BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4709

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009363399.1|  PREDICTED: 40S ribosomal protein S10             52.4    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_011654726.1|  PREDICTED: 40S ribosomal protein S10-like        51.2    4e-05   Cucumis sativus [cucumbers]
gb|EYU19583.1|  hypothetical protein MIMGU_mgv1a014799mg              50.4    8e-05   Erythranthe guttata [common monkey flower]
gb|AEZ52389.1|  40S ribosomal protein S10                             50.1    1e-04   Wolffia australiana
ref|NP_001275161.1|  40S ribosomal protein S10-like                   48.5    5e-04   Solanum tuberosum [potatoes]
ref|XP_004230234.1|  PREDICTED: 40S ribosomal protein S10-like        48.5    5e-04   Solanum lycopersicum
ref|XP_011076103.1|  PREDICTED: 40S ribosomal protein S10             48.1    5e-04   Sesamum indicum [beniseed]
ref|NP_001275178.1|  40S ribosomal protein S10-like                   48.1    5e-04   Solanum tuberosum [potatoes]
ref|XP_009622519.1|  PREDICTED: 40S ribosomal protein S10-like        48.1    6e-04   Nicotiana tomentosiformis
ref|XP_004253050.1|  PREDICTED: 40S ribosomal protein S10             48.1    6e-04   Solanum lycopersicum
ref|XP_008452010.1|  PREDICTED: 40S ribosomal protein S10-1-like      48.1    6e-04   Cucumis melo [Oriental melon]
ref|XP_004146529.1|  PREDICTED: 40S ribosomal protein S10-1-like      48.1    6e-04   Cucumis sativus [cucumbers]
ref|XP_009779518.1|  PREDICTED: 40S ribosomal protein S10-like        48.1    6e-04   Nicotiana sylvestris
gb|KHG15544.1|  40S ribosomal S10-3 -like protein                     48.1    6e-04   Gossypium arboreum [tree cotton]
gb|EPS62993.1|  hypothetical protein M569_11795                       48.1    6e-04   Genlisea aurea
gb|KJB37391.1|  hypothetical protein B456_006G208700                  48.1    7e-04   Gossypium raimondii
gb|KJB37392.1|  hypothetical protein B456_006G208700                  47.0    7e-04   Gossypium raimondii
ref|XP_011084461.1|  PREDICTED: 40S ribosomal protein S10-like        48.1    7e-04   Sesamum indicum [beniseed]
gb|KJB24308.1|  hypothetical protein B456_004G138400                  48.1    7e-04   Gossypium raimondii
gb|KHG23176.1|  40S ribosomal S10-3 -like protein                     48.1    7e-04   Gossypium arboreum [tree cotton]
emb|CDP04851.1|  unnamed protein product                              47.0    7e-04   Coffea canephora [robusta coffee]
gb|EYU19584.1|  hypothetical protein MIMGU_mgv1a014799mg              47.4    0.001   Erythranthe guttata [common monkey flower]
gb|EYU19582.1|  hypothetical protein MIMGU_mgv1a014799mg              47.8    0.001   Erythranthe guttata [common monkey flower]
gb|EYU25149.1|  hypothetical protein MIMGU_mgv1a014769mg              47.4    0.001   Erythranthe guttata [common monkey flower]



>ref|XP_009363399.1| PREDICTED: 40S ribosomal protein S10 [Pyrus x bretschneideri]
Length=180

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 6/74 (8%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +SL+ K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A  A    
Sbjct  43   IKLMQSLKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQAKPA--GR  100

Query  431  PM----DRPYCSTR  460
            PM    DRP   +R
Sbjct  101  PMGLSGDRPRGPSR  114



>ref|XP_011654726.1| PREDICTED: 40S ribosomal protein S10-like [Cucumis sativus]
 gb|KGN50065.1| hypothetical protein Csa_5G152800 [Cucumis sativus]
Length=179

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 6/79 (8%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQAK------  96

Query  431  PMDRPYCSTRTTRYLLMAR  487
            P  RP+      R    +R
Sbjct  97   PAGRPFGGPSGDRPRGPSR  115



>gb|EYU19583.1| hypothetical protein MIMGU_mgv1a014799mg [Erythranthe guttata]
Length=174

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (52%), Gaps = 3/77 (4%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKA---S*AL  421
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A      +
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPLGRPM  102

Query  422  IDNPMDRPYCSTRTTRY  472
               P DRP       R+
Sbjct  103  GGPPGDRPRFEGERPRF  119



>gb|AEZ52389.1| 40S ribosomal protein S10 [Wolffia australiana]
Length=179

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 3/79 (4%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  K++  +   
Sbjct  43   IKLMQSFKSKEYVRKTFGWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLK-KSAKPIPSR  101

Query  431  PMDRPYCSTRTTRYLLMAR  487
            PM  P    R  R L   R
Sbjct  102  PMGGP--GDRPPRRLDGDR  118



>ref|NP_001275161.1| 40S ribosomal protein S10-like [Solanum tuberosum]
 gb|ABB55398.1| 40S ribosomal protein S10-like [Solanum tuberosum]
Length=182

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>ref|XP_004230234.1| PREDICTED: 40S ribosomal protein S10-like [Solanum lycopersicum]
Length=182

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>ref|XP_011076103.1| PREDICTED: 40S ribosomal protein S10 [Sesamum indicum]
Length=177

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>ref|NP_001275178.1| 40S ribosomal protein S10-like [Solanum tuberosum]
 gb|ABB55361.1| 40S ribosomal protein S10-like [Solanum tuberosum]
 gb|ABB72819.1| 40S ribosomal protein S10-like protein [Solanum tuberosum]
Length=180

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>ref|XP_009622519.1| PREDICTED: 40S ribosomal protein S10-like [Nicotiana tomentosiformis]
Length=181

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>ref|XP_004253050.1| PREDICTED: 40S ribosomal protein S10 [Solanum lycopersicum]
Length=180

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>ref|XP_008452010.1| PREDICTED: 40S ribosomal protein S10-1-like [Cucumis melo]
Length=182

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 6/66 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQA------K  96

Query  431  PMDRPY  448
            P  RP+
Sbjct  97   PAGRPF  102



>ref|XP_004146529.1| PREDICTED: 40S ribosomal protein S10-1-like [Cucumis sativus]
 gb|KGN53350.1| hypothetical protein Csa_4G049090 [Cucumis sativus]
Length=182

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 6/66 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQA------K  96

Query  431  PMDRPY  448
            P  RP+
Sbjct  97   PAGRPF  102



>ref|XP_009779518.1| PREDICTED: 40S ribosomal protein S10-like [Nicotiana sylvestris]
Length=181

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>gb|KHG15544.1| 40S ribosomal S10-3 -like protein [Gossypium arboreum]
Length=177

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQA------K  96

Query  431  PMDRP  445
            P  RP
Sbjct  97   PAGRP  101



>gb|EPS62993.1| hypothetical protein M569_11795, partial [Genlisea aurea]
Length=176

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  42   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  95

Query  431  PMDRP  445
            P+ RP
Sbjct  96   PIGRP  100



>gb|KJB37391.1| hypothetical protein B456_006G208700 [Gossypium raimondii]
Length=177

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQA------K  96

Query  431  PMDRP  445
            P  RP
Sbjct  97   PAGRP  101



>gb|KJB37392.1| hypothetical protein B456_006G208700 [Gossypium raimondii]
Length=132

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 6/61 (10%)
 Frame = +2

Query  263  KSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDNPMDR  442
            +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A       P  R
Sbjct  2    QSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQA------KPAGR  55

Query  443  P  445
            P
Sbjct  56   P  56



>ref|XP_011084461.1| PREDICTED: 40S ribosomal protein S10-like [Sesamum indicum]
Length=178

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------R  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>gb|KJB24308.1| hypothetical protein B456_004G138400 [Gossypium raimondii]
Length=180

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQA------K  96

Query  431  PMDRP  445
            P  RP
Sbjct  97   PAGRP  101



>gb|KHG23176.1| 40S ribosomal S10-3 -like protein [Gossypium arboreum]
Length=180

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++  +A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQA------K  96

Query  431  PMDRP  445
            P  RP
Sbjct  97   PAGRP  101



>emb|CDP04851.1| unnamed protein product [Coffea canephora]
Length=130

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 6/61 (10%)
 Frame = +2

Query  263  KSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDNPMDR  442
            +S + K+ V+ T+ WMHY  +LTND IEF  T LN+  E +  ++   A       P+DR
Sbjct  2    QSFKSKENVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIILATLKKSA------KPLDR  55

Query  443  P  445
            P
Sbjct  56   P  56



>gb|EYU19584.1| hypothetical protein MIMGU_mgv1a014799mg [Erythranthe guttata]
Length=162

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>gb|EYU19582.1| hypothetical protein MIMGU_mgv1a014799mg [Erythranthe guttata]
Length=178

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



>gb|EYU25149.1| hypothetical protein MIMGU_mgv1a014769mg [Erythranthe guttata]
Length=179

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  251  VILCKSLRLKDFVKVTYFWMHYICHLTNDRIEFFITKLNILLENVFLSISYKAS*ALIDN  430
            + L +S + K++V+ T+ WMHY  +LTND IEF  T LN+  E V  ++   A       
Sbjct  43   IKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSA------K  96

Query  431  PMDRP  445
            P+ RP
Sbjct  97   PLGRP  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 655681405646