFGGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLRGNVTIPFRETKPKQE  60

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--------  563
             +K  I  LPDECLFEIFR L   R+RS +ACVSKRWLML SS+R SEI RSK        
Sbjct  61    QKDLISMLPDECLFEIFRCLPAARDRSVSACVSKRWLMLQSSMRRSEIKRSKPSPKTCGE  120

Query  564   ------SHQDLSIADKVNGASNDVEMSPAD-----EDLEVECD-----------------  659
                   S Q     D  + + ++ E    D     E LE E                   
Sbjct  121   APNRDRSEQSKPSQDNASFSEDNFEEFFDDGFGELEHLEPESREFDAGWKGTTDKGTGEK  180

Query  660   ------GYLSRSVEGKKATDVRLAAI------------------------AVGTSSRGGL  749
                   G LSR +EGKK TD  L+AI                        A+G +S  G+
Sbjct  181   KPRWVIGDLSRCLEGKKVTDNTLSAIGLHCKNLTELTFVNLQKVTEKGFKALGNAS--GM  238

Query  750   GKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDL  929
              KL +    S RG+TN G+ +IG+GCPS+K++S      + D+GL    +   SLE L L
Sbjct  239   QKLKMLSVTSCRGLTNPGLESIGQGCPSVKLVSFRKCEFLSDKGLKAFTKVAISLESLQL  298

Query  930   CQCPSISNKGLV-------------------AIAE---------RCTNLTSLTIESCPNI  1025
              +C  IS+ GL+                    I E          C +L SL+I SCP++
Sbjct  299   EECNMISHLGLIDALGSCSGKLKVLTLVKCTGIKESGLGEVPVPTCESLKSLSIRSCPSL  358

Query  1026  GNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHA-LNITD  1187
             GN  L  +GR C ++Q +       + D G+ +L  S    L K+ L   + +TD
Sbjct  359   GNGCLALLGRACPQVQSIDFSGLAGISDDGLFALFGSCKTSLVKLNLSGCIEVTD  413



>ref|XP_001775242.1| predicted protein [Physcomitrella patens]
 gb|EDQ59978.1| predicted protein [Physcomitrella patens]
Length=619

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 146/239 (61%), Gaps = 9/239 (4%)
 Frame = +3

Query  420   IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  599
             I  LPDECL EIF  L   ++R +AA V  RWLML S ++  + F+ +S   L  A++V+
Sbjct  23    INDLPDECLQEIFGFLPKVQDRCAAAAVCMRWLMLQSRMQRGD-FKIESASMLGNANEVH  81

Query  600   GASNDVEMSPADEDLEVECD-----GYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV  764
                N++++   D +  V+       G LSR ++GK+ATDV LA +A+G  +RGGL  L V
Sbjct  82    PCGNEIDIV-IDGEPRVQMQPQWVCGELSRILQGKEATDVMLALVAIGELARGGLVDLKV  140

Query  765   RG--SNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQC  938
              G  + +++GI++ G+ AI   C +L+ L+LW   N+ D GL  I   C SLEKL +  C
Sbjct  141   IGGLARASKGISDSGLIAIANCCAALRSLTLWGCENITDVGLAAIGSGCRSLEKLSIMNC  200

Query  939   PSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             P I ++GL AIA+ C  L++++I+SC N+G+  L+A+G +   L    + +CP+VG  G
Sbjct  201   PGIGDRGLQAIAKGCPLLSTVSIDSCSNVGDASLKALGIWSGSLSSFCLTNCPMVGSAG  259


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             + IT+V ++AI   C  L+ L L     VGD GL  +A ECP L++LDL    SI++ GL
Sbjct  492   KNITDVAVAAIASRCGDLERLILDGCYQVGDNGLQTLATECPLLKELDL-SGTSITDSGL  550

Query  963   VA-IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              + +  +   L  LT   C N+ +E L +I  +C  L  L +++CPL+  +G
Sbjct  551   RSLVTSQGLFLQGLTFTGCINLTDESLSSIEDFCPLLGSLNLRNCPLLTREG  602


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 84/179 (47%), Gaps = 20/179 (11%)
 Frame = +3

Query  636   EDLEV----ECDGYLSRSVEGKKATDVRLAAIAV----GTSSRGGLGKLCVRGSNSARGI  791
             +DLE     +C     R ++G     +RL ++ +      ++ G L  L  RG  + R +
Sbjct  347   QDLETCVLTQCQSITDRGLQGLMQCCIRLDSLQLERCHAITNAGVLAAL-ARGKGNLRKL  405

Query  792   TNVGISAIGRG----------CPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
                   +   G          C SLK L++    NVG E ++ +   CPSLE LDL Q  
Sbjct  406   NLSKCDSFWNGGKRAEELPLRCLSLKTLNVTECKNVGVEPIVTMGLCCPSLENLDLSQLT  465

Query  942   SISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              ++++ +++I E C  +L +L + +C NI +  + AI   C  L+ L +  C  VGD G
Sbjct  466   DLNDEAIISIIEVCGEHLVNLNLTNCKNITDVAVAAIASRCGDLERLILDGCYQVGDNG  524


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +3

Query  795   NVGISAI---GRGCPSLKVLSLWNVPNVGDEGLLEIAREC-PSLEKLDLCQCPSISNKGL  962
             NVG+  I   G  CPSL+ L L  + ++ DE ++ I   C   L  L+L  C +I++  +
Sbjct  440   NVGVEPIVTMGLCCPSLENLDLSQLTDLNDEAIISIIEVCGEHLVNLNLTNCKNITDVAV  499

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
              AIA RC +L  L ++ C  +G+ GL+ +   C  L+
Sbjct  500   AAIASRCGDLERLILDGCYQVGDNGLQTLATECPLLK  536



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 142/262 (54%), Gaps = 39/262 (15%)
 Frame = +3

Query  408   KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  587
             + PS++ALPDECLFEI RR+ G R R ++A VS+RWL L+  +R+SEI R  +   +   
Sbjct  73    EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEIKREPAAAAVPDL  132

Query  588   DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
             ++V    ++ E    +  L   C     R +EG++ATDV L A+AV  + RG L  L +R
Sbjct  133   NQVFVDEDEEEEDEFEVPLGGGCSS--ERCLEGREATDVGLMAVAVADALRGSLESLVIR  190

Query  768   GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSI  947
             GS+  RG+T+ GISA  RGCPSL  L+LW+VP           + CP L+ + +  CP +
Sbjct  191   GSHPTRGVTDAGISAAARGCPSLLSLALWHVP-----------QGCPDLKVVTVEACPGV  239

Query  948   SNKGLVAIAERCTNLTSLTIESCPNIGNEG--------------------------LRAI  1049
             +++GL AI   C  L S+ I++C ++G++G                          L  I
Sbjct  240   ADEGLKAIGRCCAKLQSVNIKNCAHVGDQGVSGLVCSAAASLAKVRLQGLSITDASLSVI  299

Query  1050  GRYCTKLQCLTIKDCPLVGDQG  1115
             G Y   +  LT+   P VG++G
Sbjct  300   GYYGKAITDLTLARLPAVGERG  321


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 75/151 (50%), Gaps = 9/151 (6%)
 Frame = +3

Query  684   GKKATDVRLAAI-AVG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ LA + AVG       ++  GL KL     +S  G+T++ +++I + CPSLK 
Sbjct  303   GKAITDLTLARLPAVGERGFWVMANALGLQKLRFMSVSSCPGVTDLALASIAKFCPSLKQ  362

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT-NLTSLTIESCP  1019
             L+L     V D  L + A     LE L + +C  ++  G++A    C+    +L++  C 
Sbjct  363   LNLKKCGQVSDGRLKDFAESAKVLESLQIEECNKVTLMGILAFLLNCSPKFKALSLVKCN  422

Query  1020  NIGNE-GLRAIGRYCTKLQCLTIKDCPLVGD  1109
              I +     A    C  L+ LTIKDCP   D
Sbjct  423   GIKDICSAPAQLPLCKSLRSLTIKDCPGFTD  453



>ref|XP_001783097.1| predicted protein [Physcomitrella patens]
 gb|EDQ52100.1| predicted protein [Physcomitrella patens]
Length=633

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 139/263 (53%), Gaps = 28/263 (11%)
 Frame = +3

Query  354   PSRKRARITGP-----FVVEVQE--KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKR  512
             P  KR R +       F+V V E  +   I  LPDECL EIF  L    +R +AA V  R
Sbjct  26    PKTKRRRTSSKIEDSNFLVAVSELDQVDRINDLPDECLQEIFGFLPKVEDRCAAASVCMR  85

Query  513   WLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKK  692
             WLML S +R           D  I   +       + +           G LSR++EG++
Sbjct  86    WLMLQSRMRRG---------DFKIQPNIVCKGGQPQWA----------SGELSRALEGRE  126

Query  693   ATDVRLAAIAVGTSSRGGLGKLCVRG--SNSARGITNVGISAIGRGCPSLKVLSLWNVPN  866
              TDV+LA +A+G  +RGGL  L + G  +   +G+T+ G+ AIG  C +L+ L+LW   N
Sbjct  127   VTDVKLALVAIGELARGGLAALKITGGPARVGKGVTDSGLIAIGNCCAALRSLTLWGCDN  186

Query  867   VGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRA  1046
             + D GL  I   C  L+KLD+ +CP + ++GL  IA  C  L++++I+SC N+G+  L+A
Sbjct  187   ITDFGLAAIGSGCRLLQKLDIMKCPMVGDRGLQEIARGCPLLSTVSIDSCSNVGDASLKA  246

Query  1047  IGRYCTKLQCLTIKDCPLVGDQG  1115
             +G +   L   ++  C +VG  G
Sbjct  247   LGTWSASLTSFSVTSCSMVGSAG  269


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             + IT+V ++AI   C  L+ L L     VGD GL  +A  CPSL++LDL    SI++ GL
Sbjct  502   KNITDVVVAAIASHCGDLERLILDGCYQVGDSGLQMLAAACPSLKELDL-SGTSITDSGL  560

Query  963   VAIA-ERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              ++   R   L  LT+  C N+ +E L  I  YC  L  L +++CPL+  +G
Sbjct  561   RSLVISRGLWLQGLTLTGCINLTDESLSLIEDYCPSLGALNLRNCPLLSREG  612


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = +3

Query  825   CPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSL  1001
             C SLK L++    NVG E ++++   CP LE LDL Q   ++++ ++++ E C  +L SL
Sbjct  437   CLSLKTLNVTGCKNVGVEPVVKMCLRCPLLENLDLSQMVDLNDEAIISVIEGCGEHLVSL  496

Query  1002  TIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              + +C NI +  + AI  +C  L+ L +  C  VGD G
Sbjct  497   NLTNCKNITDVVVAAIASHCGDLERLILDGCYQVGDSG  534


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 74/159 (47%), Gaps = 10/159 (6%)
 Frame = +3

Query  660   GYLSRSVEGKKATDVRLAAIA-------VGTSSRGGLGKLCVRGSNSARGITNVGISAIG  818
             G ++     K  T ++LA +        +G     GL +L      +  G+T+V +  +G
Sbjct  294   GLIAMGENCKSVTSMKLANLGWCTEEGFIGFFEGSGLKRLKSLLITACPGMTDVSLEVVG  353

Query  819   RGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG-LVAIAERCTNLT  995
             + C  LK+  L    +V D+GL    + C  L+ L L +C +I+N G L A+ +   NL 
Sbjct  354   KVCQDLKLCVLSQCQSVTDKGLQSFLQCCVCLDSLQLERCHAITNGGVLTALVQGKGNLR  413

Query  996   SLTIESCPNIGNEGLRA--IGRYCTKLQCLTIKDCPLVG  1106
             +L +  C  + NE  RA  +   C  L+ L +  C  VG
Sbjct  414   TLNLSKCHGLWNEEKRANEVSLECLSLKTLNVTGCKNVG  452



>gb|ADW83728.1| EIN3-binding F-box protein 1 [Musa acuminata AAA Group]
Length=453

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  834   LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIES  1013
             L+VLS+W VP + D GL EIA  CP LEKLDLCQCP I++KGLVA+A++C NLTSLTIES
Sbjct  1     LRVLSMWKVPLITDAGLSEIADGCPLLEKLDLCQCPLITDKGLVAVAKKCPNLTSLTIES  60

Query  1014  CPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITDF  1190
             C NI NEGL+ IGR C KL+ LTIKDC  VGDQG+ SL+SSAS+ L ++KL ALNI+D 
Sbjct  61    CANICNEGLQVIGRSCPKLKSLTIKDCLHVGDQGIVSLVSSASSCLERIKLQALNISDI  119


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 61/116 (53%), Gaps = 4/116 (3%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPS-LEKLDLCQCPSISN  953
             S   I N G+  IGR CP LK L++ +  +VGD+G++ +     S LE++ L Q  +IS+
Sbjct  60    SCANICNEGLQVIGRSCPKLKSLTIKDCLHVGDQGIVSLVSSASSCLERIKL-QALNISD  118

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRY--CTKLQCLTIKDCPLVGDQG  1115
               L  I     NL  L++    N+G +G   +G      KL+ +TI  C  + D+G
Sbjct  119   IVLAVIGHYGKNLIDLSLNGLQNVGEKGFWVMGNALGLQKLRSITINCCNGLTDKG  174


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             IT+ G+ A+ + CP+L  L++ +  N+ +EGL  I R CP L+ L +  C  + ++G+V+
Sbjct  38    ITDKGLVAVAKKCPNLTSLTIESCANICNEGLQVIGRSCPKLKSLTIKDCLHVGDQGIVS  97

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             +    ++          NI +  L  IG Y   L  L++     VG++G
Sbjct  98    LVSSASSCLERIKLQALNISDIVLAVIGHYGKNLIDLSLNGLQNVGEKG  146



>ref|XP_006648432.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=490

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  828   PSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTI  1007
             P+L  L+LW+VP V D GL EIA  CPSLE+LD+ +CP I++KGL A+A+ C NL SLT+
Sbjct  36    PNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLTAVAQGCPNLLSLTV  95

Query  1008  ESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             ESCP +GN+GLRAIGR C+KLQ L IK+C LVGDQG++S++ +A+A LTK++L  LNITD
Sbjct  96    ESCPGVGNDGLRAIGRCCSKLQALNIKNCALVGDQGISSVVCAATASLTKIRLQGLNITD  155


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 77/159 (48%), Gaps = 8/159 (5%)
 Frame = +3

Query  639   DLEVECDGYLSRSVEGKKATDVRLAAIA----VGTSSRGGLGKLCVRGSNSARGITNVGI  806
             D  +   GY  ++V     T VRL+A+A       ++  GL  L      S  G+TN+ +
Sbjct  155   DASLAVIGYYGKAV--TDLTLVRLSAVAERGFWVMANAAGLQNLRCMSVISCPGVTNLAL  212

Query  807   SAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCT  986
             ++I + CPSL+ LSL    ++ D GL         LE L L +C  ++  G++A    C 
Sbjct  213   ASIAKFCPSLRQLSLRKCGHMTDAGLKAFTDSARLLESLQLEECNGVTLVGILAFLVNCG  272

Query  987   N-LTSLTIESCPNIGN-EGLRAIGRYCTKLQCLTIKDCP  1097
             +   SL++  C  I +   + A    C  LQ LTIKDCP
Sbjct  273   HKFRSLSLVKCMGIKDISSMPAQLPLCKSLQFLTIKDCP  311



>gb|EMS68820.1| hypothetical protein TRIUR3_29831 [Triticum urartu]
Length=484

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             R + + G+ A+ RG P+L  L+LW+VP V D GL EIA  CPSLE+LD+  CP I++KGL
Sbjct  16    RVLEDQGLLAVARGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITSCPLITDKGL  75

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssas  1142
              AIA+ C NL SLT+E+C  +GNEGLRAIGR C KLQ ++IK+C  VGDQG++SL+ SAS
Sbjct  76    AAIAQGCPNLVSLTMEACSGVGNEGLRAIGRCCLKLQAVSIKNCVHVGDQGISSLVCSAS  135

Query  1143  avlTKVKLHALNITD  1187
             A L K++L  LNITD
Sbjct  136   ASLAKIRLQGLNITD  150


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 71/147 (48%), Gaps = 9/147 (6%)
 Frame = +3

Query  684   GKKATDVRLAAIA-VG------TSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKV  842
             GK  TD+ LA +A VG       ++  GL KL      S  G+T++ I+ I + CP LK 
Sbjct  160   GKAVTDLTLARLAAVGERGFWVMANAAGLQKLRCMSVTSCLGVTDLAITCIAKFCPGLKQ  219

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN-LTSLTIESCP  1019
             L L    +V D GL         +E L L +C  ++  G++A    C++   +L++  C 
Sbjct  220   LCLRKCGHVSDAGLKAFTESAKVMENLQLEECNRVTLVGVLACLINCSHKFRALSLVKCT  279

Query  1020  NIGNE-GLRAIGRYCTKLQCLTIKDCP  1097
              + +     A    C  L+ LTIKDCP
Sbjct  280   GVKDVCSAPAQLPVCKSLRFLTIKDCP  306



>ref|NP_001046222.1| Os02g0200900 [Oryza sativa Japonica Group]
 dbj|BAD15850.1| putative F-box protein [Oryza sativa Japonica Group]
 dbj|BAF08136.1| Os02g0200900 [Oryza sativa Japonica Group]
Length=511

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  819   RGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTS  998
             RG P+L  L+LW+VP V D GL EIA  CPSLE+LD+ +CP I++KGL A+A  C NL S
Sbjct  54    RGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAVAHGCPNLLS  113

Query  999   LTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALN  1178
             LT+ESC  +GN+GLRAIGR C+K+Q L IK+C  +GDQG++SL+ SA+A LTK++L  LN
Sbjct  114   LTVESCSGVGNDGLRAIGRSCSKIQALNIKNCARIGDQGISSLVCSATASLTKIRLQGLN  173

Query  1179  ITD  1187
             ITD
Sbjct  174   ITD  176


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             IT+ G++A+  GCP+L  L++ +   VG++GL  I R C  ++ L++  C  I ++G+ +
Sbjct  96    ITDKGLAAVAHGCPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNCARIGDQGISS  155

Query  969   IAERCT-NLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             +    T +LT + ++   NI +  L  IG Y   +  LT+   P+V ++G
Sbjct  156   LVCSATASLTKIRLQGL-NITDASLALIGYYGKAVTDLTLVRLPVVAERG  204


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 67/148 (45%), Gaps = 11/148 (7%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             GK  TD+ L  + V  + RG        GL  L      S  G+TN+ ++AI + CPSL+
Sbjct  186   GKAVTDLTLVRLPV-VAERGFWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLR  244

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESC  1016
              LS     ++ D GL         LE L L +C  ++  G++     C     SL++  C
Sbjct  245   QLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTLVGILDFLVNCGPKFRSLSLVKC  304

Query  1017  PNIGNE-GLRAIGRYCTKLQCLTIKDCP  1097
               I +     A    C  LQ LTIKDCP
Sbjct  305   MGIKDICSTPAQLPLCKSLQFLTIKDCP  332


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 73/168 (43%), Gaps = 34/168 (20%)
 Frame = +3

Query  696   TDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGD  875
             TD  LAA+A G  +   L  L V    S  G+ N G+ AIGR C  ++ L++ N   +GD
Sbjct  97    TDKGLAAVAHGCPN---LLSLTVE---SCSGVGNDGLRAIGRSCSKIQALNIKNCARIGD  150

Query  876   EG--------------------------LLEIARECPSLEKLDLCQCPSISNKGLVAIAE  977
             +G                          L  I     ++  L L + P ++ +G   +A 
Sbjct  151   QGISSLVCSATASLTKIRLQGLNITDASLALIGYYGKAVTDLTLVRLPVVAERGFWVMAN  210

Query  978   RC--TNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
                  NL  +++ SCP + N  L AI ++C  L+ L+ + C  + D G
Sbjct  211   AAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLRQLSFRKCGHMTDAG  258



>ref|XP_010908612.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=569

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 147/263 (56%), Gaps = 34/263 (13%)
 Frame = +3

Query  351   CPSRKRARITGPFVVEVQEKKPS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLM  527
             C +R++ R+    V E   ++P  I+ LP+ECL  IFR L   R+R S A VSK+WL + 
Sbjct  3     CGNREK-RVRCGTVEESNAREPDFIDQLPEECLVLIFRFLPLIRDRCSCAAVSKKWLHVQ  61

Query  528   SSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVR  707
             + +R S+ +RS+                D   SP+ E         +SR ++ ++A D R
Sbjct  62    ARMRRSD-WRSE---------------QDEACSPSKE---------ISRCLDMEEANDTR  96

Query  708   LAAIAVGTSSRGGLGKLCVRGS-----NSARG--ITNVGISAIGRGCPSLKVLSLWNVPN  866
             LAA+A+G   +G L +L +  S      S+RG  +T+ G+S I + C +L+ L+LWN   
Sbjct  97    LAAMAIGIPYQGVLTELAISASLPSLPFSSRGDQMTDYGLSIISQVCLNLRSLTLWNCTK  156

Query  867   VGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRA  1046
             VG++G+  +A  C SLEK  L   PSI++ GL+ IA+ C +L+SL + SC +IGN  L A
Sbjct  157   VGNKGIASLANCCTSLEKFSLSNSPSITDDGLLLIAKGCPDLSSLILNSCWSIGNRSLDA  216

Query  1047  IGRYCTKLQCLTIKDCPLVGDQG  1115
               ++  KL+   ++ CP+V D  
Sbjct  217   FAKHSNKLKLFILERCPVVKDSA  239



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = +3

Query  243  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  410
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  411  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  590
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  591  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKAT  698
            +V+G           ED EVE  GYLSRS+E K+  
Sbjct  121  EVSGN--------KAEDQEVEGCGYLSRSLERKEGN  148



>gb|AAR88780.1| putative F-box protein family [Musa acuminata AAA Group]
Length=164

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  873   DEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
             D GL EIA  CP LEKLDLCQCP I++K LVA+A++C NLTSLTIESC NI NEGL+ IG
Sbjct  1     DAGLSEIADGCPLLEKLDLCQCPLITDKVLVAVAKKCPNLTSLTIESCANICNEGLQVIG  60

Query  1053  RYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNIT  1184
             R C KL+ LTIKDC  VGDQG+ SL+SSAS+ L ++KL ALNI+
Sbjct  61    RSCPKLKSLTIKDCLHVGDQGIVSLVSSASSCLERIKLQALNIS  104


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  795   NVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIA  974
             + G+S I  GCP L+ L L   P + D+ L+ +A++CP+L  L +  C +I N+GL  I 
Sbjct  1     DAGLSEIADGCPLLEKLDLCQCPLITDKVLVAVAKKCPNLTSLTIESCANICNEGLQVIG  60

Query  975   ERCTNLTSLTIESCPNIGNEGLRAI  1049
               C  L SLTI+ C ++G++G+ ++
Sbjct  61    RSCPKLKSLTIKDCLHVGDQGIVSL  85


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 60/116 (52%), Gaps = 4/116 (3%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPS-LEKLDLCQCPSISN  953
             S   I N G+  IGR CP LK L++ +  +VGD+G++ +     S LE++ L Q  +IS 
Sbjct  47    SCANICNEGLQVIGRSCPKLKSLTIKDCLHVGDQGIVSLVSSASSCLERIKL-QALNISG  105

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRY--CTKLQCLTIKDCPLVGDQG  1115
               L  I     NL  L++    N+G +G   +G      KL+ +TI  C  + D+G
Sbjct  106   IVLAVIGHYGKNLIDLSLNGLQNVGEKGFWVMGNALGLQKLRSITINCCNGLTDKG  161



>ref|XP_009414462.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=615

 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 124/244 (51%), Gaps = 37/244 (15%)
 Frame = +3

Query  420   IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  599
             I+ LPDECL  IF  L   R+R   A VS++WL L +S+R SE                 
Sbjct  32    IDDLPDECLLLIFSLLPAPRDRCRCAAVSRKWLALQASMRRSEF----------------  75

Query  600   GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCV-----  764
               +N V +  A +++        SR ++G +A D RLAA+A+G  +   L  L V     
Sbjct  76    -GANAVLLPEARQEM--------SRCIKGSEANDWRLAAMAIGIDACEVLTHLSVMETLP  126

Query  765   -------RGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
                    + + + R I++VG+  I + C  L+ L+L N   V D GL  IA+ C +L+ L
Sbjct  127   SCPLPPLQHAGNHRHISDVGLFVIAQACTDLRSLALHNCIKVSDRGLAAIAQNCSALKNL  186

Query  924   DLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLV  1103
             +L    S++++GL+ IA  C NL SL + +CP++ +  L A  R+ T L    +  CPL+
Sbjct  187   ELTNAFSVTDRGLMLIASGCPNLASLRLTACPSVTDRSLVAFSRHSTLLNSFAVAQCPLI  246

Query  1104  GDQG  1115
              D G
Sbjct  247   TDHG  250



>ref|XP_009386195.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=604

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 141/266 (53%), Gaps = 36/266 (14%)
 Frame = +3

Query  420   IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  599
             I+ LPDE L  IF  +   R+R     VSK+W +L +S+  S+                 
Sbjct  30    IDDLPDELLVHIFSFIPAIRDRCCCGAVSKKWSLLQASMPRSDYI---------------  74

Query  600   GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGS--  773
              +   +   P  E         +SRS  G +A D RL A+A+G  +RG L  L V G+  
Sbjct  75    -SRGFLLPRPTQE---------ISRSFRGSEANDTRLVAMAIGIDARGVLTNLSVIGTLP  124

Query  774   -------NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLC  932
                    +  R I++VG+S +   C SLK LSL+  P +   G+  +   C  LE+L+L 
Sbjct  125   DSSPPPPSGHRSISDVGLSIVAGACKSLKSLSLFKCPKITGWGIGSVG-HCIGLERLELV  183

Query  933   QCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                S+++ GLV +A RC NL+SL++ SCPN+GN  L+A  +Y  KL+ +T+  CPL+ D 
Sbjct  184   DAMSVTDDGLVILAIRCLNLSSLSLVSCPNVGNHSLQAFAKYSRKLKSVTLASCPLITDS  243

Query  1113  GvasllssasavlTKVKLHALNITDF  1190
             G+ SL+++ S + T VK+ ++ ++D 
Sbjct  244   GIVSLVANRSGLET-VKIASMKLSDI  268



>ref|XP_009392099.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=661

 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 142/289 (49%), Gaps = 40/289 (14%)
 Frame = +3

Query  363   KRARITGPFVVEVQEK---KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSS  533
             KR R   PF     ++   +  I  LP++CL  IF  L   R+R   + VS+ W  L + 
Sbjct  56    KRRRTDSPFNESRTDQGRGQDLISNLPNDCLLLIFSFLPSPRDRCRCSAVSRSWFALQTF  115

Query  534   VRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLA  713
             +R SE FR+                 +V + P             SR ++G  A D+RL 
Sbjct  116   LRRSE-FRA-----------------NVVLPPRSRQES-------SRCLQGSSANDLRLG  150

Query  714   AIAVGTSSRGGLGKLCVRGS-----------NSARGITNVGISAIGRGCPSLKVLSLWNV  860
             A+A+G    G L +L V  +           +    +++VGISA+ + C +L+ L+L N 
Sbjct  151   AMAIGMDECGILTELSVIDTLPCSLLPLHHHHHHCHVSDVGISAMAQACSNLRSLALHNC  210

Query  861   PNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGL  1040
               V D GL  +A+ C +L+ L+L    S+ + GLV +A RC  L SL++ +CP + +  L
Sbjct  211   TKVTDRGLATVAQNCTALKNLELTHAASVGDHGLVILATRCLKLASLSLTACPRVTDRSL  270

Query  1041  RAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              A  ++ T L+ +T+  CP + D G+ S++   + + T VK+ ++ + D
Sbjct  271   EAYSKHSTHLKSITVAQCPFITDYGILSIVVLLTKLET-VKISSMKLGD  318



>dbj|BAJ34438.1| unnamed protein product [Thellungiella halophila]
Length=430

 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  912   LEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKD  1091
             +EKLDL +CP I++  +VAIAE C +L+ LTI+SC  IGNEGLRAI R CT L+ ++I+ 
Sbjct  2     IEKLDLSRCPGITDNAMVAIAENCLHLSDLTIDSCSGIGNEGLRAIARRCTNLRSISIRS  61

Query  1092  CPLVGDQGvasllssasavlTKVKLHALNIT  1184
             CP +GDQGVA LL+ A + LTKVKL  LNIT
Sbjct  62    CPRIGDQGVAFLLAQAGSYLTKVKLQMLNIT  92


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 93/206 (45%), Gaps = 39/206 (19%)
 Frame = +3

Query  684   GKKATDVRLAAIAVGTSSRG--------GLGKLCVRGSNSARGITNVGISAIGRGCPSLK  839
             G   TD+ L  +  G + +G        G+ KL      S RG+T+VG+ A+G GCP LK
Sbjct  103   GAAVTDLVLHGLQ-GVNEKGFWVMANAKGMKKLKSLSVMSCRGMTDVGLEAVGNGCPDLK  161

Query  840   VLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER-------------  980
              +SL     V  +GL+ +A+   SLE L L +C  I+  G +                  
Sbjct  162   HVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGFLGFLTNCGSKLKAFSLANC  221

Query  981   ----------------CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
                             C+++ SL+I  CP  G+  L  +G++C +LQ + +     V D 
Sbjct  222   MGIQDLNPESPLQLTGCSSIRSLSIRCCPGFGDASLAFLGKFCHQLQDVELSGLNGVTDA  281

Query  1113  GvasllssasavlTKVKLHA-LNITD  1187
             GV  LL S +  L KV L   +N++D
Sbjct  282   GVLELLQSNNVGLVKVNLSGCINVSD  307


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 48/87 (55%), Gaps = 6/87 (7%)
 Frame = +3

Query  843   LSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPN  1022
             L L   P + D  ++ IA  C  L  L +  C  I N+GL AIA RCTNL S++I SCP 
Sbjct  5     LDLSRCPGITDNAMVAIAENCLHLSDLTIDSCSGIGNEGLRAIARRCTNLRSISIRSCPR  64

Query  1023  IGNEG----LRAIGRYCT--KLQCLTI  1085
             IG++G    L   G Y T  KLQ L I
Sbjct  65    IGDQGVAFLLAQAGSYLTKVKLQMLNI  91



>gb|KDO69901.1| hypothetical protein CISIN_1g015721mg [Citrus sinensis]
Length=402

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 112/243 (46%), Gaps = 19/243 (8%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA-----  587
             E L D+ L  I  RL   +++     V KRWL L S+ R     R+  H    IA     
Sbjct  8     EVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRAGPHMLRKIAARFSR  67

Query  588   ----DKVNGASNDVEMSPADEDLEVECDGYLSRSV----EGKKATDVRLAAIAVGTSSRG  743
                 D     S        D DL V  DG+ S  +      K  TD  +A+I  G  S  
Sbjct  68    LVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQ  127

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
              L        +  R +T+ G+SA+  GC  L+ L L    +V D  L  +++ C +LE+L
Sbjct  128   SLDL------SYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSVTDGTLQALSKNCRNLEEL  181

Query  924   DLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLV  1103
              L  C SIS+ G++ +   C N+  L +  C NIG+ G+ ++ + C+ L+ L + DC  V
Sbjct  182   GLLGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKV  241

Query  1104  GDQ  1112
             GD+
Sbjct  242   GDK  244



>ref|XP_006484494.1| PREDICTED: F-box/LRR-repeat protein 4-like [Citrus sinensis]
Length=402

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 112/243 (46%), Gaps = 19/243 (8%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA-----  587
             E L D+ L  I  RL   +++     V KRWL L S+ R     R+  H    IA     
Sbjct  8     EVLRDDELRSILSRLEDDKDKERFGLVCKRWLHLQSTERKKLSVRAGPHMLRKIAARFSR  67

Query  588   ----DKVNGASNDVEMSPADEDLEVECDGYLSRSV----EGKKATDVRLAAIAVGTSSRG  743
                 D     S        D DL V  DG+ S  +      K  TD  +A+I  G  S  
Sbjct  68    LVELDLSQSVSRSFYPGVTDSDLAVIADGFKSLKLLNLQNCKGITDAGIASIGSGLCSLQ  127

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
              L        +  R +T+ G+SA+  GC  L+ L L    ++ D  L  +++ C +LE+L
Sbjct  128   SLDL------SYCRKLTDKGLSAVAEGCQDLRSLHLAGCKSITDGTLQALSKNCHNLEEL  181

Query  924   DLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLV  1103
              L  C SIS+ G++ +   C N+  L +  C NIG+ G+ ++ + C+ L+ L + DC  V
Sbjct  182   GLQGCTSISDSGVIDLVNGCQNIKFLDLNKCSNIGDNGISSVSKSCSSLKTLKLLDCYKV  241

Query  1104  GDQ  1112
             GD+
Sbjct  242   GDK  244



>ref|XP_006847795.1| PREDICTED: F-box/LRR-repeat protein 4 [Amborella trichopoda]
 gb|ERN09376.1| hypothetical protein AMTR_s00029p00023180 [Amborella trichopoda]
Length=407

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 118/257 (46%), Gaps = 19/257 (7%)
 Frame = +3

Query  381   GPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS  560
             G  + E + +    +AL D+ L  I  +L   R+R S   V K+WLML SS R     R+
Sbjct  2     GTSIAERETRVCINDALTDDELRAILSKLQSERDRDSFGLVCKKWLMLQSSERKKLCVRA  61

Query  561   KSHQDLSIADKVNGASN-DVEMSPA--------DEDLEVECDGYLSRSVEG----KKATD  701
                    IA +  GA   D+  S +        D DL V  +G+ S         K  TD
Sbjct  62    GPVMLERIARRFRGARELDISQSVSRSFYPGTLDADLSVIAEGFKSLQFLNLQNCKGVTD  121

Query  702   VRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEG  881
               L A+A G S    L       ++  R +T+ G  AI  GC  L+ L L    +V D  
Sbjct  122   TGLKALARGLSHLQSLD------ASHCRKLTDKGFIAISEGCHKLRSLHLSGCKSVSDSL  175

Query  882   LLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYC  1061
             L  +++    LE+L L  C ++++ G+ A+A+ C  +  L +  C  IG+ GL  + + C
Sbjct  176   LHALSKNSRFLEELGLQGCINVTDSGVSALADGCHLIMFLDLSKCSKIGDIGLSKLSKAC  235

Query  1062  TKLQCLTIKDCPLVGDQ  1112
               L  L ++DC  +GD+
Sbjct  236   PSLITLKLQDCSNIGDE  252


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 61/154 (40%), Gaps = 51/154 (33%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I ++G+S + + CPSL  L L +  N+GDE L  +A  CP LE L++  C +I+++ +  
Sbjct  223   IGDIGLSKLSKACPSLITLKLQDCSNIGDETLFSLAESCPDLETLNVGGCRNITDESIKR  282

Query  969   IAERCT-NLTSLTIE---------------------------------------------  1010
             +A  C  NL +L +E                                             
Sbjct  283   LASSCNKNLKNLQLEWCLNISDSAVSFVLSKCDNLEVLDIGCCNEVTDMAFGGLKGLSLR  342

Query  1011  -----SCPNIGNEGLRAIGRYCTKLQCLTIKDCP  1097
                  SCP I   G+  +   C  L+ L I+ CP
Sbjct  343   VLKASSCPGITVLGISVLVEVCQNLEYLDIRSCP  376



>emb|CDX88014.1| BnaA06g26050D [Brassica napus]
Length=405

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 112/233 (48%), Gaps = 23/233 (10%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             +AL D+ L  I  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     DALTDDELRWILSRLDTDKDKEVFGLVCKRWLYLQSTDRKKLAARAGPHMLGRLASRFTR  67

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN--  776
                          +E++    +SRS      TD  LA IA G          C+R  N  
Sbjct  68    I------------VELDLSQSVSRSFY-PGVTDSDLAVIAQGFK--------CLRVLNLH  106

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             + +GIT+ G+++IGR    L+ L +     + D+GL  +A+ C  L  L L  C  I+++
Sbjct  107   TCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAQGCHDLRALHLAGCRFITDE  166

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L +++ERC +L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  167   TLKSLSERCRDLEALVLQGCTNITDSGLADLVKGCRKIKALDINKCSNVGDAG  219



>ref|XP_009136697.1| PREDICTED: F-box/LRR-repeat protein 4 [Brassica rapa]
Length=618

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 88/161 (55%), Gaps = 5/161 (3%)
 Frame = +3

Query  648   VECDGYLSRSVEGKKATDVRLAAIA-VGTSSRGGLGKLCVRGSN----SARGITNVGISA  812
             V CDG  + +   K+ T + +     +GT     +GK C R +       + I N  +  
Sbjct  340   VSCDGLEAIAHGCKELTRIEINGCHNIGTRGLEAVGKSCARLTELYLLYCQRIGNSALYQ  399

Query  813   IGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNL  992
             IG+GC SL+ L L +   +GD  +  IA+ C +L+KL + +C  + NKG++AI + C +L
Sbjct  400   IGKGCKSLETLHLVDCAGIGDAAMCSIAKGCRNLKKLHIRRCYEVGNKGVIAIGKNCKSL  459

Query  993   TSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             T L++  C  +G+  L A+G+ C+ LQ L +  C L+GD G
Sbjct  460   TELSLRFCDKVGDAALVAVGKGCSFLQQLNVSGCHLIGDVG  500


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 76/145 (52%), Gaps = 4/145 (3%)
 Frame = +3

Query  687   KKATDVRLAAIAVGTSSRGGLGKLCVR----GSNSARGITNVGISAIGRGCPSLKVLSLW  854
             ++   ++L  + V  ++   +G  CV        S +  T+ G+ +IG+GC +LK L+L 
Sbjct  276   RRLRSLKLQCVNVTDAAFSVVGDFCVSLEILALYSFQQFTDKGMKSIGKGCKNLKDLTLS  335

Query  855   NVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNE  1034
             +   V  +GL  IA  C  L ++++  C +I  +GL A+ + C  LT L +  C  IGN 
Sbjct  336   DCYFVSCDGLEAIAHGCKELTRIEINGCHNIGTRGLEAVGKSCARLTELYLLYCQRIGNS  395

Query  1035  GLRAIGRYCTKLQCLTIKDCPLVGD  1109
              L  IG+ C  L+ L + DC  +GD
Sbjct  396   ALYQIGKGCKSLETLHLVDCAGIGD  420


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             + N G+ AIG+ C SL  LSL     VGD  L+ + + C  L++L++  C  I + G+ A
Sbjct  444   VGNKGVIAIGKNCKSLTELSLRFCDKVGDAALVAVGKGCSFLQQLNVSGCHLIGDVGITA  503

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             IA+ C  LT L I     +G+  L  +G  C  L+ L +  C  V D G
Sbjct  504   IAKGCPQLTHLDISVLQKVGDASLSELGDGCPMLKDLVLSHCHYVTDNG  552


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (55%), Gaps = 0/108 (0%)
 Frame = +3

Query  786   GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV  965
             GI +  + +I +GC +LK L +     VG++G++ I + C SL +L L  C  + +  LV
Sbjct  417   GIGDAAMCSIAKGCRNLKKLHIRRCYEVGNKGVIAIGKNCKSLTELSLRFCDKVGDAALV  476

Query  966   AIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             A+ + C+ L  L +  C  IG+ G+ AI + C +L  L I     VGD
Sbjct  477   AVGKGCSFLQQLNVSGCHLIGDVGITAIAKGCPQLTHLDISVLQKVGD  524


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 6/128 (5%)
 Frame = +3

Query  690   KATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             K  D  L A+  G S    L +L V G +    I +VGI+AI +GCP L  L +  +  V
Sbjct  469   KVGDAALVAVGKGCSF---LQQLNVSGCHL---IGDVGITAIAKGCPQLTHLDISVLQKV  522

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
             GD  L E+   CP L+ L L  C  +++ GL  +  +C  L +  +  CP I + G+  +
Sbjct  523   GDASLSELGDGCPMLKDLVLSHCHYVTDNGLNHLVNKCKLLETSHMVYCPGITSAGVATV  582

Query  1050  GRYCTKLQ  1073
                C+ ++
Sbjct  583   VSSCSHIK  590


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query  873   DEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIG  1052
             D G++ +A   P +E L L  CP++S+ GL ++A+ CT+L SL ++ C  +G++GL A+G
Sbjct  136   DAGVIALANGFPLIENLSLIWCPNVSSFGLRSLAQICTSLRSLDLQGCF-VGDQGLSAVG  194

Query  1053  RYCTKLQCLTIKDCPLVGDQG  1115
             ++C  L+ L ++ C  + D G
Sbjct  195   KFCNHLEELNLRFCEGLTDVG  215


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 55/109 (50%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + G+ A+ +GC  L+ L L  V NV D     +   C SLE L L      ++KG+ +
Sbjct  263   IHDKGVVAVVKGCRRLRSLKLQCV-NVTDAAFSVVGDFCVSLEILALYSFQQFTDKGMKS  321

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             I + C NL  LT+  C  +  +GL AI   C +L  + I  C  +G +G
Sbjct  322   IGKGCKNLKDLTLSDCYFVSCDGLEAIAHGCKELTRIEINGCHNIGTRG  370


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             + +  + A+G+GC  L+ L++     +GD G+  IA+ CP L  LD+     + +  L  
Sbjct  470   VGDAALVAVGKGCSFLQQLNVSGCHLIGDVGITAIAKGCPQLTHLDISVLQKVGDASLSE  529

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + + C  L  L +  C  + + GL  +   C  L+   +  CP +   G
Sbjct  530   LGDGCPMLKDLVLSHCHYVTDNGLNHLVNKCKLLETSHMVYCPGITSAG  578



>ref|XP_004296974.2| PREDICTED: F-box/LRR-repeat protein 4 [Fragaria vesca subsp. 
vesca]
Length=605

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 79/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK C R +  A    + I N  +S IGRGC  L+ L L +  ++GDE +  
Sbjct  354   IGTLGLESIGKSCPRLTELALLYCQRIGNFALSEIGRGCKFLQALHLVDCSSIGDEAICS  413

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA+ C +L+KL + +C  I NKG+VAI E C +LT L++  C  +G+E L A+ + C+ L
Sbjct  414   IAKGCRNLKKLHIRRCYEIGNKGVVAIGEHCRSLTDLSLRFCDRVGDEALIAVSQ-CSSL  472

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  +GD G
Sbjct  473   QYLNVSGCHQIGDAG  487


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 64/114 (56%), Gaps = 0/114 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I  +G+ +IG+ CP L  L+L     +G+  L EI R C  L+ L L  C SI +
Sbjct  349   NGCHNIGTLGLESIGKSCPRLTELALLYCQRIGNFALSEIGRGCKFLQALHLVDCSSIGD  408

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + + +IA+ C NL  L I  C  IGN+G+ AIG +C  L  L+++ C  VGD+ 
Sbjct  409   EAICSIAKGCRNLKKLHIRRCYEIGNKGVVAIGEHCRSLTDLSLRFCDRVGDEA  462


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
              T+  + AIG GC  LK L+L +   + D+ L  IA  C  L  L++  C +I   GL +
Sbjct  302   FTDKELRAIGSGCKKLKNLTLSDCSFLSDKALESIAIGCKELTHLEVNGCHNIGTLGLES  361

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             I + C  LT L +  C  IGN  L  IGR C  LQ L + DC  +GD+ 
Sbjct  362   IGKSCPRLTELALLYCQRIGNFALSEIGRGCKFLQALHLVDCSSIGDEA  410


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 59/109 (54%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I N G+ AIG  C SL  LSL     VGDE L+ ++ +C SL+ L++  C  I + GL+A
Sbjct  432   IGNKGVVAIGEHCRSLTDLSLRFCDRVGDEALIAVS-QCSSLQYLNVSGCHQIGDAGLIA  490

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             IA  C  LT L +    N+G+  L  +G  C  L+ + +  C  + D G
Sbjct  491   IARGCAELTYLDVSVLQNLGDMSLAELGEGCPNLKDIVLSHCRQITDVG  539


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 75/282 (27%), Positives = 127/282 (45%), Gaps = 49/282 (17%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LP+E + EI RRL       + + VSKRWL L    R +    +    D+ + + ++   
Sbjct  17    LPEELIVEILRRLDSKPSHDACSLVSKRWLALERLSRTTLRIGATGSPDVYV-NLLSRRF  75

Query  609   NDVEMSPADEDLEVECD---GYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNS  779
              +V     DE L +      G L+R   GKK++       +   S   G+          
Sbjct  76    VNVRHVFVDERLNISLPVHLGSLARR-RGKKSS-------SYNKSEEDGV---------E  118

Query  780   ARGITNVGISAIGRGCPSLKVLSL-W--NVPN----------------------VGDEGL  884
                +++ G++A+G G P L+ LSL W  NV +                      VGD+G+
Sbjct  119   TNSLSDAGMAALGEGFPKLEKLSLIWCSNVSSVGLTSLAEKCRLLKSLDLQGCYVGDQGV  178

Query  885   LEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLRAIGRYC  1061
               + + C  LE L+L  C  +++  LV +A     +L SL I +C  I +  L A+G +C
Sbjct  179   AAVGKCCKQLEDLNLQFCEGLTDACLVELASGVGKSLKSLGIAACVKITDVALEAVGLHC  238

Query  1062  TKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
               L+ L + D   + ++GV +++    A+   +KL  +N+TD
Sbjct  239   KSLESLLL-DAESIHNKGVLAVVHGCPALKV-LKLQCINVTD  278


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + G+ AI RGC  L  L +  + N+GD  L E+   CP+L+ + L  C  I++ GL  
Sbjct  483   IGDAGLIAIARGCAELTYLDVSVLQNLGDMSLAELGEGCPNLKDIVLSHCRQITDVGLNH  542

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             + + CT L+S  +  C  I + G+  +   C  ++
Sbjct  543   LVKNCTMLSSCHMVYCQGITSAGVATVVSSCPNIK  577


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 47/97 (48%), Gaps = 5/97 (5%)
 Frame = +3

Query  825   CPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLT  1004
             C SL+ L++     +GD GL+ IAR C  L  LD+    ++ +  L  + E C NL  + 
Sbjct  469   CSSLQYLNVSGCHQIGDAGLIAIARGCAELTYLDVSVLQNLGDMSLAELGEGCPNLKDIV  528

Query  1005  IESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             +  C  I + GL  + + CT L       C +V  QG
Sbjct  529   LSHCRQITDVGLNHLVKNCTMLS-----SCHMVYCQG  560



>ref|XP_009150869.1| PREDICTED: F-box/LRR-repeat protein 2 [Brassica rapa]
Length=405

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 112/233 (48%), Gaps = 23/233 (10%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             +AL D+ L  I  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     DALTDDELRWILSRLDTDKDKEVFGLVCKRWLYLQSTDRKKLAARAGPHMLGRLASRFTR  67

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN--  776
                          +E++    +SRS      TD  LA IA G          C+R  N  
Sbjct  68    I------------VELDLSQSVSRSFY-PGVTDSDLAVIAQGFK--------CLRVLNLH  106

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             + +GIT+ G+++IGR    L+ L +     + D+GL  +A+ C  L  L L  C  I+++
Sbjct  107   TCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAQGCHDLRALHLAGCRFITDE  166

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L +++ERC +L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  167   TLKSLSERCRDLEALGLQGCTNITDSGLADLVKGCRKIKALDINKCSNVGDAG  219



>ref|XP_002526343.1| grr1, plant, putative [Ricinus communis]
 gb|EEF36014.1| grr1, plant, putative [Ricinus communis]
Length=127

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +3

Query  645  EVECDGYLSRSVEGKKATDVRLAAIAVGTS-SRGGLGKLCVRGSNSARGITNVGISAIGR  821
            EVE D  +      +K + +    +  G S SR  + KL +RGSNS+ G   +G+ AI  
Sbjct  9    EVEPDHQVDVYSPSRKRSRINAPFVFNGKSYSRRFICKLSIRGSNSSCGDIVIGLRAIAC  68

Query  822  GCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC  983
             CPSL+  S+ N+P+V +EG+ EIA+ C  LEKLD+  CP+ISN GL+AI + C
Sbjct  69   SCPSLRAPSMCNLPSVNNEGIFEIAKACCMLEKLDIYGCPAISNNGLLAITKNC  122



>gb|KFK39198.1| hypothetical protein AALP_AA3G212400 [Arabis alpina]
Length=405

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 110/233 (47%), Gaps = 23/233 (10%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             +AL D+ L  +  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     QALTDDELRWVLTRLDSDKDKEVFGLVCKRWLHLQSTDRKKLAARAGPHMLRRLASRFT-  66

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN--  776
                        + +E++    +SRS      TD  L  IA G          C+R  N  
Sbjct  67    -----------QIVELDLSQSISRSFY-PGVTDSDLVVIAEGFK--------CLRVLNLH  106

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             + +GIT+ G+++IGR    L+ L +     + D+GL  +A  C  L  L L  C  I+++
Sbjct  107   NCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRTLHLAGCRFITDE  166

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L ++AERC  L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  167   TLKSLAERCRTLEALGLQGCTNITDSGLAELVKGCRKIKTLDINKCSNVGDAG  219


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 59/114 (52%), Gaps = 2/114 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             N    + + G+S +   C S LK L L +   VG+E +  +A+ C +LE L +  C  IS
Sbjct  210   NKCSNVGDAGVSVVAEACASSLKTLKLLDCYKVGNESISSLAQFCKNLETLIIGGCRDIS  269

Query  951   NKGLVAIAERCTN-LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             ++ ++ +A+ C + L +L ++ C NI +  L  I   C  L+ L +  C  V D
Sbjct  270   DESIILLADSCKDSLKNLRMDWCLNISDSSLSCILNQCKNLEALDVGCCEEVTD  323



>ref|NP_197725.1| RNI-like superfamily protein [Arabidopsis thaliana]
 dbj|BAB11189.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL06927.1| AT5g23340/MKD15_20 [Arabidopsis thaliana]
 gb|AAM91352.1| At5g23340/MKD15_20 [Arabidopsis thaliana]
 dbj|BAE98436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93153.1| RNI-like superfamily protein [Arabidopsis thaliana]
Length=405

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/231 (30%), Positives = 111/231 (48%), Gaps = 19/231 (8%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             EAL D+ L  +  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     EALTDDELRWVLSRLDSDKDKEVFGLVCKRWLNLQSTDRKKLAARAGPHMLRRLASRFT-  66

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
                        + +E++    +SRS      TD  LA I+       G   L V   ++ 
Sbjct  67    -----------QIVELDLSQSISRSFY-PGVTDSDLAVIS------EGFKFLRVLNLHNC  108

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             +GIT+ G+++IGR    L+ L +     + D+GL  +A  C  L  L L  C  I+++ L
Sbjct  109   KGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDESL  168

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              +++ERC +L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  169   KSLSERCRDLEALGLQGCTNITDSGLADLVKGCRKIKSLDINKCSNVGDAG  219


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 2/116 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             N    + + G+S++ + C S LK L L +   VG+E +  +A+ C +LE L +  C  IS
Sbjct  210   NKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESISSLAQFCKNLETLIIGGCRDIS  269

Query  951   NKGLVAIAERCTN-LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             ++ ++ +A+ C + L +L ++ C NI +  L  I + C  L+ L I  C  V D  
Sbjct  270   DESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILKQCKNLEALDIGCCEEVTDTA  325



>ref|XP_010493455.1| PREDICTED: F-box/LRR-repeat protein 2-like [Camelina sativa]
Length=405

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/231 (30%), Positives = 111/231 (48%), Gaps = 19/231 (8%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             EAL D+ L  +  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     EALTDDELRWVMSRLDSEKDKEVFGLVCKRWLNLQSTDRKKLAARAGPHMLRRLASRFT-  66

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
                        + +E++    +SRS      TD  LA I+       G   L V   ++ 
Sbjct  67    -----------QIVELDLSQSISRSFY-PGVTDSDLAVIS------EGFKYLRVLNLHNC  108

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
             +GIT+ G+++IGR    L+ L +     + D+GL  +A  C  L  L L  C  I+++ L
Sbjct  109   KGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDESL  168

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              +++ERC +L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  169   KSLSERCRDLEALGLQGCANITDSGLADLVKGCRKIKSLDINKCSNVGDAG  219


 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 62/114 (54%), Gaps = 2/114 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             N    + + G+S++ + C S LK L L +   VG+E +  +A+ C +LE L +  C  IS
Sbjct  210   NKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESIFSLAQSCKNLETLIIGGCRDIS  269

Query  951   NKGLVAIAERCTN-LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             ++ ++ +AE C + L +L ++ C N+ +  L  I + C  L+ L I  C  + D
Sbjct  270   DESIMLLAESCKDSLKNLRMDWCLNVSDSSLSCILKKCKNLEALDIGCCEEITD  323



>ref|XP_006287878.1| hypothetical protein CARUB_v10001105mg [Capsella rubella]
 gb|EOA20776.1| hypothetical protein CARUB_v10001105mg [Capsella rubella]
Length=405

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 112/233 (48%), Gaps = 23/233 (10%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             EAL D+ L  +  RL   +E+     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     EALTDDELRWVLSRLDSDKEKEVFGLVCKRWLTLQSTDRKKLAARAGPHMLRRLASRFT-  66

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN--  776
                        + +E++    +SRS      TD  LA I+ G          C+R  N  
Sbjct  67    -----------QIVELDLSQSISRSFY-PGVTDSDLAVISEGFK--------CLRVLNLH  106

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             + +GIT+ G+++IGR    L+ L +     + D+GL  +A  C  L  L L  C  I+++
Sbjct  107   NCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDE  166

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L +++ERC +L +L ++ C +I + GL  + + C K++ L I  C  VGD G
Sbjct  167   SLKSLSERCRDLEALGLQGCSSITDSGLADLVKGCRKIKSLDINKCSNVGDAG  219


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGC-PSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             N    + + G+S++ + C  SLK L L +   VG+E +L +A+ C +LE L L  C  IS
Sbjct  210   NKCSNVGDAGVSSVAKACGSSLKTLKLLDCYKVGNESVLSLAQSCKNLETLILGGCRDIS  269

Query  951   NKGLVAIAERCTN-LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             ++ ++ +A+ C + L +L ++ C NI +  L  I + C  L+ L I  C  + D  
Sbjct  270   DESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILKKCKNLEALDIGCCEEITDTA  325



>gb|KFM79859.1| F-box/LRR-repeat protein 7, partial [Stegodyphus mimosarum]
Length=139

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (61%), Gaps = 1/107 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I++ G+  I R C  L+ L++     V D+ L  IAR CP L  LD+ +C  I+++GL  
Sbjct  12    ISDAGVRQIARHCYKLRYLNVRGCEAVSDDALEVIARSCPRLRALDIGKC-DITDRGLKI  70

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             I++ C NL  L+++SC  I +EG++ I  YC  LQ L I+DCP+  D
Sbjct  71    ISQHCPNLRKLSVKSCEMITDEGIQIIAYYCRGLQQLNIQDCPITLD  117


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +3

Query  834   LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIES  1013
             ++ LS+     + D G+ +IAR C  L  L++  C ++S+  L  IA  C  L +L I  
Sbjct  1     MRYLSVAKCDRISDAGVRQIARHCYKLRYLNVRGCEAVSDDALEVIARSCPRLRALDIGK  60

Query  1014  CPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             C +I + GL+ I ++C  L+ L++K C ++ D+G
Sbjct  61    C-DITDRGLKIISQHCPNLRKLSVKSCEMITDEG  93



>ref|XP_002872053.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48312.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 112/233 (48%), Gaps = 23/233 (10%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             EAL D+ L  +  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     EALTDDELRWVLSRLDSDKDKEVFGLVCKRWLNLQSTDRKKLAARAGPHMLGRLASRFT-  66

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN--  776
                        + +E++    +SRS      TD  LA I+ G          C+R  N  
Sbjct  67    -----------QIVELDLSQSISRSFY-PGVTDSDLAVISEGFK--------CLRVLNLH  106

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             + +GIT+ G+++IGR    L+ L +     + D+GL  +A  C  L  L L  C  I+++
Sbjct  107   NCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDE  166

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L +++ERC +L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  167   SLKSLSERCRDLEALGLQGCTNITDSGLADLVKGCRKIKSLDINKCSNVGDAG  219


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             N    + + G+S++ + C S LK L L +   VG+E +L +A+ C +LE L +  C  IS
Sbjct  210   NKCSNVGDAGVSSLAKACASSLKTLKLLDCYKVGNESILSLAQFCKNLETLIIGGCRDIS  269

Query  951   NKGLVAIAERCTN-LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             ++ ++ +A+ C + L +L ++ C NI +  L  I + C  L+ L I  C  V D  
Sbjct  270   DESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILKQCRNLEALDIGCCEEVTDTA  325



>ref|XP_010524501.1| PREDICTED: F-box/LRR-repeat protein 4 isoform X2 [Tarenaya hassleriana]
Length=610

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +G+ C   S  A    + I+N  +  IGRGC SL+VL L +  ++GD+ +  
Sbjct  359   IGTLGLEAIGRSCPHLSELALLYCQRISNSALHEIGRGCKSLQVLHLVDCSSIGDDAICR  418

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA  CP+L+KL + +C  + +KG+VA+ + C +L  L+++ C  +G+E L A+G  C+ L
Sbjct  419   IAEGCPNLKKLHIRRCYEVGDKGIVAVGQHCKSLAELSLQFCDRVGDEALIAVGEGCS-L  477

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  +GD G
Sbjct  478   QRLNVSGCHQIGDAG  492


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I  +G+ AIGR CP L  L+L     + +  L EI R C SL+ L L  C SI +
Sbjct  354   NGCHNIGTLGLEAIGRSCPHLSELALLYCQRISNSALHEIGRGCKSLQVLHLVDCSSIGD  413

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               +  IAE C NL  L I  C  +G++G+ A+G++C  L  L+++ C  VGD+ 
Sbjct  414   DAICRIAEGCPNLKKLHIRRCYEVGDKGIVAVGQHCKSLAELSLQFCDRVGDEA  467


 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 82/170 (48%), Gaps = 12/170 (7%)
 Frame = +3

Query  615   VEMSPADEDLEVE-----CDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNS  779
             V  S    DL +E     C    + S++ +   D  L A+A G +    L   CV     
Sbjct  225   VAASAKITDLSMEAVGNHCKFLETLSLDSEYIHDRGLLAVAQGCTLLKTLKLQCVN----  280

Query  780   ARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKG  959
                +T+  + A+G  C SL+VL+L++     D+G+  + + C SL+ L L  C  +S KG
Sbjct  281   ---VTDAALIAVGTLCSSLEVLALYSFQQFTDKGMRAVGKGCKSLKDLTLSDCYFVSCKG  337

Query  960   LVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             L A+A  C  LT L I  C NIG  GL AIGR C  L  L +  C  + +
Sbjct  338   LEAVAHGCKELTRLEINGCHNIGTLGLEAIGRSCPHLSELALLYCQRISN  387


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 4/140 (3%)
 Frame = +3

Query  702   VRLAAIAVGTSSRGGLGKLC----VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             ++L  + V  ++   +G LC    V    S +  T+ G+ A+G+GC SLK L+L +   V
Sbjct  274   LKLQCVNVTDAALIAVGTLCSSLEVLALYSFQQFTDKGMRAVGKGCKSLKDLTLSDCYFV  333

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
               +GL  +A  C  L +L++  C +I   GL AI   C +L+ L +  C  I N  L  I
Sbjct  334   SCKGLEAVAHGCKELTRLEINGCHNIGTLGLEAIGRSCPHLSELALLYCQRISNSALHEI  393

Query  1050  GRYCTKLQCLTIKDCPLVGD  1109
             GR C  LQ L + DC  +GD
Sbjct  394   GRGCKSLQVLHLVDCSSIGD  413


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 123/284 (43%), Gaps = 42/284 (15%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LPDE + EIFRR      R + + V +RWL L    R +    + S  D+ I+       
Sbjct  11    LPDELILEIFRRFDSKPTRDACSLVCRRWLSLERLSRTTLRIGASSSPDVFISLLARRFL  70

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSAR-  785
             + +     DE L V    +L       +    R ++       RG   K   R S   R 
Sbjct  71    H-ITSVHIDERLPV----FLPSPSPPSRRRRERESSSVSSRKPRGSADK---RRSEEERL  122

Query  786   ---GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
                 +++ G++A+  G P L+ LSL    N+  +GL+ +A +C SL+ LDL  C  I ++
Sbjct  123   EPSSLSDAGLTALASGFPQLESLSLIWCSNISSQGLISLAEKCISLKSLDLQGC-YIGDQ  181

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGL---------------------------RAIGR  1055
             GL A+ + C  L  L +  C  + + GL                            A+G 
Sbjct  182   GLAAVGKICKQLEELNLRFCEGLTDAGLIDVAAGCGRSLKSLGVAASAKITDLSMEAVGN  241

Query  1056  YCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             +C  L+ L++ D   + D+G+ ++    + + T +KL  +N+TD
Sbjct  242   HCKFLETLSL-DSEYIHDRGLLAVAQGCTLLKT-LKLQCVNVTD  283


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +3

Query  801   GISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER  980
             G+ A+  GC  L  L +    N+G  GL  I R CP L +L L  C  ISN  L  I   
Sbjct  337   GLEAVAHGCKELTRLEINGCHNIGTLGLEAIGRSCPHLSELALLYCQRISNSALHEIGRG  396

Query  981   CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             C +L  L +  C +IG++ +  I   C  L+ L I+ C  VGD+G
Sbjct  397   CKSLQVLHLVDCSSIGDDAICRIAEGCPNLKKLHIRRCYEVGDKG  441


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 56/109 (51%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + G+ A+ +GC  LK L L  V NV D  L+ +   C SLE L L      ++KG+ A
Sbjct  256   IHDRGLLAVAQGCTLLKTLKLQCV-NVTDAALIAVGTLCSSLEVLALYSFQQFTDKGMRA  314

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + + C +L  LT+  C  +  +GL A+   C +L  L I  C  +G  G
Sbjct  315   VGKGCKSLKDLTLSDCYFVSCKGLEAVAHGCKELTRLEINGCHNIGTLG  363


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 5/126 (4%)
 Frame = +3

Query  711   AAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             A IAVG      L +L V G +    I + GI AI RGCP L  L +  + N+GD  + E
Sbjct  467   ALIAVGEGC--SLQRLNVSGCHQ---IGDAGIIAIARGCPKLTHLDVSVLQNMGDMAMEE  521

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             +   CP+L+++ L  C  I++ GL  +   C  L +  +  CP I + G+  +   C  +
Sbjct  522   VGEGCPNLKEIVLSHCHKITDTGLNHLVGNCKALETCHMVYCPRITSSGVATVVSGCPNI  581

Query  1071  QCLTIK  1088
             + + I+
Sbjct  582   RKVLIE  587


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 1/102 (1%)
 Frame = +3

Query  810   AIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN  989
             A+G GC SL+ L++     +GD G++ IAR CP L  LD+    ++ +  +  + E C N
Sbjct  470   AVGEGC-SLQRLNVSGCHQIGDAGIIAIARGCPKLTHLDVSVLQNMGDMAMEEVGEGCPN  528

Query  990   LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             L  + +  C  I + GL  +   C  L+   +  CP +   G
Sbjct  529   LKEIVLSHCHKITDTGLNHLVGNCKALETCHMVYCPRITSSG  570



>ref|XP_010454612.1| PREDICTED: F-box/LRR-repeat protein 2-like [Camelina sativa]
Length=405

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 112/233 (48%), Gaps = 23/233 (10%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             EAL D+ L  +  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     EALTDDELRWVLSRLDSEKDKELFGLVCKRWLNLQSTDRKKLAARAGPHMLRRLASRFT-  66

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN--  776
                        + +E++    +SRS      TD  LA I+ G          C+R  N  
Sbjct  67    -----------QIVELDLSQSISRSFY-PGVTDSDLAVISDGFK--------CLRVLNLH  106

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             + +GIT+ G+++IGR    L+ L +     + D+GL  +A  C  L  L L  C  I+++
Sbjct  107   NCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDE  166

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L +++ERC +L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  167   SLKSLSERCRDLEALGLQGCANITDSGLSDLVKGCRKIKSLDINKCSNVGDAG  219


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 2/114 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             N    + + G+S++ + C S LK L L +   VG+E +L +A+ C +LE L +  C  IS
Sbjct  210   NKCSNVGDAGVSSMAKACASSLKTLKLLDCYKVGNESILSLAQSCKNLETLIIGGCRDIS  269

Query  951   NKGLVAIAERCTN-LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             ++ ++ +AE C + L +L ++ C NI +  L  I + C  L+ L I  C  + D
Sbjct  270   DESIMLLAESCKDSLKNLRMDWCLNISDSSLSCILKKCKNLEALDIGCCEEITD  323



>ref|XP_011090837.1| PREDICTED: F-box/LRR-repeat protein 4 [Sesamum indicum]
Length=607

 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK CVR S  A    + I +  +S IG+GC  L+ L L +   +GD+ +  
Sbjct  356   IGTDGLKSIGKFCVRLSELALLYCQRIESDALSEIGKGCKFLQALHLVDCSGIGDDSICS  415

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA+ C +L+KL + +C  + NKG++A+ + C +LT L++  C  IG++ L +IG+ C+ L
Sbjct  416   IAKGCKNLKKLHIRRCYEVGNKGVIAVGQHCKSLTDLSLRFCDRIGDDALISIGQGCS-L  474

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  +GD G
Sbjct  475   QHLNVSGCHQIGDAG  489


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             IT+  + A+G  C SL++L+L++     D  L  I + C  L+ L L  C  +SNKGL +
Sbjct  278   ITDEALQAVGVFCLSLELLALYSFQKFTDRSLSAIGKGCKKLKNLTLSDCYFLSNKGLDS  337

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDC  1094
             +A  C  L  + +  C NIG +GL++IG++C +L  L +  C
Sbjct  338   VAAGCPELMHIEVNGCHNIGTDGLKSIGKFCVRLSELALLYC  379


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I   G+ +IG+ C  L  L+L     +  + L EI + C  L+ L L  C  I +
Sbjct  351   NGCHNIGTDGLKSIGKFCVRLSELALLYCQRIESDALSEIGKGCKFLQALHLVDCSGIGD  410

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
               + +IA+ C NL  L I  C  +GN+G+ A+G++C  L  L+++ C  +GD
Sbjct  411   DSICSIAKGCKNLKKLHIRRCYEVGNKGVIAVGQHCKSLTDLSLRFCDRIGD  462


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (56%), Gaps = 0/111 (0%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S +  T+  +SAIG+GC  LK L+L +   + ++GL  +A  CP L  +++  C +I   
Sbjct  300   SFQKFTDRSLSAIGKGCKKLKNLTLSDCYFLSNKGLDSVAAGCPELMHIEVNGCHNIGTD  359

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             GL +I + C  L+ L +  C  I ++ L  IG+ C  LQ L + DC  +GD
Sbjct  360   GLKSIGKFCVRLSELALLYCQRIESDALSEIGKGCKFLQALHLVDCSGIGD  410


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 73/281 (26%), Positives = 122/281 (43%), Gaps = 37/281 (13%)
 Frame = +3

Query  426   ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGA  605
              LPDE + EIFR +     R + + V KRWL L    R++    + +  D S+   ++  
Sbjct  10    VLPDELVLEIFRHVESKPSRDACSLVCKRWLGLERLSRDTIRIGASATPD-SLVKLLSSR  68

Query  606   SNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSAR  785
               ++     DE L +      S  V+  K   +  A  ++G    G    +      +  
Sbjct  69    FPNIRYVFIDERLSI------SLPVQYGKRRRISRAVPSIGRFRDGSDQSVGGDDGIATS  122

Query  786   GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV  965
              +++ G+ A+G     L+ LSL    +V D GL   A +C SL+ LDL  C  I ++GL 
Sbjct  123   CLSDSGLGAVGDSFIKLEKLSLIWCSSVTDLGLRSFAEKCKSLKSLDLQGC-YIGDEGLA  181

Query  966   AIAERCT---------------------------NLTSLTIESCPNIGNEGLRAIGRYCT  1064
             A+ E C                             L SL + +C  I +  L A+G YC 
Sbjct  182   AVGECCNFLEDLNLRFCEGLTDTGLVRLVLGCGKTLRSLGVAACVKITDVSLEAVGSYCR  241

Query  1065  KLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              L+ L++ D  ++ ++G+ ++    S +   +KL  +NITD
Sbjct  242   SLESLSL-DSEIIQNKGLLAVAKGCSLLKV-LKLQCINITD  280


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + GI AI RGCP L  L +  + N+GD  ++E+   CP L+ + +  C  I++ G+  
Sbjct  485   IGDAGIIAIARGCPQLSYLDVSVLQNLGDNAMVELGEGCPLLKDIVISHCRQITDIGVRY  544

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             +A +CT L S  +  CP I   G+  +   C++++
Sbjct  545   LARKCTLLESCHMVYCPGITEAGVATMVTTCSRIK  579


 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             IT+V + A+G  C SL+ LSL +   + ++GLL +A+ C  L+ L L QC +I+++ L A
Sbjct  228   ITDVSLEAVGSYCRSLESLSL-DSEIIQNKGLLAVAKGCSLLKVLKL-QCINITDEALQA  285

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             +   C +L  L + S     +  L AIG+ C KL+ LT+ DC  + ++G
Sbjct  286   VGVFCLSLELLALYSFQKFTDRSLSAIGKGCKKLKNLTLSDCYFLSNKG  334


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I +  + +IG+GC SL+ L++     +GD G++ IAR CP L  LD+    ++ +  +V 
Sbjct  460   IGDDALISIGQGC-SLQHLNVSGCHQIGDAGIIAIARGCPQLSYLDVSVLQNLGDNAMVE  518

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + E C  L  + I  C  I + G+R + R CT L+   +  CP + + G
Sbjct  519   LGEGCPLLKDIVISHCRQITDIGVRYLARKCTLLESCHMVYCPGITEAG  567



>ref|XP_010524499.1| PREDICTED: F-box/LRR-repeat protein 4 isoform X1 [Tarenaya hassleriana]
Length=617

 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +G+ C   S  A    + I+N  +  IGRGC SL+VL L +  ++GD+ +  
Sbjct  366   IGTLGLEAIGRSCPHLSELALLYCQRISNSALHEIGRGCKSLQVLHLVDCSSIGDDAICR  425

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA  CP+L+KL + +C  + +KG+VA+ + C +L  L+++ C  +G+E L A+G  C+ L
Sbjct  426   IAEGCPNLKKLHIRRCYEVGDKGIVAVGQHCKSLAELSLQFCDRVGDEALIAVGEGCS-L  484

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  +GD G
Sbjct  485   QRLNVSGCHQIGDAG  499


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I  +G+ AIGR CP L  L+L     + +  L EI R C SL+ L L  C SI +
Sbjct  361   NGCHNIGTLGLEAIGRSCPHLSELALLYCQRISNSALHEIGRGCKSLQVLHLVDCSSIGD  420

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               +  IAE C NL  L I  C  +G++G+ A+G++C  L  L+++ C  VGD+ 
Sbjct  421   DAICRIAEGCPNLKKLHIRRCYEVGDKGIVAVGQHCKSLAELSLQFCDRVGDEA  474


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 7/153 (5%)
 Frame = +3

Query  651   ECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCP  830
              C    + S++ +   D  L A+A G +    L   CV        +T+  + A+G  C 
Sbjct  249   HCKFLETLSLDSEYIHDRGLLAVAQGCTLLKTLKLQCVN-------VTDAALIAVGTLCS  301

Query  831   SLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIE  1010
             SL+VL+L++     D+G+  + + C SL+ L L  C  +S KGL A+A  C  LT L I 
Sbjct  302   SLEVLALYSFQQFTDKGMRAVGKGCKSLKDLTLSDCYFVSCKGLEAVAHGCKELTRLEIN  361

Query  1011  SCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
              C NIG  GL AIGR C  L  L +  C  + +
Sbjct  362   GCHNIGTLGLEAIGRSCPHLSELALLYCQRISN  394


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 4/140 (3%)
 Frame = +3

Query  702   VRLAAIAVGTSSRGGLGKLC----VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             ++L  + V  ++   +G LC    V    S +  T+ G+ A+G+GC SLK L+L +   V
Sbjct  281   LKLQCVNVTDAALIAVGTLCSSLEVLALYSFQQFTDKGMRAVGKGCKSLKDLTLSDCYFV  340

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
               +GL  +A  C  L +L++  C +I   GL AI   C +L+ L +  C  I N  L  I
Sbjct  341   SCKGLEAVAHGCKELTRLEINGCHNIGTLGLEAIGRSCPHLSELALLYCQRISNSALHEI  400

Query  1050  GRYCTKLQCLTIKDCPLVGD  1109
             GR C  LQ L + DC  +GD
Sbjct  401   GRGCKSLQVLHLVDCSSIGD  420


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +3

Query  801   GISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER  980
             G+ A+  GC  L  L +    N+G  GL  I R CP L +L L  C  ISN  L  I   
Sbjct  344   GLEAVAHGCKELTRLEINGCHNIGTLGLEAIGRSCPHLSELALLYCQRISNSALHEIGRG  403

Query  981   CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             C +L  L +  C +IG++ +  I   C  L+ L I+ C  VGD+G
Sbjct  404   CKSLQVLHLVDCSSIGDDAICRIAEGCPNLKKLHIRRCYEVGDKG  448


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 128/291 (44%), Gaps = 49/291 (17%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LPDE + EIFRR      R + + V +RWL L    R +    + S  D+ I+       
Sbjct  11    LPDELILEIFRRFDSKPTRDACSLVCRRWLSLERLSRTTLRIGASSSPDVFISLLARRFL  70

Query  609   NDVEMSPADEDLEVECDGYL------SRS-VEGKKATDVRLAAIAVGTSSRGGLGKLCVR  767
             + +     DE L V    +L      SR+ +  ++    R ++       RG   K   R
Sbjct  71    H-ITSVHIDERLPV----FLPSPSPPSRNWMCMQRRRRERESSSVSSRKPRGSADK---R  122

Query  768   GSNSAR----GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQ  935
              S   R     +++ G++A+  G P L+ LSL    N+  +GL+ +A +C SL+ LDL  
Sbjct  123   RSEEERLEPSSLSDAGLTALASGFPQLESLSLIWCSNISSQGLISLAEKCISLKSLDLQG  182

Query  936   CPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGL-------------------------  1040
             C  I ++GL A+ + C  L  L +  C  + + GL                         
Sbjct  183   C-YIGDQGLAAVGKICKQLEELNLRFCEGLTDAGLIDVAAGCGRSLKSLGVAASAKITDL  241

Query  1041  --RAIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
                A+G +C  L+ L++ D   + D+G+ ++    + + T +KL  +N+TD
Sbjct  242   SMEAVGNHCKFLETLSL-DSEYIHDRGLLAVAQGCTLLKT-LKLQCVNVTD  290


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 56/109 (51%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + G+ A+ +GC  LK L L  V NV D  L+ +   C SLE L L      ++KG+ A
Sbjct  263   IHDRGLLAVAQGCTLLKTLKLQCV-NVTDAALIAVGTLCSSLEVLALYSFQQFTDKGMRA  321

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + + C +L  LT+  C  +  +GL A+   C +L  L I  C  +G  G
Sbjct  322   VGKGCKSLKDLTLSDCYFVSCKGLEAVAHGCKELTRLEINGCHNIGTLG  370


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 5/126 (4%)
 Frame = +3

Query  711   AAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             A IAVG      L +L V G +    I + GI AI RGCP L  L +  + N+GD  + E
Sbjct  474   ALIAVGEGC--SLQRLNVSGCHQ---IGDAGIIAIARGCPKLTHLDVSVLQNMGDMAMEE  528

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             +   CP+L+++ L  C  I++ GL  +   C  L +  +  CP I + G+  +   C  +
Sbjct  529   VGEGCPNLKEIVLSHCHKITDTGLNHLVGNCKALETCHMVYCPRITSSGVATVVSGCPNI  588

Query  1071  QCLTIK  1088
             + + I+
Sbjct  589   RKVLIE  594


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 1/102 (1%)
 Frame = +3

Query  810   AIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN  989
             A+G GC SL+ L++     +GD G++ IAR CP L  LD+    ++ +  +  + E C N
Sbjct  477   AVGEGC-SLQRLNVSGCHQIGDAGIIAIARGCPKLTHLDVSVLQNMGDMAMEEVGEGCPN  535

Query  990   LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             L  + +  C  I + GL  +   C  L+   +  CP +   G
Sbjct  536   LKEIVLSHCHKITDTGLNHLVGNCKALETCHMVYCPRITSSG  577



>gb|KHG11100.1| F-box/LRR-repeat 4 -like protein [Gossypium arboreum]
Length=411

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 108/244 (44%), Gaps = 20/244 (8%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA-----  587
             + L D+ L  I  RL   +++     V KRWL L S+ R     R+ SH    +A     
Sbjct  13    DTLTDDELRSILSRLESDKDKEVFGLVCKRWLHLQSTERKKLSARAGSHMLSRMAARFTR  72

Query  588   ----DKVNGASNDVEMSPADEDLEVECDGYLSRSV----EGKKATDVRLAAIAVGTSSRG  743
                 D     S        D DL V  +G+    V      K  TD  LA I       G
Sbjct  73    VLELDLSQSVSRSFYPGVTDSDLAVIAEGFKCLKVLKLQNCKAITDRGLALIG------G  126

Query  744   GLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKL  923
             GL  L    ++  R +T+ G+SA+  GC  L+ L L     V D  L  ++R C +L +L
Sbjct  127   GLPSLQSLDASYCRKLTDKGLSAVADGCHDLRSLHLAGCRFVTDGLLFSLSRNCKNLVEL  186

Query  924   DLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYC-TKLQCLTIKDCPL  1100
              L  C +IS+ GL  +   C ++  L I  C N+G+ G+  +   C + L+ L + DC  
Sbjct  187   GLQGCTNISDSGLADLVNGCQHIRFLDINKCSNVGDVGISKVAEVCSSSLKTLKLLDCYK  246

Query  1101  VGDQ  1112
             VGD+
Sbjct  247   VGDE  250


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 59/116 (51%), Gaps = 2/116 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             N    + +VGIS +   C S LK L L +   VGDE +  +++ C +LE L +  C  +S
Sbjct  215   NKCSNVGDVGISKVAEVCSSSLKTLKLLDCYKVGDESIFSLSKFCKNLETLIIGGCRDVS  274

Query  951   NKGLVAIAERCTN-LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             ++ + ++A  C N L +L ++ C NI +  L  I   C  L+ L I  C  V D  
Sbjct  275   DESIKSLAAACKNSLKNLRMDWCLNISDSSLSCILTQCKNLEALDIGCCEEVTDTA  330



>gb|KDO74916.1| hypothetical protein CISIN_1g007312mg [Citrus sinensis]
Length=608

 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 78/135 (58%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK C   +  A    + I N+ +  +GRGC SL+ L L +  ++GD+ +  
Sbjct  357   IGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGDDAICS  416

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA  C +L+KL + +C  I N G+VA+ E C +LT L++  C  +G+E L +IG+ C+ L
Sbjct  417   IAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGCS-L  475

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  +GD G
Sbjct  476   QHLNVSGCHQIGDAG  490


 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 73/139 (53%), Gaps = 6/139 (4%)
 Frame = +3

Query  696   TDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGD  875
             +D+ L AIA G      L        N    I  +G+ +IG+ C +L  L+L     +G+
Sbjct  332   SDMGLEAIATGCKELTHLE------INGCHNIGTMGLESIGKFCRNLTELALLYCQRIGN  385

Query  876   EGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGR  1055
               LLE+ R C SL+ L L  C SI +  + +IAE C NL  L I  C  IGN G+ A+G 
Sbjct  386   LALLEVGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGE  445

Query  1056  YCTKLQCLTIKDCPLVGDQ  1112
             +C  L  L+++ C  VGD+
Sbjct  446   HCNSLTELSLRFCDRVGDE  464


 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 61/111 (55%), Gaps = 0/111 (0%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S +  T+ G+ A+G+GC  LK L+L +   + D GL  IA  C  L  L++  C +I   
Sbjct  301   SFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTM  360

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             GL +I + C NLT L +  C  IGN  L  +GR C  LQ L + DC  +GD
Sbjct  361   GLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGD  411


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 0/107 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +T+  + A+G  C SL++L+L++     D+GL  + + C  L+ L L  C  +S+ GL A
Sbjct  279   VTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEA  338

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             IA  C  LT L I  C NIG  GL +IG++C  L  L +  C  +G+
Sbjct  339   IATGCKELTHLEINGCHNIGTMGLESIGKFCRNLTELALLYCQRIGN  385


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 71/142 (50%), Gaps = 8/142 (6%)
 Frame = +3

Query  690   KATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             K TDV L A+     S   L       S  +  I N G+ A+ +GCP L+VL L  + NV
Sbjct  228   KITDVSLEAVGSHCKSLETL-------SLDSEFIHNKGVHAVAQGCPLLRVLKLQCI-NV  279

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
              DE L+ +  +C SLE L L      ++KGL A+ + C  L +LT+  C  + + GL AI
Sbjct  280   TDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAI  339

Query  1050  GRYCTKLQCLTIKDCPLVGDQG  1115
                C +L  L I  C  +G  G
Sbjct  340   ATGCKELTHLEINGCHNIGTMG  361


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 127/281 (45%), Gaps = 38/281 (14%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LPDE + EIFR L     R + + V +RWL L    R +    +    DL +       +
Sbjct  11    LPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGSPDLFVKLLSRRFA  70

Query  609   NDVEMSPADEDLEVECD------------------GYLSRSV---------EGKKATDVR  707
             N V+    DE L V                      YL++           E    +D  
Sbjct  71    N-VKSIHIDERLSVSIPVQHGRRRGDQSKLSALQLHYLTKKTGSEDGQFQSESYYLSDSG  129

Query  708   LAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLL  887
             L A+A G S    L KL +   ++   I+++G+ ++ + C  LK L L     VGD+GL 
Sbjct  130   LNALADGFSK---LEKLSLIWCSN---ISSLGLMSLAQKCIHLKSLDLQGCY-VGDQGLA  182

Query  888   EIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLRAIGRYCT  1064
              + + C  LE L+L  C  +++ GLV +A  C  +L SL I +C  I +  L A+G +C 
Sbjct  183   AVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCK  242

Query  1065  KLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              L+ L++ D   + ++GV ++      +   +KL  +N+TD
Sbjct  243   SLETLSL-DSEFIHNKGVHAVAQGCPLLRV-LKLQCINVTD  281


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I N GI A+G  C SL  LSL     VGDE L+ I + C SL+ L++  C  I + G++A
Sbjct  435   IGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGC-SLQHLNVSGCHQIGDAGIMA  493

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             IA+ C  L  L +    N+G++ +  +G+ C  L+ + +  C  + D G
Sbjct  494   IAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVVLSHCRQITDVG  542


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 0/95 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + GI AI +GCP L  L +  + N+GD+ ++E+ + CP L+ + L  C  I++ GL  
Sbjct  486   IGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVVLSHCRQITDVGLSH  545

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             + + C  L S  +  CP I   G+  +   C  ++
Sbjct  546   LVKNCRMLESCHMVYCPGITAAGVATVVSGCANIK  580


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +3

Query  810   AIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN  989
             +IG+GC SL+ L++     +GD G++ IA+ CP L  LD+    ++ ++ +V + + C  
Sbjct  468   SIGQGC-SLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPL  526

Query  990   LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCP  1097
             L  + +  C  I + GL  + + C  L+   +  CP
Sbjct  527   LKDVVLSHCRQITDVGLSHLVKNCRMLESCHMVYCP  562



>gb|EYU43854.1| hypothetical protein MIMGU_mgv1a003235mg [Erythranthe guttata]
Length=598

 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK CV+ S  A    + I N G+S IG+GC  L+ L L +   +GDE +  
Sbjct  347   IGTDGLKSIGKNCVQLSELALLYCQRIENDGLSEIGKGCKYLQALHLVDCSGIGDESICS  406

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IAR C +L KL + +C  + NKG++AI + C  LT L++  C  IG+E L +IG+ C+ L
Sbjct  407   IARGCKNLRKLHIRRCYEVGNKGIIAIGQNCKFLTDLSLRFCDRIGDEALISIGQGCS-L  465

Query  1071  QCLTIKDCPLVGDQG  1115
               L +  C  + D G
Sbjct  466   HHLNVSGCHQIRDAG  480


 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 82/164 (50%), Gaps = 12/164 (7%)
 Frame = +3

Query  639   DLEVECDGYLSRSVEG-----KKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVG  803
             DL +E  G   RS+E      +   +  L A+A G S    L   C+        +T+  
Sbjct  221   DLSLEAVGSHCRSLESLSLDSEIIHNKGLVAVAKGCSMLKVLKLQCL-------NVTDEA  273

Query  804   ISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC  983
             + A+G  C SL+ L+L++     D  L  I + C  L+ L L  C  +SNKGL ++A  C
Sbjct  274   LQAVGVFCLSLETLALYSFQKFTDRSLYAIGKRCKKLKNLTLSDCYFLSNKGLDSVAVGC  333

Query  984   TNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + LT + +  C NIG +GL++IG+ C +L  L +  C  + + G
Sbjct  334   SELTHIELNGCHNIGTDGLKSIGKNCVQLSELALLYCQRIENDG  377


 Score = 76.6 bits (187),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 77/267 (29%), Positives = 126/267 (47%), Gaps = 18/267 (7%)
 Frame = +3

Query  426   ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGA  605
              LPDE + EIFR +     R + + V KRWL L    R++ I    S    ++ + ++  
Sbjct  10    VLPDELILEIFRHVDSKPSRDACSLVCKRWLSLECLSRDT-IRIGASAAPGNLVNLLSRR  68

Query  606   SNDVEMSPADEDLEVECD-GYLSRSVEGKKATDVRLAAIAV-GTSSRGGLGKLCVRGSNS  779
               +      DE L +     Y+ R    +  +D  +    V GT+S    G L   G + 
Sbjct  69    YPNTRSIFIDERLSISLPVKYIKRRRTNRDGSDQSMPGDDVMGTNSLSDAG-LAAVGESF  127

Query  780   AR----------GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDL  929
              +           IT+VG+ +    C SLK L L     +GD GL  +A  C  L+ L+L
Sbjct  128   LKLENLSLIWCSSITDVGLRSFAEKCRSLKSLDLQGCY-IGDGGLTAVAECCKFLQDLNL  186

Query  930   CQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVG  1106
               C  +++ GLV +A  C  NL SL + +C  I +  L A+G +C  L+ L++ D  ++ 
Sbjct  187   RFCEGLTDAGLVLVAVSCGRNLKSLGVAACAKITDLSLEAVGSHCRSLESLSL-DSEIIH  245

Query  1107  DQGvasllssasavlTKVKLHALNITD  1187
             ++G+ ++    S +   +KL  LN+TD
Sbjct  246   NKGLVAVAKGCSMLKV-LKLQCLNVTD  271


 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I   G+ +IG+ C  L  L+L     + ++GL EI + C  L+ L L  C  I +
Sbjct  342   NGCHNIGTDGLKSIGKNCVQLSELALLYCQRIENDGLSEIGKGCKYLQALHLVDCSGIGD  401

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + + +IA  C NL  L I  C  +GN+G+ AIG+ C  L  L+++ C  +GD+ 
Sbjct  402   ESICSIARGCKNLRKLHIRRCYEVGNKGIIAIGQNCKFLTDLSLRFCDRIGDEA  455


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 0/109 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             ++N G+ ++  GC  L  + L    N+G +GL  I + C  L +L L  C  I N GL  
Sbjct  321   LSNKGLDSVAVGCSELTHIELNGCHNIGTDGLKSIGKNCVQLSELALLYCQRIENDGLSE  380

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             I + C  L +L +  C  IG+E + +I R C  L+ L I+ C  VG++G
Sbjct  381   IGKGCKYLQALHLVDCSGIGDESICSIARGCKNLRKLHIRRCYEVGNKG  429


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + GI AI RG P L  L +  + N+ D  ++E+   CP L+ + +  C  I++ G+  
Sbjct  476   IRDAGIIAIARGSPQLSYLDVSVLQNLRDNAIMELGEGCPLLKDIVISHCRQITDTGVSY  535

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             +A +C  L S  +  CP I   G+  I   CT+++
Sbjct  536   LARKCAFLESCHMVYCPGITEVGVATIVTTCTRIK  570



>gb|EYU43856.1| hypothetical protein MIMGU_mgv1a003265mg [Erythranthe guttata]
Length=595

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK CV+ S  A    + I N G+S IG+GC  L+ L L +   +GDE +  
Sbjct  344   IGTDGLKSIGKNCVQLSELALLYCQRIENDGLSEIGKGCKYLQALHLVDCSGIGDESICS  403

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IAR C +L KL + +C  + NKG++AI + C  LT L++  C  IG+E L +IG+ C+ L
Sbjct  404   IARGCKNLRKLHIRRCYEVGNKGIIAIGQNCKFLTDLSLRFCDRIGDEALISIGQGCS-L  462

Query  1071  QCLTIKDCPLVGDQG  1115
               L +  C  + D G
Sbjct  463   HHLNVSGCHQIRDAG  477


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 82/164 (50%), Gaps = 12/164 (7%)
 Frame = +3

Query  639   DLEVECDGYLSRSVEG-----KKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVG  803
             DL +E  G   RS+E      +   +  L A+A G S    L   C+        +T+  
Sbjct  218   DLSLEAVGSHCRSLESLSLDSEIIHNTGLVAVAKGCSMLKVLKLQCL-------NVTDEA  270

Query  804   ISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC  983
             + A+G  C SL+ L+L++     D  L  I + C  L+ L L  C  +SNKGL ++A  C
Sbjct  271   LQAVGVFCLSLETLALYSFQKFTDRSLYAIGKRCKKLKNLTLSDCYFLSNKGLDSVAVGC  330

Query  984   TNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + LT + +  C NIG +GL++IG+ C +L  L +  C  + + G
Sbjct  331   SELTHIELNGCHNIGTDGLKSIGKNCVQLSELALLYCQRIENDG  374


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I   G+ +IG+ C  L  L+L     + ++GL EI + C  L+ L L  C  I +
Sbjct  339   NGCHNIGTDGLKSIGKNCVQLSELALLYCQRIENDGLSEIGKGCKYLQALHLVDCSGIGD  398

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + + +IA  C NL  L I  C  +GN+G+ AIG+ C  L  L+++ C  +GD+ 
Sbjct  399   ESICSIARGCKNLRKLHIRRCYEVGNKGIIAIGQNCKFLTDLSLRFCDRIGDEA  452


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 0/109 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             ++N G+ ++  GC  L  + L    N+G +GL  I + C  L +L L  C  I N GL  
Sbjct  318   LSNKGLDSVAVGCSELTHIELNGCHNIGTDGLKSIGKNCVQLSELALLYCQRIENDGLSE  377

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             I + C  L +L +  C  IG+E + +I R C  L+ L I+ C  VG++G
Sbjct  378   IGKGCKYLQALHLVDCSGIGDESICSIARGCKNLRKLHIRRCYEVGNKG  426


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 73/281 (26%), Positives = 121/281 (43%), Gaps = 49/281 (17%)
 Frame = +3

Query  426   ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGA  605
              LPDE + EIFR +     R + + V KRWL L    R++ I    S    ++ + ++  
Sbjct  10    VLPDELILEIFRHVDSKPSRDACSLVCKRWLSLECLSRDT-IRIGASAAPGNLVNLLSRR  68

Query  606   SNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSAR  785
               +      DE L +     + R    +  +D  +    V              G+NS  
Sbjct  69    YPNTRSIFIDERLSISLP--IKRRRTNRDGSDQSMPGDDV-------------MGTNS--  111

Query  786   GITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLV  965
              +++ G++A+G     L+ LSL    ++ D GL   A +C SL+ LDL  C  I + GL 
Sbjct  112   -LSDAGLAAVGESFLKLENLSLIWCSSITDAGLRSFAEKCRSLKSLDLQGC-YIGDGGLT  169

Query  966   AIAERCT---------------------------NLTSLTIESCPNIGNEGLRAIGRYCT  1064
             A+AE C                            NL SL + +C  I +  L A+G +C 
Sbjct  170   AVAECCKFLQDLNLRFCEGLTDAGLVPVAVSCGRNLKSLGVAACAKITDLSLEAVGSHCR  229

Query  1065  KLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              L+ L++ D  ++ + G+ ++    S +   +KL  LN+TD
Sbjct  230   SLESLSL-DSEIIHNTGLVAVAKGCSMLKV-LKLQCLNVTD  268


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + GI AI RG P L  L +  + N+ D  ++E+   CP L+ + +  C  I++ G+  
Sbjct  473   IRDAGIIAIARGSPQLSYLDVSVLQNLRDNAIMELGEGCPLLKDIVISHCRQITDTGVSY  532

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             +A +C  L S  +  CP I   G+  I   CT+++
Sbjct  533   LARKCAFLESCHMVYCPGITEVGVATIVTTCTRIK  567



>ref|XP_007222308.1| hypothetical protein PRUPE_ppa003937mg [Prunus persica]
 gb|EMJ23507.1| hypothetical protein PRUPE_ppa003937mg [Prunus persica]
Length=539

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 78/135 (58%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK C R +  A    + I N  +S +GRGC  L+ L L +  ++GDE +  
Sbjct  308   IGTMGLESIGKSCPRLTELALLYCQRIGNFALSEVGRGCQFLQALHLVDCSSIGDEAICS  367

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA+ C +L+KL + +C  I N G+VA+ E C +LT L++  C  +G+E L A+ + C+ L
Sbjct  368   IAKGCRNLKKLHIRRCYEIGNTGIVAVGENCRSLTDLSLRFCDRVGDEALIAVAQ-CSSL  426

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  +GD G
Sbjct  427   QYLNVSGCHQIGDAG  441


 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I  +G+ +IG+ CP L  L+L     +G+  L E+ R C  L+ L L  C SI +
Sbjct  303   NGCHNIGTMGLESIGKSCPRLTELALLYCQRIGNFALSEVGRGCQFLQALHLVDCSSIGD  362

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             + + +IA+ C NL  L I  C  IGN G+ A+G  C  L  L+++ C  VGD+ 
Sbjct  363   EAICSIAKGCRNLKKLHIRRCYEIGNTGIVAVGENCRSLTDLSLRFCDRVGDEA  416


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 81/160 (51%), Gaps = 7/160 (4%)
 Frame = +3

Query  630   ADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGIS  809
             A E + + C    + S++ +   +  + A+A G  +   +   C+        +T+  +S
Sbjct  184   AMEAVGLHCKSLKNLSLDAEFIHNKGVVAVAQGCPALKSMKLQCIN-------VTDEALS  236

Query  810   AIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN  989
             A+G  CPSL+VL+L++     D+GL  I   C  L+ L L  C  +S+  L +IA  C  
Sbjct  237   AVGTSCPSLEVLALYSFQRFTDKGLSAIGNGCKKLKNLILSDCYFLSDNALESIATGCKE  296

Query  990   LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             LT L +  C NIG  GL +IG+ C +L  L +  C  +G+
Sbjct  297   LTHLEVNGCHNIGTMGLESIGKSCPRLTELALLYCQRIGN  336


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 118/281 (42%), Gaps = 57/281 (20%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LPDE + E+F RL     R + + V KRWL L    R +    +    DL + D + G  
Sbjct  11    LPDELIIEMFGRLDSKPSRDACSLVCKRWLALERLSRTTLRICATGSPDL-VVDLLAGRF  69

Query  609   NDVEMSPADEDLEV-----------------------------ECDGYLSRSVEGKKATD  701
              +V     DE L +                             +C    S  ++G    D
Sbjct  70    RNVRTIHIDERLNISLPCFPKLEKLSLIWCSNVSSLGLISLAEKCILLKSLDLQGCYVGD  129

Query  702   VRLAAIAVGTSSRG----------GLGKLCV-------------RGSNSARGITNVGISA  812
               LA  AVG S +           GL   CV              G  +   IT+  + A
Sbjct  130   QGLA--AVGQSCKQLEDLNLRFCEGLTDACVVELALGVGKSLKSLGIAACAKITDTAMEA  187

Query  813   IGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNL  992
             +G  C SLK LSL +   + ++G++ +A+ CP+L+ + L QC +++++ L A+   C +L
Sbjct  188   VGLHCKSLKNLSL-DAEFIHNKGVVAVAQGCPALKSMKL-QCINVTDEALSAVGTSCPSL  245

Query  993   TSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               L + S     ++GL AIG  C KL+ L + DC  + D  
Sbjct  246   EVLALYSFQRFTDKGLSAIGNGCKKLKNLILSDCYFLSDNA  286


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 74/154 (48%), Gaps = 6/154 (4%)
 Frame = +3

Query  654   CDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPS  833
             C    S  ++    TD  L+A  VGTS       L V    S +  T+ G+SAIG GC  
Sbjct  217   CPALKSMKLQCINVTDEALSA--VGTSCP----SLEVLALYSFQRFTDKGLSAIGNGCKK  270

Query  834   LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIES  1013
             LK L L +   + D  L  IA  C  L  L++  C +I   GL +I + C  LT L +  
Sbjct  271   LKNLILSDCYFLSDNALESIATGCKELTHLEVNGCHNIGTMGLESIGKSCPRLTELALLY  330

Query  1014  CPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             C  IGN  L  +GR C  LQ L + DC  +GD+ 
Sbjct  331   CQRIGNFALSEVGRGCQFLQALHLVDCSSIGDEA  364


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 67/142 (47%), Gaps = 8/142 (6%)
 Frame = +3

Query  690   KATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             K TD  + A+ +   S   L       S  A  I N G+ A+ +GCP+LK + L  + NV
Sbjct  179   KITDTAMEAVGLHCKSLKNL-------SLDAEFIHNKGVVAVAQGCPALKSMKLQCI-NV  230

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
              DE L  +   CPSLE L L      ++KGL AI   C  L +L +  C  + +  L +I
Sbjct  231   TDEALSAVGTSCPSLEVLALYSFQRFTDKGLSAIGNGCKKLKNLILSDCYFLSDNALESI  290

Query  1050  GRYCTKLQCLTIKDCPLVGDQG  1115
                C +L  L +  C  +G  G
Sbjct  291   ATGCKELTHLEVNGCHNIGTMG  312


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 59/109 (54%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I N GI A+G  C SL  LSL     VGDE L+ +A +C SL+ L++  C  I + GL+A
Sbjct  386   IGNTGIVAVGENCRSLTDLSLRFCDRVGDEALIAVA-QCSSLQYLNVSGCHQIGDAGLIA  444

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             IA  C  L+ L +    N+G+  +  +G  C  L+ + +  C  + D G
Sbjct  445   IARGCPQLSYLDVSVLQNLGDMAMAELGEGCPNLKDIVLSHCRQITDVG  493


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + G+ AI RGCP L  L +  + N+GD  + E+   CP+L+ + L  C  I++ G+  
Sbjct  437   IGDAGLIAIARGCPQLSYLDVSVLQNLGDMAMAELGEGCPNLKDIVLSHCRQITDVGINH  496

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDC  1094
             + + CT L S  +  CP I + G+  +   C  ++ + ++ C
Sbjct  497   LVKHCTMLASCHMVYCPGITSSGVATVVSSCPDIKKVLVEKC  538


 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 49/97 (51%), Gaps = 0/97 (0%)
 Frame = +3

Query  825   CPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLT  1004
             C SL+ L++     +GD GL+ IAR CP L  LD+    ++ +  +  + E C NL  + 
Sbjct  423   CSSLQYLNVSGCHQIGDAGLIAIARGCPQLSYLDVSVLQNLGDMAMAELGEGCPNLKDIV  482

Query  1005  IESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             +  C  I + G+  + ++CT L    +  CP +   G
Sbjct  483   LSHCRQITDVGINHLVKHCTMLASCHMVYCPGITSSG  519



>ref|XP_010424250.1| PREDICTED: F-box/LRR-repeat protein 2-like [Camelina sativa]
Length=366

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 69/233 (30%), Positives = 111/233 (48%), Gaps = 23/233 (10%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             E+L D+ L  +  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  8     ESLTDDELRWVLSRLDSEKDKEVFGLVCKRWLNLQSTDRKKLAARAGPHMLRRLASRFT-  66

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN--  776
                        + +E++    +SRS      TD  LA I+ G          C+R  N  
Sbjct  67    -----------QIVELDLSQSISRSFY-PGVTDSDLAVISDGFK--------CLRVLNLH  106

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             + +GIT+ G+++IGR    L+ L +     + D+GL  +A  C  L  L L  C  I+++
Sbjct  107   NCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDE  166

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L +++ERC  L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  167   SLKSLSERCRELEALGLQGCANITDSGLADLVKGCRKIKSLDINKCSNVGDAG  219


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 2/114 (2%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPS-LKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSIS  950
             N    + + G+S++ + C S LK L L +   VG+E +L +A+ C +LE L +  C  IS
Sbjct  210   NKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESILSLAQSCKNLETLIIGGCRDIS  269

Query  951   NKGLVAIAERCTN-LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             ++ ++ +AE C + L +L ++ C NI +  L  I + C  L+ L I  C  + D
Sbjct  270   DESIMLLAESCKDSLKNLRMDWCLNISDSSLSCILKKCKNLEALDIGCCEEITD  323



>gb|KDP40070.1| hypothetical protein JCGZ_02068 [Jatropha curcas]
Length=452

 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 80/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK C R +  A    + I N  +  IG+GC  L+ L L +  ++GD+ +  
Sbjct  201   IGTIGLEAIGKSCPRLTELALLYCQRIGNHALIEIGKGCKFLQALHLVDCSSIGDDAICC  260

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA+ C +L+KL + +C  I NKG++AI E C +LT L++  C  +G+E L AIG+ C+ L
Sbjct  261   IAKGCRNLKKLHIRRCYEIGNKGIIAIGENCKSLTDLSLRFCDRVGDEALIAIGQGCS-L  319

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C L+GD G
Sbjct  320   QQLNVSGCHLIGDDG  334


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I  +G+ AIG+ CP L  L+L     +G+  L+EI + C  L+ L L  C SI +
Sbjct  196   NGCHNIGTIGLEAIGKSCPRLTELALLYCQRIGNHALIEIGKGCKFLQALHLVDCSSIGD  255

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
               +  IA+ C NL  L I  C  IGN+G+ AIG  C  L  L+++ C  VGD+
Sbjct  256   DAICCIAKGCRNLKKLHIRRCYEIGNKGIIAIGENCKSLTDLSLRFCDRVGDE  308


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +T+  + A+G  C SL+VL+L++     D+GL  I   C  L+ L L  C  +S+KGL A
Sbjct  123   VTDEALMAVGTHCLSLEVLALYSFQRFTDKGLRAIGGGCKKLKNLTLSDCYFLSDKGLEA  182

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
             IA  C  LT L +  C NIG  GL AIG+ C +L  L +  C  +G+ 
Sbjct  183   IATGCRELTQLEVNGCHNIGTIGLEAIGKSCPRLTELALLYCQRIGNH  230


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 70/109 (64%), Gaps = 2/109 (2%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             IT++ + A+   C SL+ LSL +  ++ +EG+L +A+ CPSL+ L L QC +++++ L+A
Sbjct  73    ITDISLEAVSSYCKSLESLSL-DSESIHNEGVLSVAQGCPSLKVLKL-QCINVTDEALMA  130

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             +   C +L  L + S     ++GLRAIG  C KL+ LT+ DC  + D+G
Sbjct  131   VGTHCLSLEVLALYSFQRFTDKGLRAIGGGCKKLKNLTLSDCYFLSDKG  179


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +3

Query  711   AAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             A +AVGT        L V    S +  T+ G+ AIG GC  LK L+L +   + D+GL  
Sbjct  127   ALMAVGTHCL----SLEVLALYSFQRFTDKGLRAIGGGCKKLKNLTLSDCYFLSDKGLEA  182

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA  C  L +L++  C +I   GL AI + C  LT L +  C  IGN  L  IG+ C  L
Sbjct  183   IATGCRELTQLEVNGCHNIGTIGLEAIGKSCPRLTELALLYCQRIGNHALIEIGKGCKFL  242

Query  1071  QCLTIKDCPLVGD  1109
             Q L + DC  +GD
Sbjct  243   QALHLVDCSSIGD  255


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 51/95 (54%), Gaps = 0/95 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + GI+AI RGCP L  L +  + ++GD  + EI   CP L+++ L  C  I++ GL  
Sbjct  330   IGDDGITAIARGCPELIHLDVSVLQHLGDMAMAEIGEGCPLLKEIVLSHCREITDVGLSH  389

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             + + CT L S  +  CP I   G+  +   C  ++
Sbjct  390   LVKNCTMLESCHVVYCPGITAAGVATVVSSCPNIK  424


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 63/103 (61%), Gaps = 7/103 (7%)
 Frame = +3

Query  801   GISAIGRGCPSLKVLSLWNVPNVGDEGLLEIAREC-PSLEKLDLCQCPSISNKGLVAIAE  977
             G++AIGRGC  L+ L+L     + D GL+E+A+ C  SL+ + +  C  I++  L A++ 
Sbjct  24    GLAAIGRGCKRLEDLNLRFCEGLTDTGLVELAQGCGKSLKTVSVAACAKITDISLEAVSS  83

Query  978   RCTNLTSLTIESCPNIGNEGLRAIGRYC-----TKLQCLTIKD  1091
              C +L SL+++S  +I NEG+ ++ + C      KLQC+ + D
Sbjct  84    YCKSLESLSLDS-ESIHNEGVLSVAQGCPSLKVLKLQCINVTD  125


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +3

Query  810   AIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN  989
             AIG+GC SL+ L++     +GD+G+  IAR CP L  LD+     + +  +  I E C  
Sbjct  312   AIGQGC-SLQQLNVSGCHLIGDDGITAIARGCPELIHLDVSVLQHLGDMAMAEIGEGCPL  370

Query  990   LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCP  1097
             L  + +  C  I + GL  + + CT L+   +  CP
Sbjct  371   LKEIVLSHCREITDVGLSHLVKNCTMLESCHVVYCP  406


 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 62/108 (57%), Gaps = 3/108 (3%)
 Frame = +3

Query  867   VGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLR  1043
             VGD GL  I R C  LE L+L  C  +++ GLV +A+ C  +L ++++ +C  I +  L 
Sbjct  20    VGDNGLAAIGRGCKRLEDLNLRFCEGLTDTGLVELAQGCGKSLKTVSVAACAKITDISLE  79

Query  1044  AIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             A+  YC  L+ L++ D   + ++GV S+     ++   +KL  +N+TD
Sbjct  80    AVSSYCKSLESLSL-DSESIHNEGVLSVAQGCPSLKV-LKLQCINVTD  125



>ref|XP_010440303.1| PREDICTED: F-box/LRR-repeat protein 4-like [Camelina sativa]
Length=610

 Score = 89.4 bits (220),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVR----GSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK C R    G    + I N  +  IG+GC SL++L L +   +GD  +  
Sbjct  359   IGTHGLEAIGKSCSRLNELGLLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGDNAMCS  418

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA+ C +L+KL + +C  I NKG+VA+ + C +LT L++  C  +G+E L AIG+ C+ L
Sbjct  419   IAKGCRNLKKLHIRRCYEIGNKGIVAVGKHCKSLTELSVRFCDKVGDEALIAIGKGCS-L  477

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  + D G
Sbjct  478   QQLNVSGCNHISDAG  492


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I   G+ AIG+ C  L  L L     +G+  L EI + C SLE L L  C  I +
Sbjct  354   NGCHNIGTHGLEAIGKSCSRLNELGLLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGD  413

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               + +IA+ C NL  L I  C  IGN+G+ A+G++C  L  L+++ C  VGD+ 
Sbjct  414   NAMCSIAKGCRNLKKLHIRRCYEIGNKGIVAVGKHCKSLTELSVRFCDKVGDEA  467


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 89/189 (47%), Gaps = 17/189 (9%)
 Frame = +3

Query  573   DLSIADKVNGASND-----VEMSPADEDLEVECDGYLSRSVE-----GKKATDVRLAAIA  722
             D+   D V G +N      V  S    DL +E  G   + +E      +   D  L A+A
Sbjct  206   DVGFIDLVVGRANSLKSIRVAASAKITDLSMEAVGSHCKLLEVLFLDSECIHDKGLIAVA  265

Query  723   VGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARE  902
              G +    L   CV        +T+   S +G  C SL+ L+L++  +  D+G+  I + 
Sbjct  266   QGCNRLKDLSLQCVL-------LTDKAFSVVGDLCTSLERLALYSFQHFSDKGMRAIGKG  318

Query  903   CPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLT  1082
             C  L+ L L  C  +S KGL AIA  C  LT + I  C NIG  GL AIG+ C++L  L 
Sbjct  319   CKMLKNLTLSDCSFLSCKGLEAIANGCKELTRVEINGCHNIGTHGLEAIGKSCSRLNELG  378

Query  1083  IKDCPLVGD  1109
             +  C  +G+
Sbjct  379   LLYCQRIGN  387


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 81/165 (49%), Gaps = 7/165 (4%)
 Frame = +3

Query  642   LEVEC---DGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR----GSNSARGITNV  800
             L+ EC    G ++ +    +  D+ L  + +   +   +G LC         S +  ++ 
Sbjct  251   LDSECIHDKGLIAVAQGCNRLKDLSLQCVLLTDKAFSVVGDLCTSLERLALYSFQHFSDK  310

Query  801   GISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER  980
             G+ AIG+GC  LK L+L +   +  +GL  IA  C  L ++++  C +I   GL AI + 
Sbjct  311   GMRAIGKGCKMLKNLTLSDCSFLSCKGLEAIANGCKELTRVEINGCHNIGTHGLEAIGKS  370

Query  981   CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             C+ L  L +  C  IGN  L+ IG+ C  L+ L + DC  +GD  
Sbjct  371   CSRLNELGLLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGDNA  415


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 69/133 (52%), Gaps = 7/133 (5%)
 Frame = +3

Query  690   KATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             K  D  L AI  G S    L +L V G N    I++ GI AI +GCP L  L +  + N+
Sbjct  462   KVGDEALIAIGKGCS----LQQLNVSGCNH---ISDAGILAIAKGCPQLTHLDISVLQNI  514

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
             GD  L E+   CP L+ L L  C +I++ GL  + ++CT L S  +  CP I + G+  +
Sbjct  515   GDMALAELGEGCPLLKDLVLSHCHNITDTGLNHLVQKCTLLESCHMVYCPGITSAGVATV  574

Query  1050  GRYCTKLQCLTIK  1088
                C  ++ + I+
Sbjct  575   VSSCPHIKKVLIE  587


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 71/118 (60%), Gaps = 3/118 (3%)
 Frame = +3

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +R + SA+ IT++ + A+G  C  L+VL L +   + D+GL+ +A+ C  L+ L L QC 
Sbjct  223   IRVAASAK-ITDLSMEAVGSHCKLLEVLFL-DSECIHDKGLIAVAQGCNRLKDLSL-QCV  279

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              +++K    + + CT+L  L + S  +  ++G+RAIG+ C  L+ LT+ DC  +  +G
Sbjct  280   LLTDKAFSVVGDLCTSLERLALYSFQHFSDKGMRAIGKGCKMLKNLTLSDCSFLSCKG  337


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +3

Query  864   NVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLR  1043
             ++ D GL  +A   P LE L L  CP++S+ G+ ++AE+C  L SL ++ C  +G++GL 
Sbjct  126   SLADAGLTALANGFPRLENLSLIWCPNVSSFGMCSLAEKCALLRSLDLQGCF-VGDQGLA  184

Query  1044  AIGRYCTKLQCLTIKDCPLVGDQG  1115
             A+G++C +L+ L ++ C  V D G
Sbjct  185   AVGKFCDQLEDLNLRFCEGVTDVG  208


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 68/133 (51%), Gaps = 5/133 (4%)
 Frame = +3

Query  717   IAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIA  896
             +AVG   +  L +L VR  +    + +  + AIG+GC SL+ L++    ++ D G+L IA
Sbjct  443   VAVGKHCKS-LTELSVRFCDK---VGDEALIAIGKGC-SLQQLNVSGCNHISDAGILAIA  497

Query  897   RECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQC  1076
             + CP L  LD+    +I +  L  + E C  L  L +  C NI + GL  + + CT L+ 
Sbjct  498   KGCPQLTHLDISVLQNIGDMALAELGEGCPLLKDLVLSHCHNITDTGLNHLVQKCTLLES  557

Query  1077  LTIKDCPLVGDQG  1115
               +  CP +   G
Sbjct  558   CHMVYCPGITSAG  570


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 87/213 (41%), Gaps = 23/213 (11%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNS---------EIFRSKSHQDLS  581
             LP+E + EIFRRL     R + + V KRWL L    R +         E F S S + L 
Sbjct  11    LPEELILEIFRRLESKPSRDACSLVCKRWLSLERFSRTTLRIGASISPEEFASLSRRFLH  70

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             I             S   ++        LS S   K+  +    + +       G     
Sbjct  71    IT------------SIHVDERLSVSLPSLSPSPRRKRGRNSSSPSSSSKRKKLNGKTHSA  118

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             V    S   + + G++A+  G P L+ LSL   PNV   G+  +A +C  L  LDL  C 
Sbjct  119   VENVESC-SLADAGLTALANGFPRLENLSLIWCPNVSSFGMCSLAEKCALLRSLDLQGC-  176

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGL  1040
              + ++GL A+ + C  L  L +  C  + + G 
Sbjct  177   FVGDQGLAAVGKFCDQLEDLNLRFCEGVTDVGF  209



>emb|CDO98963.1| unnamed protein product [Coffea canephora]
Length=607

 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 78/135 (58%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +G+ CV  S  A    + I N  +S IGRGC  L+ L L +  ++GD+ ++ 
Sbjct  356   IGTFGLESIGRSCVSLSELALLYCQKIGNFALSEIGRGCKFLQALHLVDCSSIGDDAIIS  415

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA+ C +L+KL + +C  + ++G+VA+ E C  LT L++  C  IG+E L AIG  C  L
Sbjct  416   IAKGCRNLKKLHIRRCYEVGSEGIVAVGENCKFLTDLSLRFCDKIGDEALVAIGN-CHSL  474

Query  1071  QCLTIKDCPLVGDQG  1115
             + L +  C  +GD G
Sbjct  475   RYLNVSGCHHIGDAG  489


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = +3

Query  696   TDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGD  875
             +D  L A+A+G +    L  L V G ++   I   G+ +IGR C SL  L+L     +G+
Sbjct  331   SDKGLEAVAIGCTE---LTHLEVNGCHN---IGTFGLESIGRSCVSLSELALLYCQKIGN  384

Query  876   EGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGR  1055
               L EI R C  L+ L L  C SI +  +++IA+ C NL  L I  C  +G+EG+ A+G 
Sbjct  385   FALSEIGRGCKFLQALHLVDCSSIGDDAIISIAKGCRNLKKLHIRRCYEVGSEGIVAVGE  444

Query  1056  YCTKLQCLTIKDCPLVGDQG  1115
              C  L  L+++ C  +GD+ 
Sbjct  445   NCKFLTDLSLRFCDKIGDEA  464


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 0/107 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +T+  + A+G  C +L+ L+L++     D+ L  I + C  L+ L L  C  +S+KGL A
Sbjct  278   VTDEALEAVGIFCNTLEFLALYSFQRFTDKSLCAIGKGCKRLKNLTLSDCYFLSDKGLEA  337

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             +A  CT LT L +  C NIG  GL +IGR C  L  L +  C  +G+
Sbjct  338   VAIGCTELTHLEVNGCHNIGTFGLESIGRSCVSLSELALLYCQKIGN  384


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S +  T+  + AIG+GC  LK L+L +   + D+GL  +A  C  L  L++  C +I   
Sbjct  300   SFQRFTDKSLCAIGKGCKRLKNLTLSDCYFLSDKGLEAVAIGCTELTHLEVNGCHNIGTF  359

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             GL +I   C +L+ L +  C  IGN  L  IGR C  LQ L + DC  +GD
Sbjct  360   GLESIGRSCVSLSELALLYCQKIGNFALSEIGRGCKFLQALHLVDCSSIGD  410


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 76/140 (54%), Gaps = 7/140 (5%)
 Frame = +3

Query  696   TDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGD  875
             TD  L  +A+G        KL   G  +   IT+V + A+G  C SL+ LSL +   + +
Sbjct  202   TDTGLVNLALGCRR-----KLKSLGVAACAKITDVSLEAVGSYCLSLETLSL-DSEFIHN  255

Query  876   EGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGR  1055
             +G+L +A+ C  L+ L L QC +++++ L A+   C  L  L + S     ++ L AIG+
Sbjct  256   KGVLAVAKGCRVLKVLKL-QCINVTDEALEAVGIFCNTLEFLALYSFQRFTDKSLCAIGK  314

Query  1056  YCTKLQCLTIKDCPLVGDQG  1115
              C +L+ LT+ DC  + D+G
Sbjct  315   GCKRLKNLTLSDCYFLSDKG  334


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 62/128 (48%), Gaps = 4/128 (3%)
 Frame = +3

Query  744   GLGKLCVRGSN----SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPS  911
              +GK C R  N        +++ G+ A+  GC  L  L +    N+G  GL  I R C S
Sbjct  311   AIGKGCKRLKNLTLSDCYFLSDKGLEAVAIGCTELTHLEVNGCHNIGTFGLESIGRSCVS  370

Query  912   LEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKD  1091
             L +L L  C  I N  L  I   C  L +L +  C +IG++ + +I + C  L+ L I+ 
Sbjct  371   LSELALLYCQKIGNFALSEIGRGCKFLQALHLVDCSSIGDDAIISIAKGCRNLKKLHIRR  430

Query  1092  CPLVGDQG  1115
             C  VG +G
Sbjct  431   CYEVGSEG  438


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 114/285 (40%), Gaps = 45/285 (16%)
 Frame = +3

Query  426   ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGA  605
             +LPDE + EIFR L     R +A+ V KRWL L    R++    +    D  +   ++  
Sbjct  10    SLPDELILEIFRYLDTKPSRDAASLVCKRWLGLERLSRDTIRIGASGSPD-GLVKMLSSR  68

Query  606   SNDVEMSPADEDLEVECDGYLSRSVEGKKAT----DVRLAAIAVGTSSRGGLGKLCVRGS  773
                V     DE   +       +      +      ++ AA   G               
Sbjct  69    FPHVRNVFIDERRSITLPFQFGKRRRADHSALSPLKLQFAAGKTGPEDY----------E  118

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
                  +++ G++ +G G   L+ LSL    NV   GL  IA +C +L+ LDL  C  + +
Sbjct  119   TETYYLSDAGLAVVGDGFSKLEKLSLIWCSNVTSLGLRSIAEKCNALKSLDLQGC-YVGD  177

Query  954   KGLVAIAERCTN---------------------------LTSLTIESCPNIGNEGLRAIG  1052
             +GL A+ E C                             L SL + +C  I +  L A+G
Sbjct  178   QGLAAVGEWCKQLEDLNLRFCEGLTDTGLVNLALGCRRKLKSLGVAACAKITDVSLEAVG  237

Query  1053  RYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
              YC  L+ L++ D   + ++GV ++      +   +KL  +N+TD
Sbjct  238   SYCLSLETLSL-DSEFIHNKGVLAVAKGCRVLKV-LKLQCINVTD  280


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + GI AI RGCP L  L +  + N+GD  + E+   CP L+ + L  C  I++ GL  
Sbjct  485   IGDAGIIAIARGCPELSYLDVSVLQNLGDMAMAEMGEGCPMLKDIVLSHCRQITDVGLSY  544

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             +  +CT L +  +  CP I   G+  +   C  ++
Sbjct  545   LVRKCTLLETCHMVYCPGITTVGVATVVASCANIK  579


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 1/105 (1%)
 Frame = +3

Query  801   GISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER  980
             GI A+G  C  L  LSL     +GDE L+ I   C SL  L++  C  I + G++AIA  
Sbjct  438   GIVAVGENCKFLTDLSLRFCDKIGDEALVAIG-NCHSLRYLNVSGCHHIGDAGIIAIARG  496

Query  981   CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             C  L+ L +    N+G+  +  +G  C  L+ + +  C  + D G
Sbjct  497   CPELSYLDVSVLQNLGDMAMAEMGEGCPMLKDIVLSHCRQITDVG  541


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 1/103 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I +  + AIG  C SL+ L++    ++GD G++ IAR CP L  LD+    ++ +  +  
Sbjct  460   IGDEALVAIGN-CHSLRYLNVSGCHHIGDAGIIAIARGCPELSYLDVSVLQNLGDMAMAE  518

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCP  1097
             + E C  L  + +  C  I + GL  + R CT L+   +  CP
Sbjct  519   MGEGCPMLKDIVLSHCRQITDVGLSYLVRKCTLLETCHMVYCP  561



>ref|XP_012069471.1| PREDICTED: F-box/LRR-repeat protein 4 isoform X2 [Jatropha curcas]
Length=604

 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 80/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK C R +  A    + I N  +  IG+GC  L+ L L +  ++GD+ +  
Sbjct  353   IGTIGLEAIGKSCPRLTELALLYCQRIGNHALIEIGKGCKFLQALHLVDCSSIGDDAICC  412

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA+ C +L+KL + +C  I NKG++AI E C +LT L++  C  +G+E L AIG+ C+ L
Sbjct  413   IAKGCRNLKKLHIRRCYEIGNKGIIAIGENCKSLTDLSLRFCDRVGDEALIAIGQGCS-L  471

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C L+GD G
Sbjct  472   QQLNVSGCHLIGDDG  486


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I  +G+ AIG+ CP L  L+L     +G+  L+EI + C  L+ L L  C SI +
Sbjct  348   NGCHNIGTIGLEAIGKSCPRLTELALLYCQRIGNHALIEIGKGCKFLQALHLVDCSSIGD  407

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
               +  IA+ C NL  L I  C  IGN+G+ AIG  C  L  L+++ C  VGD+
Sbjct  408   DAICCIAKGCRNLKKLHIRRCYEIGNKGIIAIGENCKSLTDLSLRFCDRVGDE  460


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +T+  + A+G  C SL+VL+L++     D+GL  I   C  L+ L L  C  +S+KGL A
Sbjct  275   VTDEALMAVGTHCLSLEVLALYSFQRFTDKGLRAIGGGCKKLKNLTLSDCYFLSDKGLEA  334

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
             IA  C  LT L +  C NIG  GL AIG+ C +L  L +  C  +G+ 
Sbjct  335   IATGCRELTQLEVNGCHNIGTIGLEAIGKSCPRLTELALLYCQRIGNH  382


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 70/109 (64%), Gaps = 2/109 (2%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             IT++ + A+   C SL+ LSL +  ++ +EG+L +A+ CPSL+ L L QC +++++ L+A
Sbjct  225   ITDISLEAVSSYCKSLESLSL-DSESIHNEGVLSVAQGCPSLKVLKL-QCINVTDEALMA  282

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             +   C +L  L + S     ++GLRAIG  C KL+ LT+ DC  + D+G
Sbjct  283   VGTHCLSLEVLALYSFQRFTDKGLRAIGGGCKKLKNLTLSDCYFLSDKG  331


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +3

Query  711   AAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             A +AVGT        L V    S +  T+ G+ AIG GC  LK L+L +   + D+GL  
Sbjct  279   ALMAVGTHCL----SLEVLALYSFQRFTDKGLRAIGGGCKKLKNLTLSDCYFLSDKGLEA  334

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA  C  L +L++  C +I   GL AI + C  LT L +  C  IGN  L  IG+ C  L
Sbjct  335   IATGCRELTQLEVNGCHNIGTIGLEAIGKSCPRLTELALLYCQRIGNHALIEIGKGCKFL  394

Query  1071  QCLTIKDCPLVGD  1109
             Q L + DC  +GD
Sbjct  395   QALHLVDCSSIGD  407


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 119/279 (43%), Gaps = 38/279 (14%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LPDE + EIFR L     R + + V KRWL L    R +    +  + DL +        
Sbjct  11    LPDELIIEIFRHLDSKGSRDACSLVCKRWLALERLSRTTLRIGASGNPDLFVKLLARRFH  70

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
             N V+    DE   +       R     ++T         G S  G     C         
Sbjct  71    N-VKTIHIDERFSISIPVPFGRKRGSDQSTPPLKLHSEKGVSEGGQFEPYC---------  120

Query  789   ITNVGISAIGRGCPSLKVLSL-WNVP------------------------NVGDEGLLEI  893
             +++ G+SA+G G P L+ LSL W                            VGD GL  I
Sbjct  121   LSDAGLSALGDGFPRLEKLSLIWCSTVSSLGLMSLAYKCSFLVSLDLQGCYVGDNGLAAI  180

Query  894   ARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
              R C  LE L+L  C  +++ GLV +A+ C  +L ++++ +C  I +  L A+  YC  L
Sbjct  181   GRGCKRLEDLNLRFCEGLTDTGLVELAQGCGKSLKTVSVAACAKITDISLEAVSSYCKSL  240

Query  1071  QCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             + L++ D   + ++GV S+     ++   +KL  +N+TD
Sbjct  241   ESLSL-DSESIHNEGVLSVAQGCPSLKV-LKLQCINVTD  277


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 64/128 (50%), Gaps = 7/128 (5%)
 Frame = +3

Query  690   KATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             +  D  L AI  G S    L +L V G +    I + GI+AI RGCP L  L +  + ++
Sbjct  456   RVGDEALIAIGQGCS----LQQLNVSGCHL---IGDDGITAIARGCPELIHLDVSVLQHL  508

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
             GD  + EI   CP L+++ L  C  I++ GL  + + CT L S  +  CP I   G+  +
Sbjct  509   GDMAMAEIGEGCPLLKEIVLSHCREITDVGLSHLVKNCTMLESCHVVYCPGITAAGVATV  568

Query  1050  GRYCTKLQ  1073
                C  ++
Sbjct  569   VSSCPNIK  576


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +3

Query  810   AIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN  989
             AIG+GC SL+ L++     +GD+G+  IAR CP L  LD+     + +  +  I E C  
Sbjct  464   AIGQGC-SLQQLNVSGCHLIGDDGITAIARGCPELIHLDVSVLQHLGDMAMAEIGEGCPL  522

Query  990   LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCP  1097
             L  + +  C  I + GL  + + CT L+   +  CP
Sbjct  523   LKEIVLSHCREITDVGLSHLVKNCTMLESCHVVYCP  558



>ref|XP_010036070.1| PREDICTED: F-box/LRR-repeat protein 4 [Eucalyptus grandis]
 gb|KCW84335.1| hypothetical protein EUGRSUZ_B01185 [Eucalyptus grandis]
Length=609

 Score = 89.0 bits (219),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 0/113 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N   GI  +G+ ++G+ CP+L  L+L     +G   LLEI R C  L+ L L  C  I +
Sbjct  353   NGCHGIGTLGLESVGKSCPNLTELALLYCQRIGGRALLEIGRGCKFLQALHLVDCSIIGD  412

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQ  1112
               +++IA+ C NL  L I  C  IG++ + AIGR+C  L+ L+I+ C  VGD+
Sbjct  413   DAIISIAKGCKNLRRLHIRRCYEIGDKAIVAIGRHCKSLKDLSIRFCDRVGDR  465


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 0/112 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             +S +  T+VG+ ++G GC SLK L+L +   + D GL ++A  C  L  L++  C  I  
Sbjct  301   HSFQRFTDVGLHSVGNGCKSLKSLTLTDCNFLTDNGLGKVATGCKQLTHLEVNGCHGIGT  360

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
              GL ++ + C NLT L +  C  IG   L  IGR C  LQ L + DC ++GD
Sbjct  361   LGLESVGKSCPNLTELALLYCQRIGGRALLEIGRGCKFLQALHLVDCSIIGD  412


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 72/279 (26%), Positives = 119/279 (43%), Gaps = 33/279 (12%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  608
             LPDE + EIF+RL       + + V KRWL L    R +    + S  D      +    
Sbjct  11    LPDELMVEIFQRLGSKSAHDACSLVCKRWLGLERLTRATLRVGASSTSD-RFFKLLAARF  69

Query  609   NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSARG  788
              +V     DE L +     L R     +  D  L  + +   +     +  V   + +  
Sbjct  70    TNVRNVHVDERLSISLPARLGRRRRNDQFADPALLFLRMHEETE----RKSVADVSESSS  125

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPN-------------------------VGDEGLLEI  893
             +++ G++ +G G P ++ LSL    N                         VGD+GL  +
Sbjct  126   LSDDGLAVLGEGFPKMEKLSLIWCSNISSVGLRSLAERCMFLKSLDLQGCYVGDQGLAAV  185

Query  894   ARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
                C  LE+L+L  C  +++KGLV +   C  +L SL I +C  + +  L A+G +C  L
Sbjct  186   GECCKQLEELNLRFCEGLTDKGLVQLTAGCGRSLKSLGIAACAKMTDASLEAVGSHCQYL  245

Query  1071  QCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             + L++ D   + D G+ S+      +   +KLH  N+TD
Sbjct  246   ETLSL-DSEFMHDIGLLSVARGCHYLKV-LKLHCANVTD  282


 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 59/101 (58%), Gaps = 1/101 (1%)
 Frame = +3

Query  813   IGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNL  992
             IGRGC  L+ L L +   +GD+ ++ IA+ C +L +L + +C  I +K +VAI   C +L
Sbjct  392   IGRGCKFLQALHLVDCSIIGDDAIISIAKGCKNLRRLHIRRCYEIGDKAIVAIGRHCKSL  451

Query  993   TSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               L+I  C  +G+  L AIG+ C+ L  L +  C  +GD G
Sbjct  452   KDLSIRFCDRVGDRALIAIGKGCS-LTDLNVSGCHQIGDPG  491


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +T+  +  +GR C SL+ L+L +     D GL  +   C SL+ L L  C  +++ GL  
Sbjct  280   VTDETLRTVGRCCLSLEELALHSFQRFTDVGLHSVGNGCKSLKSLTLTDCNFLTDNGLGK  339

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVG  1106
             +A  C  LT L +  C  IG  GL ++G+ C  L  L +  C  +G
Sbjct  340   VATGCKQLTHLEVNGCHGIGTLGLESVGKSCPNLTELALLYCQRIG  385


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 58/109 (53%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             + ++G+ ++ RGC  LKVL L +  NV DE L  + R C SLE+L L      ++ GL +
Sbjct  255   MHDIGLLSVARGCHYLKVLKL-HCANVTDETLRTVGRCCLSLEELALHSFQRFTDVGLHS  313

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             +   C +L SLT+  C  + + GL  +   C +L  L +  C  +G  G
Sbjct  314   VGNGCKSLKSLTLTDCNFLTDNGLGKVATGCKQLTHLEVNGCHGIGTLG  362


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 1/102 (1%)
 Frame = +3

Query  810   AIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN  989
             AIG+GC SL  L++     +GD G++ IAR CP L  LD+     + +  L  + E C  
Sbjct  469   AIGKGC-SLTDLNVSGCHQIGDPGIIAIARGCPQLRSLDVSVLQRLGDIALAKLGEGCPL  527

Query  990   LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             L  + I  C  I + GL  + R C+ L+   +  C  +   G
Sbjct  528   LREIIISHCRYITDAGLSHLVRNCSMLETCHMVYCHGITSAG  569



>ref|XP_010434975.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform X1 [Camelina 
sativa]
 ref|XP_010434976.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform X2 [Camelina 
sativa]
 ref|XP_010434977.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform X3 [Camelina 
sativa]
Length=610

 Score = 89.0 bits (219),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 78/135 (58%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK C R +  A    + I N  +  IG+GC SL++L L +   +GD  +  
Sbjct  359   IGTHGLEAIGKSCSRLNELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGDNAMCS  418

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA+ C +L+KL + +C  I NKG++A+ + C +LT L++  C  +G+E L AIG+ C+ L
Sbjct  419   IAKGCRNLKKLHIRRCYEIGNKGIIAVGKHCKSLTELSVRFCDKVGDEALIAIGKGCS-L  477

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  + D G
Sbjct  478   QQLNVSGCNHISDAG  492


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +3

Query  774   NSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISN  953
             N    I   G+ AIG+ C  L  L+L     +G+  L EI + C SLE L L  C  I +
Sbjct  354   NGCHNIGTHGLEAIGKSCSRLNELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGD  413

Query  954   KGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
               + +IA+ C NL  L I  C  IGN+G+ A+G++C  L  L+++ C  VGD+ 
Sbjct  414   NAMCSIAKGCRNLKKLHIRRCYEIGNKGIIAVGKHCKSLTELSVRFCDKVGDEA  467


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 90/189 (48%), Gaps = 17/189 (9%)
 Frame = +3

Query  573   DLSIADKVNGASND-----VEMSPADEDLEVECDGYLSRSVE-----GKKATDVRLAAIA  722
             D+   D V G +N      V  S    DL +E  G   + +E      +   D  L A+A
Sbjct  206   DVGFIDLVVGRANSLKSIRVAASAKITDLSMEAVGSHCKLLEVLFLDSECIHDKGLIAVA  265

Query  723   VGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARE  902
              G +    L   CV        +T+   SA+G  C SL+ L+L++  +  D+G+  I + 
Sbjct  266   QGCNRLKDLSLQCVL-------LTDKAFSAVGDLCTSLERLALYSFQHFSDKGMRAIGKG  318

Query  903   CPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLT  1082
             C  L+ L L  C  +S KGL AIA  C  LT + I  C NIG  GL AIG+ C++L  L 
Sbjct  319   CKMLKNLSLSDCSFLSCKGLEAIANGCKELTRVEINGCHNIGTHGLEAIGKSCSRLNELA  378

Query  1083  IKDCPLVGD  1109
             +  C  +G+
Sbjct  379   LLYCQRIGN  387


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 81/165 (49%), Gaps = 7/165 (4%)
 Frame = +3

Query  642   LEVEC---DGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVR----GSNSARGITNV  800
             L+ EC    G ++ +    +  D+ L  + +   +   +G LC         S +  ++ 
Sbjct  251   LDSECIHDKGLIAVAQGCNRLKDLSLQCVLLTDKAFSAVGDLCTSLERLALYSFQHFSDK  310

Query  801   GISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAER  980
             G+ AIG+GC  LK LSL +   +  +GL  IA  C  L ++++  C +I   GL AI + 
Sbjct  311   GMRAIGKGCKMLKNLSLSDCSFLSCKGLEAIANGCKELTRVEINGCHNIGTHGLEAIGKS  370

Query  981   CTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             C+ L  L +  C  IGN  L+ IG+ C  L+ L + DC  +GD  
Sbjct  371   CSRLNELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGDNA  415


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 68/133 (51%), Gaps = 7/133 (5%)
 Frame = +3

Query  690   KATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             K  D  L AI  G S    L +L V G N    I++ GI AI +GCP L  L +  + N+
Sbjct  462   KVGDEALIAIGKGCS----LQQLNVSGCNH---ISDAGILAIAKGCPQLTHLDISVLQNI  514

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
             GD  L E+   CP L+ L L  C +I++ GL  + + CT L S  +  CP I + G+  +
Sbjct  515   GDMALAELGEGCPMLKDLVLSHCHNITDTGLNHLVQNCTLLESCHMVYCPGITSAGVATV  574

Query  1050  GRYCTKLQCLTIK  1088
                C  ++ + I+
Sbjct  575   VSSCPHIKKVLIE  587


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 72/118 (61%), Gaps = 3/118 (3%)
 Frame = +3

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
             +R + SA+ IT++ + A+G  C  L+VL L +   + D+GL+ +A+ C  L+ L L QC 
Sbjct  223   IRVAASAK-ITDLSMEAVGSHCKLLEVLFL-DSECIHDKGLIAVAQGCNRLKDLSL-QCV  279

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              +++K   A+ + CT+L  L + S  +  ++G+RAIG+ C  L+ L++ DC  +  +G
Sbjct  280   LLTDKAFSAVGDLCTSLERLALYSFQHFSDKGMRAIGKGCKMLKNLSLSDCSFLSCKG  337


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  864   NVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLR  1043
             ++ D GL  +A   P LE L L  CP++S+ G+ ++AE+C +L SL ++ C  +G++GL 
Sbjct  126   SLADAGLTALANGFPRLENLSLIWCPNVSSFGMCSLAEKCASLRSLDLQGCF-VGDQGLA  184

Query  1044  AIGRYCTKLQCLTIKDCPLVGDQG  1115
             A+G++C +L+ L ++ C  V D G
Sbjct  185   AVGKFCKQLEDLNLRFCEGVTDVG  208


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 89/213 (42%), Gaps = 23/213 (11%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNS---------EIFRSKSHQDLS  581
             LP+E + EIFRRL     R + + V KRWL L    R +         E F S S + L 
Sbjct  11    LPEELILEIFRRLESKPSRDACSLVCKRWLSLERFSRTTLRIGASISPEEFFSLSRRFLH  70

Query  582   IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLC  761
             I                DE L V     LS S   K+  +    + +       G  +  
Sbjct  71    ITS-----------IHVDERLSVTLPS-LSPSPTRKRGRNSSSPSSSSKRKKLNGKTQSV  118

Query  762   VRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCP  941
                  S   + + G++A+  G P L+ LSL   PNV   G+  +A +C SL  LDL  C 
Sbjct  119   AENVESC-SLADAGLTALANGFPRLENLSLIWCPNVSSFGMCSLAEKCASLRSLDLQGC-  176

Query  942   SISNKGLVAIAERCTNLTSLTIESCPNIGNEGL  1040
              + ++GL A+ + C  L  L +  C  + + G 
Sbjct  177   FVGDQGLAAVGKFCKQLEDLNLRFCEGVTDVGF  209


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 5/133 (4%)
 Frame = +3

Query  717   IAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIA  896
             IAVG   +  L +L VR  +    + +  + AIG+GC SL+ L++    ++ D G+L IA
Sbjct  443   IAVGKHCKS-LTELSVRFCDK---VGDEALIAIGKGC-SLQQLNVSGCNHISDAGILAIA  497

Query  897   RECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQC  1076
             + CP L  LD+    +I +  L  + E C  L  L +  C NI + GL  + + CT L+ 
Sbjct  498   KGCPQLTHLDISVLQNIGDMALAELGEGCPMLKDLVLSHCHNITDTGLNHLVQNCTLLES  557

Query  1077  LTIKDCPLVGDQG  1115
               +  CP +   G
Sbjct  558   CHMVYCPGITSAG  570



>emb|CDY45764.1| BnaC02g42180D [Brassica napus]
Length=583

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 111/233 (48%), Gaps = 23/233 (10%)
 Frame = +3

Query  423   EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  602
             +AL D+ L  I  RL   +++     V KRWL L S+ R     R+  H    +A +   
Sbjct  186   DALTDDELRWILSRLDTEKDKEVFGLVCKRWLYLQSTDRKKLAARAGPHMLGRLASRFTR  245

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSN--  776
                          +E++    +SRS      TD  LA IA G          C+R  N  
Sbjct  246   I------------VELDLSQSVSRSFY-PGVTDSDLAVIAEGFK--------CLRVLNLH  284

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             + +GIT+ G+++IGR    L+ L +     + D+GL  +A  C  L  L L  C  I+++
Sbjct  285   TCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDE  344

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L ++++RC +L +L ++ C NI + GL  + + C K++ L I  C  VGD G
Sbjct  345   TLKSLSQRCRDLEALGLQGCTNITDSGLADLVKGCRKIKALDINKCSNVGDAG  397



>gb|KDO74919.1| hypothetical protein CISIN_1g007312mg [Citrus sinensis]
Length=448

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 78/135 (58%), Gaps = 5/135 (4%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSNSA----RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLE  890
             +GT     +GK C   +  A    + I N+ +  +GRGC SL+ L L +  ++GD+ +  
Sbjct  197   IGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGDDAICS  256

Query  891   IARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKL  1070
             IA  C +L+KL + +C  I N G+VA+ E C +LT L++  C  +G+E L +IG+ C+ L
Sbjct  257   IAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGCS-L  315

Query  1071  QCLTIKDCPLVGDQG  1115
             Q L +  C  +GD G
Sbjct  316   QHLNVSGCHQIGDAG  330


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 73/139 (53%), Gaps = 6/139 (4%)
 Frame = +3

Query  696   TDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNVGD  875
             +D+ L AIA G      L        N    I  +G+ +IG+ C +L  L+L     +G+
Sbjct  172   SDMGLEAIATGCKELTHLE------INGCHNIGTMGLESIGKFCRNLTELALLYCQRIGN  225

Query  876   EGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAIGR  1055
               LLE+ R C SL+ L L  C SI +  + +IAE C NL  L I  C  IGN G+ A+G 
Sbjct  226   LALLEVGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGE  285

Query  1056  YCTKLQCLTIKDCPLVGDQ  1112
             +C  L  L+++ C  VGD+
Sbjct  286   HCNSLTELSLRFCDRVGDE  304


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 61/111 (55%), Gaps = 0/111 (0%)
 Frame = +3

Query  777   SARGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNK  956
             S +  T+ G+ A+G+GC  LK L+L +   + D GL  IA  C  L  L++  C +I   
Sbjct  141   SFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTM  200

Query  957   GLVAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             GL +I + C NLT L +  C  IGN  L  +GR C  LQ L + DC  +GD
Sbjct  201   GLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGD  251


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 0/107 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             +T+  + A+G  C SL++L+L++     D+GL  + + C  L+ L L  C  +S+ GL A
Sbjct  119   VTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEA  178

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGD  1109
             IA  C  LT L I  C NIG  GL +IG++C  L  L +  C  +G+
Sbjct  179   IATGCKELTHLEINGCHNIGTMGLESIGKFCRNLTELALLYCQRIGN  225


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 71/142 (50%), Gaps = 8/142 (6%)
 Frame = +3

Query  690   KATDVRLAAIAVGTSSRGGLGKLCVRGSNSARGITNVGISAIGRGCPSLKVLSLWNVPNV  869
             K TDV L A+     S   L       S  +  I N G+ A+ +GCP L+VL L  + NV
Sbjct  68    KITDVSLEAVGSHCKSLETL-------SLDSEFIHNKGVHAVAQGCPLLRVLKLQCI-NV  119

Query  870   GDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTNLTSLTIESCPNIGNEGLRAI  1049
              DE L+ +  +C SLE L L      ++KGL A+ + C  L +LT+  C  + + GL AI
Sbjct  120   TDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAI  179

Query  1050  GRYCTKLQCLTIKDCPLVGDQG  1115
                C +L  L I  C  +G  G
Sbjct  180   ATGCKELTHLEINGCHNIGTMG  201


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (1%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I N GI A+G  C SL  LSL     VGDE L+ I + C SL+ L++  C  I + G++A
Sbjct  275   IGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGC-SLQHLNVSGCHQIGDAGIMA  333

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
             IA+ C  L  L +    N+G++ +  +G+ C  L+ + +  C  + D G
Sbjct  334   IAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVVLSHCRQITDVG  382


 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 0/95 (0%)
 Frame = +3

Query  789   ITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVA  968
             I + GI AI +GCP L  L +  + N+GD+ ++E+ + CP L+ + L  C  I++ GL  
Sbjct  326   IGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVVLSHCRQITDVGLSH  385

Query  969   IAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQ  1073
             + + C  L S  +  CP I   G+  +   C  ++
Sbjct  386   LVKNCRMLESCHMVYCPGITAAGVATVVSGCANIK  420


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 71/160 (44%), Gaps = 29/160 (18%)
 Frame = +3

Query  723   VGTSSRGGLGKLCVRGSN----SARGITNVGISAIGRGC-PSLKVLSLWNVPNVGDEGLL  887
             VG      +GK+C +  +       G+T+ G+  +  GC  SLK L +     + D  L 
Sbjct  16    VGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLE  75

Query  888   EIARECPSLEKLDL------------------------CQCPSISNKGLVAIAERCTNLT  995
              +   C SLE L L                         QC +++++ LVA+  +C +L 
Sbjct  76    AVGSHCKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQCLSLE  135

Query  996   SLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              L + S     ++GL A+G+ C KL+ LT+ DC  + D G
Sbjct  136   LLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMG  175


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 3/108 (3%)
 Frame = +3

Query  867   VGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERC-TNLTSLTIESCPNIGNEGLR  1043
             VGD+GL  + + C  LE L+L  C  +++ GLV +A  C  +L SL I +C  I +  L 
Sbjct  16    VGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLE  75

Query  1044  AIGRYCTKLQCLTIKDCPLVGDQGvasllssasavlTKVKLHALNITD  1187
             A+G +C  L+ L++ D   + ++GV ++      +   +KL  +N+TD
Sbjct  76    AVGSHCKSLETLSL-DSEFIHNKGVHAVAQGCPLLRV-LKLQCINVTD  121


 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +3

Query  810   AIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGLVAIAERCTN  989
             +IG+GC SL+ L++     +GD G++ IA+ CP L  LD+    ++ ++ +V + + C  
Sbjct  308   SIGQGC-SLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPL  366

Query  990   LTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCP  1097
             L  + +  C  I + GL  + + C  L+   +  CP
Sbjct  367   LKDVVLSHCRQITDVGLSHLVKNCRMLESCHMVYCP  402



>ref|XP_001630901.1| predicted protein [Nematostella vectensis]
 gb|EDO38838.1| predicted protein, partial [Nematostella vectensis]
Length=225

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 112/231 (48%), Gaps = 19/231 (8%)
 Frame = +3

Query  429   LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVR--NSEIFRSKSHQDLSIADKVNG  602
             LPD+   +IF   S  +ER+S A V + W +L    R   +  FRS  H    I DK+  
Sbjct  1     LPDDIWLQIFSYFSV-KERASLARVCREWNILCRDSRFWGAVDFRS-CHVSGEITDKI--  56

Query  603   ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGTSSRGGLGKLCVRGSNSA  782
                 VE S      ++    + S+       TD  L  +A   +   GL +L + G +  
Sbjct  57    ----VE-SVVAYSCKIRIIDFSSKRCHA--VTDTSLTHVA---NHCPGLQRLNLTGKSL-  105

Query  783   RGITNVGISAIGRGCPSLKVLSLWNVPNVGDEGLLEIARECPSLEKLDLCQCPSISNKGL  962
               ITN G+ AI R C  L+ L L     V D G+  +A +CP LEKL L  C  +++K L
Sbjct  106   --ITNRGLGAIARSCGDLEQLFLSGCSRVSDRGVRTLASKCPKLEKLSLSNCLRLTDKSL  163

Query  963   VAIAERCTNLTSLTIESCPNIGNEGLRAIGRYCTKLQCLTIKDCPLVGDQG  1115
              AI+ +C++L +L +  C  I + G++A+ RY   L  + +KD   +  +G
Sbjct  164   SAISRKCSSLKTLDLSGCVKITDRGIKALSRYSEHLTDINLKDTTGISIEG  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3300232503505