BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4651

Length=710
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593351.1|  PREDICTED: TBC1 domain family member 15 isof...    185   5e-51   
ref|XP_009593350.1|  PREDICTED: TBC1 domain family member 17 isof...    186   7e-51   Nicotiana tomentosiformis
ref|XP_009789610.1|  PREDICTED: TBC1 domain family member 15-like...    184   1e-50   Nicotiana sylvestris
ref|XP_009593349.1|  PREDICTED: TBC1 domain family member 17 isof...    185   1e-50   Nicotiana tomentosiformis
ref|XP_009789609.1|  PREDICTED: TBC1 domain family member 17-like...    184   2e-50   Nicotiana sylvestris
ref|XP_012081206.1|  PREDICTED: GTPase-activating protein gyp7 is...    184   2e-50   
ref|XP_009789608.1|  PREDICTED: TBC1 domain family member 17-like...    184   3e-50   Nicotiana sylvestris
ref|XP_012081204.1|  PREDICTED: TBC1 domain family member 15 isof...    184   4e-50   Jatropha curcas
ref|XP_010241555.1|  PREDICTED: TBC1 domain family member 17 isof...    184   5e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010241554.1|  PREDICTED: TBC1 domain family member 17 isof...    183   8e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010656459.1|  PREDICTED: TBC1 domain family member 17 isof...    181   5e-49   Vitis vinifera
ref|XP_010323291.1|  PREDICTED: GTPase-activating protein gyp7          180   1e-48   Solanum lycopersicum
ref|XP_010656458.1|  PREDICTED: GTPase-activating protein GYP7 is...    180   1e-48   Vitis vinifera
ref|XP_007013520.1|  RabGAP/TBC domain-containing protein isoform 1     179   3e-48   
ref|XP_006358298.1|  PREDICTED: GTPase-activating protein gyp7-like     176   4e-47   Solanum tuberosum [potatoes]
gb|KJB27075.1|  hypothetical protein B456_004G276400                    174   6e-47   Gossypium raimondii
emb|CDP10442.1|  unnamed protein product                                175   7e-47   Coffea canephora [robusta coffee]
gb|KJB27076.1|  hypothetical protein B456_004G276400                    174   1e-46   Gossypium raimondii
gb|KJB27077.1|  hypothetical protein B456_004G276400                    173   2e-46   Gossypium raimondii
gb|KJB27079.1|  hypothetical protein B456_004G276400                    173   2e-46   Gossypium raimondii
gb|KDO80156.1|  hypothetical protein CISIN_1g005652mg                   172   5e-46   Citrus sinensis [apfelsine]
ref|XP_006345222.1|  PREDICTED: TBC1 domain family member 15-like       172   7e-46   Solanum tuberosum [potatoes]
gb|KHG01737.1|  TBC1 domain family member 15                            172   8e-46   Gossypium arboreum [tree cotton]
ref|XP_009758337.1|  PREDICTED: TBC1 domain family member 15-like       170   3e-45   Nicotiana sylvestris
ref|XP_004251725.1|  PREDICTED: TBC1 domain family member 17-like       169   6e-45   Solanum lycopersicum
ref|XP_010241556.1|  PREDICTED: TBC1 domain family member 15 isof...    169   6e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010112474.1|  TBC1 domain family member 15                       167   1e-44   
ref|XP_009624893.1|  PREDICTED: TBC1 domain family member 15-like       168   1e-44   Nicotiana tomentosiformis
ref|XP_011084120.1|  PREDICTED: TBC1 domain family member 15            168   2e-44   Sesamum indicum [beniseed]
gb|AIU48658.1|  RabGAP/TBC domain-containing protein                    167   2e-44   Buxus sinica
ref|XP_007013521.1|  RabGAP/TBC domain-containing protein isoform 2     167   3e-44   
gb|AIU48685.1|  RabGAP/TBC domain-containing protein                    164   4e-44   Platanus x hispanica [London plane tree]
gb|AIU48651.1|  RabGAP/TBC domain-containing protein                    167   4e-44   Gossypium raimondii
gb|AIU48643.1|  RabGAP/TBC domain-containing protein                    166   5e-44   Magnolia denudata [haku-mokuren]
ref|XP_002285365.1|  PREDICTED: TBC1 domain family member 17 isof...    167   5e-44   Vitis vinifera
gb|KJB64720.1|  hypothetical protein B456_010G061900                    166   6e-44   Gossypium raimondii
gb|AIU48681.1|  RabGAP/TBC domain-containing protein                    166   6e-44   Vitis vinifera
gb|AIU48647.1|  RabGAP/TBC domain-containing protein                    165   2e-43   Theobroma cacao [chocolate]
gb|KJB64721.1|  hypothetical protein B456_010G061900                    164   2e-43   Gossypium raimondii
gb|AIU48652.1|  RabGAP/TBC domain-containing protein                    165   2e-43   Carica papaya [mamon]
gb|KJB64719.1|  hypothetical protein B456_010G061900                    165   2e-43   Gossypium raimondii
gb|AIU48669.1|  RabGAP/TBC domain-containing protein                    164   3e-43   Erythranthe guttata [common monkey flower]
gb|EYU18249.1|  hypothetical protein MIMGU_mgv1a002604mg                164   3e-43   Erythranthe guttata [common monkey flower]
gb|AIU48684.1|  RabGAP/TBC domain-containing protein                    164   3e-43   Cinnamomum camphora
ref|XP_007155039.1|  hypothetical protein PHAVU_003G167800g             164   5e-43   Phaseolus vulgaris [French bean]
ref|XP_004508469.1|  PREDICTED: TBC1 domain family member 17-like...    162   9e-43   
ref|XP_012081205.1|  PREDICTED: TBC1 domain family member 15 isof...    163   1e-42   Jatropha curcas
ref|XP_008456989.1|  PREDICTED: TBC1 domain family member 15            162   1e-42   Cucumis melo [Oriental melon]
gb|AIU48673.1|  RabGAP/TBC domain-containing protein                    162   2e-42   Phaseolus vulgaris [French bean]
gb|AIU48663.1|  RabGAP/TBC domain-containing protein                    156   2e-42   Pandanus utilis
gb|AIU48687.1|  RabGAP/TBC domain-containing protein                    162   2e-42   Houttuynia cordata [chameleon-plant]
ref|XP_011020167.1|  PREDICTED: TBC1 domain family member 15            162   2e-42   Populus euphratica
gb|AIU48649.1|  RabGAP/TBC domain-containing protein                    157   3e-42   Sarcandra glabra
ref|XP_004508468.1|  PREDICTED: TBC1 domain family member 17-like...    161   4e-42   Cicer arietinum [garbanzo]
ref|XP_004139297.1|  PREDICTED: TBC1 domain family member 15            161   5e-42   Cucumis sativus [cucumbers]
gb|AIU48639.1|  RabGAP/TBC domain-containing protein                    160   9e-42   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU48660.1|  RabGAP/TBC domain-containing protein                    160   9e-42   Chloranthus japonicus
gb|KDO80165.1|  hypothetical protein CISIN_1g005652mg                   155   2e-41   Citrus sinensis [apfelsine]
ref|XP_003609386.1|  TBC1 domain family member                          159   4e-41   Medicago truncatula
gb|AIU48666.1|  RabGAP/TBC domain-containing protein                    158   4e-41   Medicago truncatula
gb|KDO80163.1|  hypothetical protein CISIN_1g005652mg                   156   6e-41   Citrus sinensis [apfelsine]
ref|XP_009127224.1|  PREDICTED: TBC1 domain family member 15            158   6e-41   Brassica rapa
gb|AIU48656.1|  RabGAP/TBC domain-containing protein                    157   7e-41   Glycine max [soybeans]
gb|AIU48671.1|  RabGAP/TBC domain-containing protein                    157   1e-40   Prunus persica
ref|XP_007204093.1|  hypothetical protein PRUPE_ppa002904mg             157   1e-40   
gb|ACU19099.1|  unknown                                                 152   1e-40   Glycine max [soybeans]
emb|CDY27056.1|  BnaA02g10760D                                          157   1e-40   Brassica napus [oilseed rape]
gb|KDO80162.1|  hypothetical protein CISIN_1g005652mg                   156   1e-40   Citrus sinensis [apfelsine]
gb|KDO80164.1|  hypothetical protein CISIN_1g005652mg                   156   1e-40   Citrus sinensis [apfelsine]
gb|AIU48682.1|  RabGAP/TBC domain-containing protein                    153   1e-40   Lactuca sativa [cultivated lettuce]
gb|AIU48662.1|  RabGAP/TBC domain-containing protein                    157   2e-40   Chimonanthus praecox [wintersweet]
gb|KDO80161.1|  hypothetical protein CISIN_1g005652mg                   156   2e-40   Citrus sinensis [apfelsine]
gb|KDO80160.1|  hypothetical protein CISIN_1g005652mg                   156   2e-40   Citrus sinensis [apfelsine]
gb|AIU48668.1|  RabGAP/TBC domain-containing protein                    156   2e-40   Manihot esculenta [manioc]
gb|KJB27078.1|  hypothetical protein B456_004G276400                    156   3e-40   Gossypium raimondii
ref|XP_008242808.1|  PREDICTED: TBC1 domain family member 17            156   3e-40   Prunus mume [ume]
gb|AIU48654.1|  RabGAP/TBC domain-containing protein                    156   3e-40   Citrus sinensis [apfelsine]
gb|AIU48650.1|  RabGAP/TBC domain-containing protein                    156   3e-40   Citrus clementina [clementine]
ref|XP_006475896.1|  PREDICTED: TBC1 domain family member 17-like       156   3e-40   Citrus sinensis [apfelsine]
ref|XP_006450870.1|  hypothetical protein CICLE_v10007683mg             156   3e-40   Citrus clementina [clementine]
gb|KDO80159.1|  hypothetical protein CISIN_1g005652mg                   155   3e-40   Citrus sinensis [apfelsine]
gb|AIU48648.1|  RabGAP/TBC domain-containing protein                    155   3e-40   Acorus calamus [flagroot]
gb|AIU48659.1|  RabGAP/TBC domain-containing protein                    155   6e-40   Iris japonica
ref|XP_003542634.1|  PREDICTED: TBC1 domain family member 15-like       155   6e-40   Glycine max [soybeans]
gb|AIU48674.1|  RabGAP/TBC domain-containing protein                    148   6e-40   Artemisia annua [sweet Annie]
gb|KHN22122.1|  TBC1 domain family member 15                            155   6e-40   Glycine soja [wild soybean]
gb|AIU48657.1|  RabGAP/TBC domain-containing protein                    155   7e-40   Illicium henryi
gb|KCW80045.1|  hypothetical protein EUGRSUZ_C01375                     154   7e-40   Eucalyptus grandis [rose gum]
gb|AIU48645.1|  RabGAP/TBC domain-containing protein                    155   7e-40   Pinellia ternata
gb|AIU48655.1|  RabGAP/TBC domain-containing protein                    154   8e-40   Eucalyptus grandis [rose gum]
ref|XP_010047970.1|  PREDICTED: TBC1 domain family member 15            155   8e-40   Eucalyptus grandis [rose gum]
gb|AIU48665.1|  RabGAP/TBC domain-containing protein                    154   1e-39   Aristolochia tagala
emb|CDY65323.1|  BnaC02g44880D                                          154   1e-39   Brassica napus [oilseed rape]
ref|XP_008785780.1|  PREDICTED: TBC1 domain family member 15            154   1e-39   Phoenix dactylifera
gb|AIU48675.1|  RabGAP/TBC domain-containing protein                    153   2e-39   Ricinus communis
ref|XP_002527173.1|  conserved hypothetical protein                     153   3e-39   
ref|XP_011017820.1|  PREDICTED: TBC1 domain family member 17-like...    152   4e-39   Populus euphratica
ref|XP_003549744.1|  PREDICTED: TBC1 domain family member 15-like       152   4e-39   
gb|AIU48690.1|  RabGAP/TBC domain-containing protein                    152   4e-39   Trachycarpus fortunei
ref|XP_011017816.1|  PREDICTED: TBC1 domain family member 15-like...    153   5e-39   Populus euphratica
ref|XP_011017818.1|  PREDICTED: TBC1 domain family member 15-like...    152   5e-39   Populus euphratica
ref|XP_006372159.1|  hypothetical protein POPTR_0018s12770g             152   7e-39   
ref|XP_004287286.1|  PREDICTED: TBC1 domain family member 15            152   8e-39   Fragaria vesca subsp. vesca
gb|AIU48670.1|  RabGAP/TBC domain-containing protein                    152   9e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002324638.2|  hypothetical protein POPTR_0018s12770g             152   9e-39   
ref|XP_006855176.1|  PREDICTED: TBC1 domain family member 15 isof...    152   1e-38   Amborella trichopoda
ref|XP_010911930.1|  PREDICTED: TBC1 domain family member 17 isof...    150   1e-38   Elaeis guineensis
gb|AIU48680.1|  RabGAP/TBC domain-containing protein                    151   2e-38   Schrenkiella parvula
ref|XP_009363991.1|  PREDICTED: TBC1 domain family member 15            151   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_010557604.1|  PREDICTED: TBC1 domain family member 15            151   2e-38   Tarenaya hassleriana [spider flower]
gb|AIU48689.1|  RabGAP/TBC domain-containing protein                    150   2e-38   Alisma plantago-aquatica
ref|XP_006401805.1|  hypothetical protein EUTSA_v10012867mg             150   3e-38   Eutrema salsugineum [saltwater cress]
ref|XP_006401806.1|  hypothetical protein EUTSA_v10012867mg             150   3e-38   
ref|XP_008377303.1|  PREDICTED: TBC1 domain family member 17            150   3e-38   
gb|AIU48664.1|  RabGAP/TBC domain-containing protein                    150   4e-38   Asparagus officinalis
gb|AIU48640.1|  RabGAP/TBC domain-containing protein                    149   5e-38   Arabidopsis lyrata [lyrate rockcress]
gb|AIU48677.1|  RabGAP/TBC domain-containing protein                    148   2e-37   Yucca filamentosa [Adam's-needle]
ref|XP_010911929.1|  PREDICTED: TBC1 domain family member 15 isof...    148   2e-37   Elaeis guineensis
gb|AIU48691.1|  RabGAP/TBC domain-containing protein                    145   3e-37   Cabomba caroliniana
gb|AIU48653.1|  RabGAP/TBC domain-containing protein                    147   3e-37   Capsella rubella
gb|AIU48641.1|  RabGAP/TBC domain-containing protein                    147   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011627325.1|  PREDICTED: TBC1 domain family member 15 isof...    147   3e-37   Amborella trichopoda
ref|XP_002864184.1|  hypothetical protein ARALYDRAFT_495330             147   5e-37   Arabidopsis lyrata subsp. lyrata
gb|KJB54007.1|  hypothetical protein B456_009G016100                    146   8e-37   Gossypium raimondii
ref|XP_006280129.1|  hypothetical protein CARUB_v10026023mg             146   8e-37   Capsella rubella
ref|XP_010482626.1|  PREDICTED: TBC1 domain family member 15-like...    146   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010442797.1|  PREDICTED: TBC1 domain family member 15-like       146   9e-37   Camelina sativa [gold-of-pleasure]
ref|NP_200071.2|  RabGAP/TBC domain-containing protein                  146   9e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445073.1|  PREDICTED: TBC1 domain family member 15-like...    146   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010482625.1|  PREDICTED: TBC1 domain family member 15-like...    146   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010482627.1|  PREDICTED: TBC1 domain family member 15-like...    146   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010445069.1|  PREDICTED: TBC1 domain family member 15-like...    146   9e-37   Camelina sativa [gold-of-pleasure]
gb|AIU48661.1|  RabGAP/TBC domain-containing protein                    145   2e-36   Ceratophyllum demersum [hornwort]
ref|XP_011469988.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    144   3e-36   Fragaria vesca subsp. vesca
ref|XP_009420718.1|  PREDICTED: TBC1 domain family member 15            145   3e-36   
ref|XP_008362894.1|  PREDICTED: TBC1 domain family member 17-like       144   4e-36   
gb|AIU48683.1|  RabGAP/TBC domain-containing protein                    144   4e-36   Ceratophyllum platyacanthum subsp. oryzetorum
ref|XP_010687933.1|  PREDICTED: TBC1 domain family member 15 isof...    144   6e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687932.1|  PREDICTED: TBC1 domain family member 15 isof...    144   6e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU48686.1|  RabGAP/TBC domain-containing protein                    143   8e-36   Ginkgo biloba [ginkgo]
gb|KFK26862.1|  hypothetical protein AALP_AA8G303600                    144   9e-36   Arabis alpina [alpine rockcress]
gb|AIU48642.1|  RabGAP/TBC domain-containing protein                    142   2e-35   Lilium brownii [Hong Kong lily]
gb|AIU48688.1|  RabGAP/TBC domain-containing protein                    141   2e-35   Zea mays [maize]
gb|AIU48679.1|  RabGAP/TBC domain-containing protein                    141   5e-35   Sorghum bicolor [broomcorn]
ref|NP_001168835.1|  uncharacterized protein LOC100382640               141   6e-35   Zea mays [maize]
gb|AIU48672.1|  RabGAP/TBC domain-containing protein                    140   7e-35   Panicum virgatum
ref|XP_002452666.1|  hypothetical protein SORBIDRAFT_04g030250          141   8e-35   
gb|AIU48667.1|  RabGAP/TBC domain-containing protein                    140   8e-35   Canna indica [canna]
gb|EEC73873.1|  hypothetical protein OsI_08649                          141   9e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001047892.1|  Os02g0709800                                       140   1e-34   
gb|AIU48676.1|  RabGAP/TBC domain-containing protein                    140   1e-34   Dioscorea oppositifolia
dbj|BAA98077.1|  unnamed protein product                                136   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783529.1|  predicted protein                                  135   2e-33   
ref|XP_006647781.1|  PREDICTED: TBC1 domain family member 15-like       135   5e-33   Oryza brachyantha
gb|AIU48678.1|  RabGAP/TBC domain-containing protein                    135   6e-33   Setaria italica
gb|AIU48646.1|  RabGAP/TBC domain-containing protein                    135   7e-33   Brachypodium distachyon [annual false brome]
ref|XP_004953647.1|  PREDICTED: TBC1 domain family member 15-like       135   8e-33   Setaria italica
ref|NP_001190524.1|  RabGAP/TBC domain-containing protein               135   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570212.1|  PREDICTED: TBC1 domain family member 15            135   2e-32   Brachypodium distachyon [annual false brome]
dbj|BAK05291.1|  predicted protein                                      134   4e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU48644.1|  RabGAP/TBC domain-containing protein                    127   3e-31   Musa acuminata [banana]
gb|KDO80158.1|  hypothetical protein CISIN_1g005652mg                   129   2e-30   Citrus sinensis [apfelsine]
gb|EMT03185.1|  TBC1 domain family member 15                            124   4e-29   
ref|XP_006381119.1|  hypothetical protein POPTR_0006s06520g             105   4e-23   
ref|XP_005649420.1|  RabGAP/TBC                                         100   2e-20   Coccomyxa subellipsoidea C-169
ref|XP_636536.1|  RabGAP/TBC domain-containing protein                  100   2e-20   Dictyostelium discoideum AX4
ref|XP_002673421.1|  rabGTPase-activating protein                     98.6    1e-19   Naegleria gruberi strain NEG-M
ref|XP_003292326.1|  hypothetical protein DICPUDRAFT_89768            98.2    1e-19   Dictyostelium purpureum
ref|XP_002972350.1|  hypothetical protein SELMODRAFT_97576            94.4    3e-19   
ref|XP_004338737.1|  TBC domain containing protein                    94.7    4e-19   Acanthamoeba castellanii str. Neff
ref|XP_007435599.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  94.4    2e-18   
ref|XP_002971826.1|  hypothetical protein SELMODRAFT_96534            92.0    2e-18   
ref|XP_001642096.1|  predicted protein                                93.6    2e-18   Nematostella vectensis
ref|XP_002190300.1|  PREDICTED: TBC1 domain family member 15          94.0    3e-18   Taeniopygia guttata
ref|XP_005242171.1|  PREDICTED: TBC1 domain family member 15          94.0    3e-18   
ref|XP_008327394.1|  PREDICTED: TBC1 domain family member 17          93.6    4e-18   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005991037.1|  PREDICTED: TBC1 domain family member 17          93.6    4e-18   Latimeria chalumnae
ref|XP_005081528.1|  PREDICTED: TBC1 domain family member 15 isof...  93.2    5e-18   Mesocricetus auratus [Syrian golden hamster]
gb|KFZ52722.1|  TBC1 domain family member 15                          92.4    5e-18   Antrostomus carolinensis
ref|XP_010176692.1|  PREDICTED: TBC1 domain family member 15          92.4    6e-18   
ref|XP_005081527.1|  PREDICTED: TBC1 domain family member 15 isof...  93.2    6e-18   Mesocricetus auratus [Syrian golden hamster]
gb|KFZ49120.1|  TBC1 domain family member 15                          93.2    6e-18   Podiceps cristatus
ref|XP_007531341.1|  PREDICTED: TBC1 domain family member 15 isof...  91.3    1e-17   
ref|XP_010123979.1|  PREDICTED: TBC1 domain family member 15          92.4    1e-17   Chlamydotis macqueenii
gb|ERE88321.1|  TBC1 domain family member 15-like protein             92.4    1e-17   Cricetulus griseus [Chinese hamsters]
ref|XP_002406773.1|  rabGAP domain-containing protein, putative       91.7    1e-17   Ixodes scapularis [blacklegged tick]
ref|XP_009975733.1|  PREDICTED: TBC1 domain family member 15          92.0    1e-17   Tauraco erythrolophus
ref|XP_009863167.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  91.7    1e-17   Apaloderma vittatum
ref|XP_007638185.1|  PREDICTED: TBC1 domain family member 15 isof...  92.4    1e-17   
ref|XP_009946918.1|  PREDICTED: TBC1 domain family member 15          92.0    1e-17   Leptosomus discolor
gb|KFP37050.1|  TBC1 domain family member 15                          92.0    1e-17   Chlamydotis macqueenii
ref|XP_010560088.1|  PREDICTED: TBC1 domain family member 15 isof...  92.0    1e-17   Haliaeetus leucocephalus
gb|EOA97812.1|  TBC1 domain family member 15                          92.0    1e-17   Anas platyrhynchos [duck]
ref|XP_009461518.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  92.0    1e-17   Nipponia nippon
ref|XP_011572962.1|  PREDICTED: TBC1 domain family member 15          92.0    1e-17   Aquila chrysaetos canadensis
ref|XP_005024460.1|  PREDICTED: TBC1 domain family member 15          92.0    1e-17   
ref|XP_008938492.1|  PREDICTED: TBC1 domain family member 21          91.7    1e-17   Merops nubicus
ref|XP_009584974.1|  PREDICTED: TBC1 domain family member 15          92.0    1e-17   Fulmarus glacialis
ref|XP_008354495.1|  PREDICTED: GTPase-activating protein gyp7-like   90.1    1e-17   
ref|XP_005358112.1|  PREDICTED: TBC1 domain family member 15 isof...  92.0    1e-17   Microtus ochrogaster [prairie voles]
gb|KFQ18609.1|  TBC1 domain family member 15                          91.7    1e-17   Merops nubicus
gb|KFP24887.1|  TBC1 domain family member 15                          91.3    1e-17   Colius striatus
gb|KGL95544.1|  TBC1 domain family member 15                          92.0    1e-17   Charadrius vociferus
ref|XP_010196615.1|  PREDICTED: TBC1 domain family member 15          91.3    1e-17   Colius striatus
ref|XP_005358111.1|  PREDICTED: TBC1 domain family member 15 isof...  92.0    1e-17   
gb|KFV88938.1|  TBC1 domain family member 15                          92.0    1e-17   Fulmarus glacialis
ref|XP_009504749.1|  PREDICTED: TBC1 domain family member 15          92.0    1e-17   Phalacrocorax carbo [common cormorant]
gb|KFM03402.1|  TBC1 domain family member 15                          92.0    1e-17   Aptenodytes forsteri
ref|XP_009271513.1|  PREDICTED: TBC1 domain family member 15          92.0    1e-17   Aptenodytes forsteri
gb|KFP22081.1|  TBC1 domain family member 15                          91.7    2e-17   Egretta garzetta
ref|XP_009644606.1|  PREDICTED: TBC1 domain family member 15          92.0    2e-17   Egretta garzetta
ref|XP_009085252.1|  PREDICTED: TBC1 domain family member 15          91.7    2e-17   
gb|KFP53694.1|  TBC1 domain family member 15                          91.7    2e-17   Cathartes aura
ref|NP_001072902.1|  TBC1 domain family, member 17                    91.7    2e-17   Xenopus tropicalis [western clawed frog]
dbj|BAE87494.1|  unnamed protein product                              89.4    2e-17   Macaca fascicularis [crab eating macaque]
ref|XP_005480662.1|  PREDICTED: TBC1 domain family member 15          91.7    2e-17   Zonotrichia albicollis
ref|XP_007531340.1|  PREDICTED: TBC1 domain family member 15 isof...  91.3    2e-17   Erinaceus europaeus [common hedgehog]
ref|XP_004602734.1|  PREDICTED: TBC1 domain family member 15 isof...  91.3    2e-17   Sorex araneus [Eurasian shrew]
ref|XP_010078295.1|  PREDICTED: TBC1 domain family member 15          91.3    2e-17   Pterocles gutturalis
ref|XP_007531339.1|  PREDICTED: TBC1 domain family member 15 isof...  91.3    2e-17   Erinaceus europaeus [common hedgehog]
ref|XP_004602733.1|  PREDICTED: TBC1 domain family member 15 isof...  91.3    2e-17   Sorex araneus [Eurasian shrew]
ref|XP_005143065.1|  PREDICTED: TBC1 domain family member 15          91.3    2e-17   Melopsittacus undulatus
ref|XP_009886127.1|  PREDICTED: TBC1 domain family member 15          91.3    3e-17   Charadrius vociferus
gb|KFV12457.1|  TBC1 domain family member 15                          91.3    3e-17   Pterocles gutturalis
dbj|BAE00843.1|  unnamed protein product                              90.1    3e-17   Macaca fascicularis [crab eating macaque]
ref|XP_005795977.1|  PREDICTED: TBC1 domain family member 15-like     90.9    3e-17   Xiphophorus maculatus
ref|XP_006989060.1|  PREDICTED: TBC1 domain family member 15          90.9    3e-17   
ref|XP_008153766.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  91.3    3e-17   
ref|XP_007441051.1|  PREDICTED: TBC1 domain family member 15          90.9    3e-17   Python bivittatus
gb|EFA85722.1|  RabGAP/TBC domain-containing protein                  91.3    3e-17   Heterostelium album PN500
ref|XP_010223867.1|  PREDICTED: TBC1 domain family member 15          90.9    4e-17   Tinamus guttatus
emb|CAF89095.1|  unnamed protein product                              89.4    4e-17   Tetraodon nigroviridis
gb|KGL84754.1|  TBC1 domain family member 15                          90.5    4e-17   Tinamus guttatus
ref|XP_006719630.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    4e-17   Homo sapiens [man]
ref|XP_005039952.1|  PREDICTED: TBC1 domain family member 15          90.5    4e-17   Ficedula albicollis
ref|XP_005469062.1|  PREDICTED: TBC1 domain family member 17          90.5    4e-17   
ref|XP_010753848.1|  PREDICTED: TBC1 domain family member 17          90.5    4e-17   
ref|XP_005884185.1|  PREDICTED: TBC1 domain family member 15 isof...  90.9    4e-17   Myotis brandtii
gb|EPQ18866.1|  TBC1 domain family member 15                          90.9    4e-17   Myotis brandtii
ref|XP_009962025.1|  PREDICTED: TBC1 domain family member 15          90.5    5e-17   Tyto alba [Schleiereule]
gb|ETE68555.1|  TBC1 domain family member 17                          90.5    5e-17   Ophiophagus hannah
ref|XP_005884184.1|  PREDICTED: TBC1 domain family member 15 isof...  90.5    5e-17   Myotis brandtii
ref|XP_006146258.1|  PREDICTED: TBC1 domain family member 15 isof...  90.5    5e-17   Tupaia chinensis
ref|XP_006759815.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  90.5    5e-17   
gb|ELK33247.1|  TBC1 domain family member 15                          90.5    5e-17   Myotis davidii
ref|XP_005431957.1|  PREDICTED: TBC1 domain family member 15          90.1    5e-17   
ref|XP_004632275.1|  PREDICTED: TBC1 domain family member 15          90.5    5e-17   
ref|XP_008294681.1|  PREDICTED: TBC1 domain family member 17 isof...  90.1    5e-17   Stegastes partitus
ref|XP_010131193.1|  PREDICTED: TBC1 domain family member 15          90.1    5e-17   Buceros rhinoceros silvestris
ref|XP_006014956.1|  PREDICTED: TBC1 domain family member 17 isof...  90.1    5e-17   Alligator sinensis
gb|KFV47134.1|  TBC1 domain family member 15                          90.1    5e-17   Tyto alba [Schleiereule]
ref|XP_006095517.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  90.5    5e-17   
ref|XP_006014957.1|  PREDICTED: TBC1 domain family member 17 isof...  90.1    5e-17   Alligator sinensis
ref|XP_008925123.1|  PREDICTED: TBC1 domain family member 15          90.5    5e-17   
ref|XP_008294680.1|  PREDICTED: TBC1 domain family member 17 isof...  90.1    5e-17   Stegastes partitus
ref|XP_009179475.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    5e-17   Papio anubis [baboon]
ref|XP_006146257.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Tupaia chinensis
ref|XP_011905122.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    6e-17   Cercocebus atys
ref|XP_001117529.2|  PREDICTED: TBC1 domain family member 15-like...  90.1    6e-17   
ref|XP_009484857.1|  PREDICTED: TBC1 domain family member 15          89.4    6e-17   Pelecanus crispus
ref|XP_010369039.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Rhinopithecus roxellana
ref|XP_008002231.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Chlorocebus sabaeus
ref|XP_011725456.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Macaca nemestrina [pigtail macaque]
ref|XP_011784734.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Colobus angolensis palliatus
ref|XP_010615803.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Fukomys damarensis [Damara mole rat]
ref|XP_003906829.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Papio anubis [baboon]
ref|XP_009179474.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Papio anubis [baboon]
ref|XP_008002230.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Chlorocebus sabaeus
ref|XP_011833895.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Mandrillus leucophaeus
ref|XP_011784733.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    6e-17   Colobus angolensis palliatus
ref|XP_011905121.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   Cercocebus atys
gb|KFW83412.1|  TBC1 domain family member 15                          90.1    7e-17   Manacus vitellinus
ref|XP_005571608.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   Macaca fascicularis [crab eating macaque]
ref|XP_011784735.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   Colobus angolensis palliatus
ref|XP_011725455.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   Macaca nemestrina [pigtail macaque]
ref|XP_010615800.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   Fukomys damarensis [Damara mole rat]
ref|XP_003906830.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   Papio anubis [baboon]
gb|EHH66499.1|  hypothetical protein EGM_03502                        90.1    7e-17   Macaca fascicularis [crab eating macaque]
ref|XP_008498865.1|  PREDICTED: TBC1 domain family member 15          88.6    7e-17   Calypte anna
gb|KFP06138.1|  TBC1 domain family member 15                          88.6    7e-17   
ref|XP_011833896.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   
ref|XP_010369038.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   
ref|XP_011536983.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    7e-17   
ref|XP_010615802.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   
ref|XP_011905120.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   
ref|XP_009179472.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   
ref|XP_011833894.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   
ref|XP_008832774.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    7e-17   
ref|XP_011605983.1|  PREDICTED: TBC1 domain family member 15          89.7    7e-17   
ref|XP_005571607.1|  PREDICTED: TBC1 domain family member 15 isof...  90.1    7e-17   
gb|EHH20973.1|  hypothetical protein EGK_03934                        90.1    7e-17   
ref|XP_010615801.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    7e-17   
ref|XP_009325940.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  89.7    7e-17   
gb|KFV99684.1|  TBC1 domain family member 15                          89.4    7e-17   
gb|AAH91834.1|  Si:ch211-218c6.6 protein                              87.8    7e-17   
ref|XP_008002227.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    7e-17   
ref|XP_011905118.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    8e-17   
ref|XP_008002228.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    8e-17   
ref|XP_008002226.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    8e-17   
ref|XP_009424060.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    8e-17   
ref|XP_011905119.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    8e-17   
gb|EAW97273.1|  TBC1 domain family, member 15, isoform CRA_a          89.4    8e-17   
ref|XP_003798993.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    8e-17   
ref|XP_345826.3|  PREDICTED: TBC1 domain family member 15 isoform X2  89.7    8e-17   
gb|KFO87733.1|  TBC1 domain family member 15                          89.7    8e-17   
ref|XP_008956626.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    8e-17   
ref|XP_008002229.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    8e-17   
ref|XP_011905117.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    8e-17   
ref|XP_008582303.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    8e-17   
ref|XP_009424058.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    9e-17   
ref|XP_009424057.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    9e-17   
ref|XP_006719629.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    9e-17   
ref|NP_001267438.1|  TBC1 domain family member 15                     89.7    9e-17   
ref|XP_006226083.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    9e-17   
ref|XP_010159724.1|  PREDICTED: TBC1 domain family member 15-like     89.4    9e-17   
ref|XP_003798994.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    9e-17   
ref|XP_008582304.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    9e-17   
ref|XP_004053624.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    9e-17   
ref|XP_004053625.1|  PREDICTED: TBC1 domain family member 15 isof...  89.7    9e-17   
ref|XP_003832953.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
ref|XP_009424056.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
ref|NP_001139685.2|  TBC1 domain family member 15 isoform 3           89.4    1e-16   
ref|XP_008832775.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    1e-16   
ref|XP_003832954.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
dbj|BAB13971.1|  unnamed protein product                              89.4    1e-16   
gb|EAW97275.1|  TBC1 domain family, member 15, isoform CRA_c          89.4    1e-16   
gb|AAH28352.1|  TBC1 domain family, member 15                         89.4    1e-16   
ref|XP_006719628.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
ref|XP_010001382.1|  PREDICTED: TBC1 domain family member 15          89.4    1e-16   
ref|NP_073608.4|  TBC1 domain family member 15 isoform 1              89.4    1e-16   
ref|NP_001139686.1|  TBC1 domain family member 15 isoform 2           89.4    1e-16   
gb|KFR06581.1|  TBC1 domain family member 15                          89.4    1e-16   
ref|XP_004650166.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
ref|XP_007503117.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
gb|KFU93704.1|  TBC1 domain family member 15                          89.4    1e-16   
ref|XP_009424055.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
ref|XP_007503116.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
ref|XP_007241483.1|  PREDICTED: TBC1 domain family member 17-like     88.6    1e-16   
ref|XP_005519422.1|  PREDICTED: TBC1 domain family member 15          89.4    1e-16   
gb|KFP66026.1|  TBC1 domain family member 15                          87.8    1e-16   
gb|EAW97274.1|  TBC1 domain family, member 15, isoform CRA_b          89.4    1e-16   
ref|XP_009700419.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  88.2    1e-16   
ref|XP_010412149.1|  PREDICTED: TBC1 domain family member 15          89.4    1e-16   
ref|XP_005374380.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
ref|XP_004650165.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
ref|XP_004700841.1|  PREDICTED: TBC1 domain family member 15          89.4    1e-16   
ref|XP_006719627.1|  PREDICTED: TBC1 domain family member 15 isof...  89.4    1e-16   
gb|KFQ85381.1|  TBC1 domain family member 15                          89.0    1e-16   
ref|XP_009246305.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    1e-16   
ref|XP_009246306.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    1e-16   
ref|XP_003475965.2|  PREDICTED: TBC1 domain family member 15          89.0    1e-16   
ref|XP_005374379.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    1e-16   
ref|XP_007950655.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    1e-16   
ref|XP_010706484.1|  PREDICTED: TBC1 domain family member 15          89.0    1e-16   
ref|NP_001124672.1|  TBC1 domain family member 15                     89.0    2e-16   
dbj|BAG60001.1|  unnamed protein product                              89.0    2e-16   
ref|XP_008410112.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    2e-16   
ref|XP_009929915.1|  PREDICTED: TBC1 domain family member 15          89.0    2e-16   
ref|XP_006643220.1|  PREDICTED: TBC1 domain family member 17-like     89.0    2e-16   
ref|XP_008631121.1|  PREDICTED: TBC1 domain family member 15          89.0    2e-16   
gb|EHB12386.1|  TBC1 domain family member 15                          88.2    2e-16   
ref|XP_006871674.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    2e-16   
ref|XP_006871673.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    2e-16   
emb|CDQ65317.1|  unnamed protein product                              88.6    2e-16   
ref|XP_003259599.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_009808653.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  88.2    2e-16   
ref|XP_003259600.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_007950654.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|NP_001012827.1|  TBC1 domain family member 15                     88.6    2e-16   
ref|XP_010779789.1|  PREDICTED: TBC1 domain family member 17          88.6    2e-16   
ref|XP_005514233.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  88.6    2e-16   
ref|XP_008053430.1|  PREDICTED: TBC1 domain family member 15          88.2    2e-16   
ref|XP_004071273.1|  PREDICTED: TBC1 domain family member 17          88.6    2e-16   
ref|XP_010881820.1|  PREDICTED: TBC1 domain family member 15-like     88.6    2e-16   
ref|XP_010597189.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
gb|KFO58466.1|  TBC1 domain family member 15                          88.6    2e-16   
ref|XP_003927857.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_007054875.1|  PREDICTED: TBC1 domain family member 15          88.6    2e-16   
ref|XP_003927856.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_005159143.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_003431503.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_011218547.1|  PREDICTED: TBC1 domain family member 15          88.6    2e-16   
gb|KFP76577.1|  TBC1 domain family member 15                          88.6    2e-16   
ref|XP_003989099.1|  PREDICTED: TBC1 domain family member 15          88.6    2e-16   
ref|XP_531681.3|  PREDICTED: TBC1 domain family member 15 isoform 2   88.6    2e-16   
ref|XP_004583095.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_010597192.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|NP_001166096.1|  TBC1 domain family member 15                     88.6    2e-16   
ref|XP_008682529.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_008682528.1|  PREDICTED: TBC1 domain family member 15 isof...  88.6    2e-16   
ref|XP_005305159.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    2e-16   
ref|XP_009069186.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  88.2    2e-16   
ref|XP_004417925.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    2e-16   
ref|XP_001925371.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    2e-16   
ref|XP_004417924.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_012029312.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_012029313.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_005305158.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_003355565.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_006274452.1|  PREDICTED: TBC1 domain family member 17          88.2    3e-16   
ref|XP_003364361.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_004583094.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_003221196.1|  PREDICTED: TBC1 domain family member 15          88.2    3e-16   
ref|XP_004899564.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_010839244.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
gb|KFQ74636.1|  TBC1 domain family member 15                          88.2    3e-16   
gb|KFQ10699.1|  TBC1 domain family member 15                          88.2    3e-16   
ref|XP_001488011.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_010285040.1|  PREDICTED: TBC1 domain family member 15          88.2    3e-16   
ref|XP_012019523.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_870873.5|  PREDICTED: TBC1 domain family member 15 isoform X2  88.2    3e-16   
ref|XP_005679777.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_009925542.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  88.2    3e-16   
ref|XP_010839243.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_004752477.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_003770985.1|  PREDICTED: TBC1 domain family member 15-like     88.2    3e-16   
ref|XP_005961389.1|  PREDICTED: TBC1 domain family member 15          88.2    3e-16   
ref|XP_005679778.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_012019521.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_004899563.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_002752810.2|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_010957163.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_009002471.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_004845086.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  88.2    3e-16   
tpg|DAA30135.1|  TPA: TBC1 domain family, member 15                   88.2    3e-16   
ref|XP_005198255.1|  PREDICTED: TBC1 domain family member 15 isof...  88.2    3e-16   
ref|XP_004752478.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_006191165.1|  PREDICTED: TBC1 domain family member 15          87.8    3e-16   
ref|XP_008255015.1|  PREDICTED: TBC1 domain family member 15          87.8    3e-16   
gb|ELR55632.1|  TBC1 domain family member 15                          87.8    3e-16   
ref|XP_010957164.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_010839241.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_009002470.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_009002468.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_009002467.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_010178473.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  87.8    3e-16   
ref|XP_002752809.2|  PREDICTED: TBC1 domain family member 15 isof...  87.8    3e-16   
ref|XP_005305160.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    4e-16   
ref|XP_010986520.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    4e-16   
ref|XP_008535036.1|  PREDICTED: TBC1 domain family member 15          88.2    4e-16   
ref|XP_010986519.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    4e-16   
ref|XP_006197894.1|  PREDICTED: TBC1 domain family member 15 isof...  87.8    4e-16   
ref|XP_004281948.1|  PREDICTED: TBC1 domain family member 15 isof...  87.4    4e-16   
ref|XP_005330478.1|  PREDICTED: TBC1 domain family member 15 isof...  87.4    4e-16   
ref|XP_007542420.1|  PREDICTED: TBC1 domain family member 15          87.4    4e-16   
ref|XP_004406070.1|  PREDICTED: TBC1 domain family member 15 isof...  87.4    4e-16   
ref|XP_004281947.1|  PREDICTED: TBC1 domain family member 15 isof...  87.4    4e-16   
ref|XP_007082314.1|  PREDICTED: TBC1 domain family member 15          87.4    4e-16   
ref|XP_006197895.1|  PREDICTED: TBC1 domain family member 15 isof...  87.4    5e-16   
ref|XP_005810365.1|  PREDICTED: TBC1 domain family member 17-like     87.4    5e-16   
ref|XP_004406069.1|  PREDICTED: TBC1 domain family member 15 isof...  87.4    5e-16   
ref|XP_005330477.1|  PREDICTED: TBC1 domain family member 15 isof...  87.4    5e-16   
ref|NP_001019565.1|  TBC1 domain family member 17                     87.0    5e-16   
ref|XP_004462078.1|  PREDICTED: TBC1 domain family member 15 isof...  87.4    5e-16   
ref|XP_006744585.1|  PREDICTED: TBC1 domain family member 15          87.4    5e-16   
ref|XP_004462077.1|  PREDICTED: TBC1 domain family member 15 isof...  87.0    6e-16   
ref|XP_006062209.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  87.0    6e-16   
ref|XP_006923814.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  87.0    7e-16   
gb|AAH66727.1|  Zgc:110443 protein                                    87.0    7e-16   
ref|XP_010014050.1|  PREDICTED: TBC1 domain family member 15          86.7    7e-16   
ref|XP_011372687.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  87.0    7e-16   
ref|XP_005164004.1|  PREDICTED: TBC1 domain family member 17 isof...  86.7    7e-16   
gb|ELK02505.1|  TBC1 domain family member 15                          87.0    7e-16   
ref|XP_009564626.1|  PREDICTED: TBC1 domain family member 15          87.0    7e-16   
ref|XP_007113511.1|  PREDICTED: TBC1 domain family member 15-like...  87.0    7e-16   
ref|XP_004552549.1|  PREDICTED: TBC1 domain family member 17-like     86.7    7e-16   
ref|XP_010752961.1|  PREDICTED: TBC1 domain family member 15 isof...  86.7    7e-16   
ref|XP_007195069.1|  PREDICTED: TBC1 domain family member 15 isof...  87.0    7e-16   
ref|XP_007195071.1|  PREDICTED: TBC1 domain family member 15 isof...  86.7    7e-16   
gb|KFQ50653.1|  TBC1 domain family member 15                          86.7    8e-16   
ref|XP_010752960.1|  PREDICTED: TBC1 domain family member 15 isof...  86.7    8e-16   
ref|XP_007129610.1|  PREDICTED: TBC1 domain family member 15-like     86.7    8e-16   
ref|XP_007195070.1|  PREDICTED: TBC1 domain family member 15 isof...  86.7    8e-16   
ref|XP_007113510.1|  PREDICTED: TBC1 domain family member 15-like...  86.7    8e-16   
ref|XP_005921832.1|  PREDICTED: TBC1 domain family member 17-like     86.7    8e-16   
ref|NP_989223.1|  TBC1 domain family member 15                        86.7    9e-16   
gb|AAH76966.1|  TBC1 domain family, member 15                         86.7    9e-16   
ref|XP_005419335.1|  PREDICTED: TBC1 domain family member 15          86.7    9e-16   
ref|XP_006026311.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  86.3    1e-15   
ref|XP_007448833.1|  PREDICTED: TBC1 domain family member 15 isof...  86.3    1e-15   
ref|XP_010872405.1|  PREDICTED: TBC1 domain family member 17          85.9    1e-15   
ref|XP_007448834.1|  PREDICTED: TBC1 domain family member 15 isof...  86.3    1e-15   
ref|XP_007664518.1|  PREDICTED: TBC1 domain family member 15          86.3    1e-15   
gb|KFV67974.1|  TBC1 domain family member 15                          85.9    2e-15   
ref|XP_009899605.1|  PREDICTED: TBC1 domain family member 15          85.9    2e-15   
ref|XP_007901954.1|  PREDICTED: TBC1 domain family member 15          85.9    2e-15   
ref|XP_007249279.1|  PREDICTED: TBC1 domain family member 15-like     85.9    2e-15   
gb|KFV78597.1|  TBC1 domain family member 15                          85.9    2e-15   
ref|XP_004361055.1|  RabGAP/TBC domain-containing protein             86.3    2e-15   
ref|XP_007562193.1|  PREDICTED: TBC1 domain family member 17          85.5    2e-15   
ref|XP_008414636.1|  PREDICTED: TBC1 domain family member 17          85.5    2e-15   
ref|XP_008292610.1|  PREDICTED: TBC1 domain family member 15          85.1    2e-15   
ref|XP_009667915.1|  PREDICTED: TBC1 domain family member 15          85.5    2e-15   
gb|AAY53531.1|  TBC1 domain family member 15                          85.5    2e-15   
ref|XP_006258530.1|  PREDICTED: TBC1 domain family member 15          85.1    2e-15   
dbj|GAM28092.1|  hypothetical protein SAMD00019534_112680             85.1    3e-15   
ref|XP_006121609.1|  PREDICTED: TBC1 domain family member 15 isof...  85.1    3e-15   
ref|XP_003965064.1|  PREDICTED: TBC1 domain family member 17          84.7    3e-15   
ref|NP_079982.3|  TBC1 domain family member 15                        84.7    3e-15   
gb|EDL21763.1|  TBC1 domain family, member 15                         84.7    4e-15   



>ref|XP_009593351.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 4/125 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  195  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  250

Query  516  PQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSIS  695
             QALRKRIFYGG+E  LRKEVW+FLLGYHSYDSTYAERK LAS+KKSEYET+KNQWKSIS
Sbjct  251  SQALRKRIFYGGVEKGLRKEVWRFLLGYHSYDSTYAERKYLASIKKSEYETLKNQWKSIS  310

Query  696  REQAK  710
            +EQAK
Sbjct  311  KEQAK  315



>ref|XP_009593350.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 4/125 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSIS  695
             QALRKRIFYGG+E  LRKEVW+FLLGYHSYDSTYAERK LAS+KKSEYET+KNQWKSIS
Sbjct  364  SQALRKRIFYGGVEKGLRKEVWRFLLGYHSYDSTYAERKYLASIKKSEYETLKNQWKSIS  423

Query  696  REQAK  710
            +EQAK
Sbjct  424  KEQAK  428



>ref|XP_009789610.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Nicotiana 
sylvestris]
Length=563

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 104/125 (83%), Gaps = 4/125 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  195  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  250

Query  516  PQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSIS  695
             QALRKRIFYGG+E  LRKEVW+FLLGYHSYDSTYAERK +AS+KKSEYET+KNQWKSIS
Sbjct  251  SQALRKRIFYGGVEKGLRKEVWRFLLGYHSYDSTYAERKYIASIKKSEYETLKNQWKSIS  310

Query  696  REQAK  710
            +EQAK
Sbjct  311  KEQAK  315



>ref|XP_009593349.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nicotiana 
tomentosiformis]
Length=676

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 4/125 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSIS  695
             QALRKRIFYGG+E  LRKEVW+FLLGYHSYDSTYAERK LAS+KKSEYET+KNQWKSIS
Sbjct  364  SQALRKRIFYGGVEKGLRKEVWRFLLGYHSYDSTYAERKYLASIKKSEYETLKNQWKSIS  423

Query  696  REQAK  710
            +EQAK
Sbjct  424  KEQAK  428



>ref|XP_009789609.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Nicotiana 
sylvestris]
Length=626

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 104/125 (83%), Gaps = 4/125 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSIS  695
             QALRKRIFYGG+E  LRKEVW+FLLGYHSYDSTYAERK +AS+KKSEYET+KNQWKSIS
Sbjct  364  SQALRKRIFYGGVEKGLRKEVWRFLLGYHSYDSTYAERKYIASIKKSEYETLKNQWKSIS  423

Query  696  REQAK  710
            +EQAK
Sbjct  424  KEQAK  428


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+ QGS SMT S   K S+S++   V I  L D VA++P Q+A + I
Sbjct  5    DLHDLSDDADYAASMHQGSTSMTTSGGSKPSSSSEQVGVEIVYLKDNVAIHPTQHAWERI  64

Query  297  NNQLRQINQGKPIL  338
              +L+ I QG  +L
Sbjct  65   RGRLKLIKQGSSLL  78



>ref|XP_012081206.1| PREDICTED: GTPase-activating protein gyp7 isoform X3 [Jatropha 
curcas]
Length=609

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +3

Query  354  RKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            RKH+H EE AT V P  LIN+ +FD ++LVWGKPRQP +G +EWATFLDSEGRVM+ +AL
Sbjct  319  RKHEHGEEAATNVGPFQLINFKEFDKLTLVWGKPRQPPLGSEEWATFLDSEGRVMDSKAL  378

Query  528  RKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQA  707
            RKRIFYGG+E++LR+EVW FLLGYH+YDSTYAER+ L   KK EYET+K QW+SIS EQA
Sbjct  379  RKRIFYGGVEHTLRREVWAFLLGYHAYDSTYAERECLRYNKKLEYETVKKQWQSISPEQA  438

Query  708  K  710
            K
Sbjct  439  K  439



>ref|XP_009789608.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Nicotiana 
sylvestris]
Length=676

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 104/125 (83%), Gaps = 4/125 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSIS  695
             QALRKRIFYGG+E  LRKEVW+FLLGYHSYDSTYAERK +AS+KKSEYET+KNQWKSIS
Sbjct  364  SQALRKRIFYGGVEKGLRKEVWRFLLGYHSYDSTYAERKYIASIKKSEYETLKNQWKSIS  423

Query  696  REQAK  710
            +EQAK
Sbjct  424  KEQAK  428


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+ QGS SMT S   K S+S++   V I  L D VA++P Q+A + I
Sbjct  5    DLHDLSDDADYAASMHQGSTSMTTSGGSKPSSSSEQVGVEIVYLKDNVAIHPTQHAWERI  64

Query  297  NNQLRQINQGKPIL  338
              +L+ I QG  +L
Sbjct  65   RGRLKLIKQGSSLL  78



>ref|XP_012081204.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Jatropha 
curcas]
 gb|KDP30256.1| hypothetical protein JCGZ_17038 [Jatropha curcas]
Length=687

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +3

Query  354  RKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            RKH+H EE AT V P  LIN+ +FD ++LVWGKPRQP +G +EWATFLDSEGRVM+ +AL
Sbjct  319  RKHEHGEEAATNVGPFQLINFKEFDKLTLVWGKPRQPPLGSEEWATFLDSEGRVMDSKAL  378

Query  528  RKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQA  707
            RKRIFYGG+E++LR+EVW FLLGYH+YDSTYAER+ L   KK EYET+K QW+SIS EQA
Sbjct  379  RKRIFYGGVEHTLRREVWAFLLGYHAYDSTYAERECLRYNKKLEYETVKKQWQSISPEQA  438

Query  708  K  710
            K
Sbjct  439  K  439



>ref|XP_010241555.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nelumbo nucifera]
Length=700

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 2/127 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K   +K +H EE ATKV    L+N  +FD ++LVWGKPRQP +GP+EW TFLDSEGRV
Sbjct  328  LEKIPCKKQNHGEEAATKVGTFELVNCKEFDKLALVWGKPRQPPLGPEEWTTFLDSEGRV  387

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            M+ +AL+KRIFYGG+E+ LR E+WKFLLGYH YDSTYAER+ LAS+KKSEYETIK+QW+S
Sbjct  388  MDSKALKKRIFYGGIEHELRNEIWKFLLGYHKYDSTYAEREYLASIKKSEYETIKHQWQS  447

Query  690  ISREQAK  710
            IS  QAK
Sbjct  448  ISPAQAK  454


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_010241554.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nelumbo nucifera]
Length=707

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +3

Query  354  RKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            +K +H EE ATKV    L+N  +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +AL
Sbjct  341  KKQNHGEEAATKVGTFELVNCKEFDKLALVWGKPRQPPLGPEEWTTFLDSEGRVMDSKAL  400

Query  528  RKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQA  707
            +KRIFYGG+E+ LR E+WKFLLGYH YDSTYAER+ LAS+KKSEYETIK+QW+SIS  QA
Sbjct  401  KKRIFYGGIEHELRNEIWKFLLGYHKYDSTYAEREYLASIKKSEYETIKHQWQSISPAQA  460

Query  708  K  710
            K
Sbjct  461  K  461


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_010656459.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Vitis vinifera]
 emb|CBI28236.3| unnamed protein product [Vitis vinifera]
Length=684

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K+  RK  HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EWATFLDSEGR+
Sbjct  312  LEKTRCRKQYHDEEAVTNVGTFELIDCKEFDKLALVWGKPRQPPLGSEEWATFLDSEGRI  371

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            M+ +ALRKRIFYGG+E+SLRKEVW FLLGYH+YDST AER+ L S+KKSEYET+K QW+S
Sbjct  372  MDSKALRKRIFYGGIEHSLRKEVWTFLLGYHAYDSTSAEREYLVSIKKSEYETVKQQWQS  431

Query  690  ISREQAK  710
            IS EQAK
Sbjct  432  ISPEQAK  438



>ref|XP_010323291.1| PREDICTED: GTPase-activating protein gyp7 [Solanum lycopersicum]
Length=678

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQ  521
            +SS  KH+ +EE A + + L  Y+ +D +SLVWGKPRQP +G +EW+TFLDSEGR+++ Q
Sbjct  310  ESSCEKHNKNEEAAMRDENL-EYD-YDKLSLVWGKPRQPPLGSEEWSTFLDSEGRIVDSQ  367

Query  522  ALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISRE  701
            ALRKRIFYGG+E  LRKEVW+FLLGYHSYDSTY+ER+ LAS++KSEYETIKNQWKSI++E
Sbjct  368  ALRKRIFYGGVEKGLRKEVWRFLLGYHSYDSTYSEREYLASIRKSEYETIKNQWKSITKE  427

Query  702  QAK  710
            QAK
Sbjct  428  QAK  430



>ref|XP_010656458.1| PREDICTED: GTPase-activating protein GYP7 isoform X1 [Vitis vinifera]
Length=696

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            K+  RK  HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+
Sbjct  326  KTRCRKQYHDEEAVTNVGTFELIDCKEFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMD  385

Query  516  PQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSIS  695
             +ALRKRIFYGG+E+SLRKEVW FLLGYH+YDST AER+ L S+KKSEYET+K QW+SIS
Sbjct  386  SKALRKRIFYGGIEHSLRKEVWTFLLGYHAYDSTSAEREYLVSIKKSEYETVKQQWQSIS  445

Query  696  REQAK  710
             EQAK
Sbjct  446  PEQAK  450



>ref|XP_007013520.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY31139.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
Length=743

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = +3

Query  258  VAVNPMQYASDWINNQLRQINQGKPILTKSSFRKHDHDEEPATKVQP--LINYNKFDNVS  431
            VA +P++     +  Q   +     +  K+ +RKH+HD+E AT V    LI++ +FD +S
Sbjct  306  VAPDPLELERFQVLCQDHPMPTSTLVKQKAPYRKHNHDDEAATNVGTFELIDFKEFDKLS  365

Query  432  LVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYD  611
            LVWGKPRQP +G +EWATFLDSEGRV++ +ALRKRIFYGG+E+ LR+EVW  LLGYH+Y+
Sbjct  366  LVWGKPRQPPLGLEEWATFLDSEGRVVDSKALRKRIFYGGIEHKLRREVWAILLGYHTYE  425

Query  612  STYAERKLLASVKKSEYETIKNQWKSIS  695
            STYAERK L S+KK+EYETIKNQW+ I+
Sbjct  426  STYAERKYLRSIKKTEYETIKNQWQCIT  453


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS QQGSASM R +  K S+S++ +   I  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQQGSASMMRCDRGKRSSSSEPEGAEIVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGSSLF  78



>ref|XP_006358298.1| PREDICTED: GTPase-activating protein gyp7-like [Solanum tuberosum]
Length=678

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQ  521
            +SS   H+ +EE A + + L  Y+ +D +SLVWGKPRQP +G +EW+TFLDSEGRV++ Q
Sbjct  310  ESSCEIHNKNEEAAMRDESL-EYD-YDKLSLVWGKPRQPPLGSKEWSTFLDSEGRVIDSQ  367

Query  522  ALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISRE  701
            ALRKRIFYGG+E  LRKEVW+FLLGYHSYDST AER+ LAS++KSEYETIKNQWKSI++E
Sbjct  368  ALRKRIFYGGVEKGLRKEVWRFLLGYHSYDSTCAEREYLASIRKSEYETIKNQWKSITKE  427

Query  702  QAK  710
            QAK
Sbjct  428  QAK  430



>gb|KJB27075.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=544

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            ++ +ALRKRIFYGG+E+ LRKEVW  LLGYH+Y+STYAERK   S+KK EYETIK+QW+S
Sbjct  371  VDSKALRKRIFYGGIEHKLRKEVWAILLGYHTYESTYAERKHQRSIKKIEYETIKSQWQS  430

Query  690  ISREQAK  710
            IS  QAK
Sbjct  431  ISPAQAK  437


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>emb|CDP10442.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K+S R  + DEE AT V    L+N  + D +SLVWGKPRQP +GP+EWATFLDSEGRV
Sbjct  313  LEKTSHRNENRDEEAATNVGVFELVNCKELDKLSLVWGKPRQPPLGPEEWATFLDSEGRV  372

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            M+ +AL+KRIFYGG+E+SLRKE+W  LL YH+YDSTYAER+ L SVKK EYET+KNQW+S
Sbjct  373  MDEKALKKRIFYGGVEHSLRKELWPCLLEYHAYDSTYAEREYLVSVKKLEYETLKNQWQS  432

Query  690  ISREQAK  710
            IS  QA+
Sbjct  433  ISPAQAR  439


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS+QQGS+S  RS+  + S+S ++D   I  L D V ++P Q+A
Sbjct  1    MHETEVNDLSDDADYAASMQQGSSSFARSDSGRRSSSGETDGAEIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I  +L+ I QG  + 
Sbjct  61   SERIRGRLKLIKQGTALF  78



>gb|KJB27076.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=626

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            ++ +ALRKRIFYGG+E+ LRKEVW  LLGYH+Y+STYAERK   S+KK EYETIK+QW+S
Sbjct  371  VDSKALRKRIFYGGIEHKLRKEVWAILLGYHTYESTYAERKHQRSIKKIEYETIKSQWQS  430

Query  690  ISREQAK  710
            IS  QAK
Sbjct  431  ISPAQAK  437


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|KJB27077.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=639

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  267  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  326

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            ++ +ALRKRIFYGG+E+ LRKEVW  LLGYH+Y+STYAERK   S+KK EYETIK+QW+S
Sbjct  327  VDSKALRKRIFYGGIEHKLRKEVWAILLGYHTYESTYAERKHQRSIKKIEYETIKSQWQS  386

Query  690  ISREQAK  710
            IS  QAK
Sbjct  387  ISPAQAK  393


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|KJB27079.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=683

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            ++ +ALRKRIFYGG+E+ LRKEVW  LLGYH+Y+STYAERK   S+KK EYETIK+QW+S
Sbjct  371  VDSKALRKRIFYGGIEHKLRKEVWAILLGYHTYESTYAERKHQRSIKKIEYETIKSQWQS  430

Query  690  ISREQAK  710
            IS  QAK
Sbjct  431  ISPAQAK  437


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|KDO80156.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=685

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            K S RKH HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+
Sbjct  314  KISSRKHIHDEEAVTNVGTFELIDCKEFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMD  373

Query  516  PQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSIS  695
              ALRKRIFYGG+++ LR+EVW FLLGY++YDSTYAER+ L  +KKSEYE IK QW+SIS
Sbjct  374  SNALRKRIFYGGVDHKLRREVWAFLLGYYAYDSTYAEREYLRCIKKSEYENIKRQWQSIS  433

Query  696  REQAK  710
             EQA+
Sbjct  434  PEQAR  438



>ref|XP_006345222.1| PREDICTED: TBC1 domain family member 15-like [Solanum tuberosum]
Length=656

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 106/155 (68%), Gaps = 22/155 (14%)
 Frame = +3

Query  297  NNQLRQINQGKPILTKSSFRKHD---HD--------------EEPATKVQPLINYNKFDN  425
             +QL    QG   +T    RKHD   HD              E+      PL    +FD 
Sbjct  259  TSQLFGEAQGDGFITNDR-RKHDGKTHDYPRMAESNDAQKLPEDVPVPADPL----EFDK  313

Query  426  VSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHS  605
            +SLVWGKPRQP +G +EW+ FLDSEGRV + +ALRKRIFYGG+E  LRKEVW+FLLGYHS
Sbjct  314  LSLVWGKPRQPPLGTEEWSAFLDSEGRVTDSEALRKRIFYGGVEPDLRKEVWRFLLGYHS  373

Query  606  YDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            YDSTYAER+ L S+KKSEYETIKNQWKSIS+EQAK
Sbjct  374  YDSTYAEREYLVSIKKSEYETIKNQWKSISKEQAK  408


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+Q GSASM RSN  K  +S + +   I  + D VA++P QYAS+ I
Sbjct  5    DVHDLSDDADYAASVQHGSASMNRSNSSKQGSSGEQEGAEIVYVKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>gb|KHG01737.1| TBC1 domain family member 15 [Gossypium arboreum]
Length=683

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LI+Y +FD +SLVWGKPRQP +G +EWATFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELISYKEFDKLSLVWGKPRQPPLGLEEWATFLDSEGRV  370

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            ++ +ALRKRIFYGG+E+ LRKEVW  LLG+H+Y+STYAERK   S+KK+EYETIK+QW+S
Sbjct  371  VDSKALRKRIFYGGIEHKLRKEVWAILLGHHTYESTYAERKHQRSIKKTEYETIKSQWQS  430

Query  690  ISREQAK  710
            IS  QAK
Sbjct  431  ISPAQAK  437


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS Q+GSASM R +  K STS++++   I  L D VA++P QYA
Sbjct  1    MQEAELHDLSDDADYAASQQEGSASMMRCDSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
             + I+ +L+ I QG  + 
Sbjct  61   FERISGRLKLIKQGSALF  78



>ref|XP_009758337.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana sylvestris]
Length=649

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EW+TFLD EGRV + +A+RKRIFYGG+E  LRKEVW+FLL
Sbjct  303  EFDKLSLVWGKPRQPPLGTEEWSTFLDCEGRVTDSEAVRKRIFYGGVEQGLRKEVWRFLL  362

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYHSYDSTYAER+ L SV+KSEYETIKNQWKSIS+EQA+
Sbjct  363  GYHSYDSTYAEREYLVSVRKSEYETIKNQWKSISKEQAR  401



>ref|XP_004251725.1| PREDICTED: TBC1 domain family member 17-like [Solanum lycopersicum]
Length=656

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EW+ FLD+EGRV + +A+RKRIFYGG+E  LRKEVW+FLL
Sbjct  309  EFDKLSLVWGKPRQPPLGTEEWSAFLDTEGRVTDSEAVRKRIFYGGVEPDLRKEVWQFLL  368

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYHSYDSTYAER+ L SVKKSEYETIKNQWKSIS+EQAK
Sbjct  369  GYHSYDSTYAEREYLVSVKKSEYETIKNQWKSISKEQAK  407


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+QQGSASM RSN  K  +S + +   I  + D VA++P QYAS+ I
Sbjct  5    DVHDLSDDADYAASVQQGSASMNRSNSSKQGSSGEQEGAEIVYVKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>ref|XP_010241556.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nelumbo nucifera]
Length=673

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 5/114 (4%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DE P     PL    +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +AL+KRIFYG
Sbjct  319  DEAPVAS-DPL----EFDKLALVWGKPRQPPLGPEEWTTFLDSEGRVMDSKALKKRIFYG  373

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E+ LR E+WKFLLGYH YDSTYAER+ LAS+KKSEYETIK+QW+SIS  QAK
Sbjct  374  GIEHELRNEIWKFLLGYHKYDSTYAEREYLASIKKSEYETIKHQWQSISPAQAK  427


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_010112474.1| TBC1 domain family member 15 [Morus notabilis]
 gb|EXC33718.1| TBC1 domain family member 15 [Morus notabilis]
Length=517

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K S  KH+  EE AT V    LIN  +FD ++LVWGKPRQP +GP+EW T LDSEGRV
Sbjct  70   LPKFSCMKHNIGEEAATGVGNFELINLEEFDKLALVWGKPRQPPLGPEEWVTLLDSEGRV  129

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
             +P+ALRKRIFYGG+E+ LRKEVW FLLG+++Y+STYAER+ L SVKKSEYETIKNQW+ 
Sbjct  130  TDPEALRKRIFYGGVEHILRKEVWAFLLGHYAYESTYAEREYLRSVKKSEYETIKNQWQG  189

Query  690  IS  695
            + 
Sbjct  190  LC  191



>ref|XP_009624893.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tomentosiformis]
Length=649

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EW+ FLD EGRV + +A+RKRIFYGG+E  LRKEVW+FLL
Sbjct  303  EFDKLSLVWGKPRQPPLGTEEWSAFLDCEGRVTDSEAVRKRIFYGGVEQGLRKEVWRFLL  362

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYHSYDSTYAER+ L SV+KSEYETIKNQWKSIS+EQA+
Sbjct  363  GYHSYDSTYAEREYLVSVRKSEYETIKNQWKSISKEQAR  401


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            +I D SD+  YAASIQQGSASM RS+  K S+S + +   I  L D VA++P QYAS+ I
Sbjct  5    DIHDLSDDADYAASIQQGSASMNRSDSSKQSSSGEQEGAEIVYLKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>ref|XP_011084120.1| PREDICTED: TBC1 domain family member 15 [Sesamum indicum]
Length=654

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EWATF+D+EGRVM+P+ALRKRIFYGG+E++LRKEVW FLL
Sbjct  309  EFDKLSLVWGKPRQPPLGKEEWATFMDAEGRVMDPKALRKRIFYGGVEHNLRKEVWTFLL  368

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTY ER+ L SVKK+EYETIK QW+SIS EQA+
Sbjct  369  GYHAYDSTYPEREYLMSVKKAEYETIKRQWQSISPEQAR  407


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAASIQQGSASMTRS+ R+ S++++ +   +    + VA++P QYAS+ I
Sbjct  5    ELHDLSDDADYAASIQQGSASMTRSDSRRLSSTSEPEGAEVVYSKENVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGNSLF  78



>gb|AIU48658.1| RabGAP/TBC domain-containing protein, partial [Buxus sinica]
Length=629

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 4/113 (4%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EE      PL    +FD ++LVWGKPRQP +G +EWATFLDSEGR+++ +AL+KR+FYGG
Sbjct  281  EEIQVAADPL----EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIVDSKALKKRVFYGG  336

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            +E  LRKE+WKFLLGYH+YDSTYAER+ LAS KKSEYETIK QWKSIS EQAK
Sbjct  337  VEYGLRKELWKFLLGYHAYDSTYAEREYLASTKKSEYETIKYQWKSISLEQAK  389



>ref|XP_007013521.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY31140.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
Length=656

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K D DEE   K     +  +FD +SLVWGKPRQP +G +EWATFLDSEGRV++ +ALRKR
Sbjct  293  KVDEDEELPVKSPVAPDPLEFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDSKALRKR  352

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IFYGG+E+ LR+EVW  LLGYH+Y+STYAERK L S+KK+EYETIKNQW+SIS EQAK
Sbjct  353  IFYGGIEHKLRREVWAILLGYHTYESTYAERKYLRSIKKTEYETIKNQWQSISPEQAK  410


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS QQGSASM R +  K S+S++ +   I  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQQGSASMMRCDRGKRSSSSEPEGAEIVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGSSLF  78



>gb|AIU48685.1| RabGAP/TBC domain-containing protein, partial [Platanus x acerifolia]
Length=387

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  390  VQPLINYN--KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            V+PL+  +  +FD ++LVWGKPRQP +G +EWA FLDSEGR+M+ +ALRKRIFYGG+E+ 
Sbjct  147  VEPLVAADPPEFDKLTLVWGKPRQPPLGSEEWAAFLDSEGRIMDSKALRKRIFYGGVEHC  206

Query  564  LRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            LR EVWKFLLGYHSYDSTY ER+ L S K+SEYETIK QW+SIS  QAK
Sbjct  207  LRNEVWKFLLGYHSYDSTYTEREYLISTKRSEYETIKRQWESISPAQAK  255



>gb|AIU48651.1| RabGAP/TBC domain-containing protein, partial [Gossypium raimondii]
Length=624

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 100/134 (75%), Gaps = 4/134 (3%)
 Frame = +3

Query  309  RQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATF  488
            R  NQ     +KSS  K D   +      PL    +FD +SLVWGKPRQP +G +EWATF
Sbjct  255  RNSNQSALDYSKSSEYKEDVPVQSPVDPDPL----EFDKLSLVWGKPRQPPLGLEEWATF  310

Query  489  LDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYET  668
            LDSEGRV++P+ALRKRIFYGG+E+  RKEVW  LLGYHSY+STYAER+   S+KK+EYET
Sbjct  311  LDSEGRVVDPKALRKRIFYGGVEHKFRKEVWAILLGYHSYESTYAEREYQKSIKKTEYET  370

Query  669  IKNQWKSISREQAK  710
            IKNQW+SIS EQAK
Sbjct  371  IKNQWQSISPEQAK  384



>gb|AIU48643.1| RabGAP/TBC domain-containing protein, partial [Magnolia denudata]
Length=622

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EWATF DSEGR+M+ +ALRKRIFYGG+E+ LRKEVWKFLL
Sbjct  290  EFDKLSLVWGKPRQPPLGLEEWATFFDSEGRIMDSKALRKRIFYGGVEHCLRKEVWKFLL  349

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+H+YDSTYAER+ L S+KKSEYETIK+QW+SIS  QAK
Sbjct  350  GFHAYDSTYAEREYLDSIKKSEYETIKHQWQSISPAQAK  388



>ref|XP_002285365.1| PREDICTED: TBC1 domain family member 17 isoform X3 [Vitis vinifera]
Length=657

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+ +ALRKRIFYGG+E+SLRKEVW FLL
Sbjct  313  EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMDSKALRKRIFYGGIEHSLRKEVWTFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDST AER+ L S+KKSEYET+K QW+SIS EQAK
Sbjct  373  GYHAYDSTSAEREYLVSIKKSEYETVKQQWQSISPEQAK  411



>gb|KJB64720.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=527

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+E+  RKEVW  LL
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGVEHKFRKEVWAILL  367

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYHSY+STYAER+   S+KK+EYETIKNQW+SIS EQAK
Sbjct  368  GYHSYESTYAEREYQKSIKKTEYETIKNQWQSISPEQAK  406


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>gb|AIU48681.1| RabGAP/TBC domain-containing protein, partial [Vitis vinifera]
Length=629

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+ +ALRKRIFYGG+E+SLRKEVW FLL
Sbjct  291  EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMDSKALRKRIFYGGIEHSLRKEVWTFLL  350

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDST AER+ L S+KKSEYET+K QW+SIS EQAK
Sbjct  351  GYHAYDSTSAEREYLVSIKKSEYETVKQQWQSISPEQAK  389



>gb|AIU48647.1| RabGAP/TBC domain-containing protein, partial [Theobroma cacao]
Length=603

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++ +ALRKRIFYGG+E+ LR+EVW  LL
Sbjct  265  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDSKALRKRIFYGGIEHKLRREVWAILL  324

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+Y+STYAERK L S+KK+EYETIKNQW+SIS EQAK
Sbjct  325  GYHTYESTYAERKYLRSIKKTEYETIKNQWQSISPEQAK  363



>gb|KJB64721.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=550

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+E+  RKEVW  LL
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGVEHKFRKEVWAILL  367

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYHSY+STYAER+   S+KK+EYETIKNQW+SIS EQAK
Sbjct  368  GYHSYESTYAEREYQKSIKKTEYETIKNQWQSISPEQAK  406


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>gb|AIU48652.1| RabGAP/TBC domain-containing protein, partial [Carica papaya]
Length=628

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +ALRKRIFYGG+E+ LR+EVW FLL
Sbjct  290  EFDKLTLVWGKPRQPPLGPEEWVTFLDSEGRVMDSKALRKRIFYGGIEHKLRREVWAFLL  349

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+Y+ST AER+ L S+KKSEYETIK QW+SIS EQAK
Sbjct  350  GYHAYESTCAEREYLRSIKKSEYETIKQQWQSISAEQAK  388



>gb|KJB64719.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=653

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+E+  RKEVW  LL
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGVEHKFRKEVWAILL  367

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYHSY+STYAER+   S+KK+EYETIKNQW+SIS EQAK
Sbjct  368  GYHSYESTYAEREYQKSIKKTEYETIKNQWQSISPEQAK  406


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>gb|AIU48669.1| RabGAP/TBC domain-containing protein, partial [Erythranthe guttata]
Length=624

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQ  +G QEWATFLD+EGRVM+ +AL KRIFYGGLE++LRKEVW FLL
Sbjct  286  EFDKISLVWGKPRQSPLGQQEWATFLDAEGRVMDSKALIKRIFYGGLEHNLRKEVWTFLL  345

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTYAER  L SVKK+EY+TIK QW+SIS EQAK
Sbjct  346  GYHAYDSTYAERDYLMSVKKTEYDTIKKQWQSISPEQAK  384



>gb|EYU18249.1| hypothetical protein MIMGU_mgv1a002604mg [Erythranthe guttata]
Length=655

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQ  +G QEWATFLD+EGRVM+ +AL KRIFYGGLE++LRKEVW FLL
Sbjct  310  EFDKISLVWGKPRQSPLGQQEWATFLDAEGRVMDSKALIKRIFYGGLEHNLRKEVWTFLL  369

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTYAER  L SVKK+EY+TIK QW+SIS EQAK
Sbjct  370  GYHAYDSTYAERDYLMSVKKTEYDTIKKQWQSISPEQAK  408


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAASIQQGSAS++++  R+ STSN+ D   I    D V ++P QYAS+ I
Sbjct  5    ELHDLSDDADYAASIQQGSASISQNESRRQSTSNEPDGAEIVYTKDNVTIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGNALF  78



>gb|AIU48684.1| RabGAP/TBC domain-containing protein, partial [Cinnamomum camphora]
Length=561

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EWATFLD+EGR+M+ +ALRKRIFYGG+E+SLRKEVWK LL
Sbjct  223  EFDKLSLVWGKPRQPPLGFEEWATFLDAEGRIMDSKALRKRIFYGGVEHSLRKEVWKILL  282

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+H+YDSTYAER+ L S+KK+EYETIK+QW+SIS  QAK
Sbjct  283  GFHAYDSTYAEREYLKSIKKAEYETIKSQWQSISPAQAK  321



>ref|XP_007155039.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
 gb|ESW27033.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
Length=652

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 121/192 (63%), Gaps = 10/192 (5%)
 Frame = +3

Query  159  IQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLR--QIN----  320
            +  GS+S+T  + R     + + D+ I  L     V   ++A +  +   R  QIN    
Sbjct  217  VNNGSSSVTHFHGRPRQKVDPARDISIQVLEKFSLVT--KFARETTSQLFRENQINGFSE  274

Query  321  QGKPILTKSSF-RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLD  494
            +  PI T     R+  H EE  +    L ++  +FDN+SLVWGKPRQP +G +EW  FLD
Sbjct  275  RRTPIQTNIDHPRRSSHVEEKTSDESCLALDSQEFDNLSLVWGKPRQPPLGSEEWIIFLD  334

Query  495  SEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIK  674
            SEGRV + +ALRKR+FYGGL++ LR EVW  LLGY+ YDSTYAER+ L S+KKSEYE IK
Sbjct  335  SEGRVTDSEALRKRVFYGGLDHELRNEVWGLLLGYYPYDSTYAEREFLKSIKKSEYENIK  394

Query  675  NQWKSISREQAK  710
            NQW+SIS  QAK
Sbjct  395  NQWQSISSAQAK  406



>ref|XP_004508469.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Cicer 
arietinum]
Length=518

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EW TFLDSEGRV N +ALRKRIFYGGL++ LR EVW  LL
Sbjct  360  EFDELSLVWGKPRQPPLGSEEWITFLDSEGRVTNSEALRKRIFYGGLDHKLRNEVWGLLL  419

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY+ YDSTYAER+ L SVKKSEYETIKNQW+SIS  QAK
Sbjct  420  GYYPYDSTYAEREFLKSVKKSEYETIKNQWQSISSAQAK  458



>ref|XP_012081205.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Jatropha 
curcas]
Length=660

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 125/197 (63%), Gaps = 13/197 (7%)
 Frame = +3

Query  153  ASIQQGSASMTRSNIRKWSTSNK-SDDVGIACLNDKVAVNPMQYASDWINNQLRQ-INQG  326
              I  GS+S+++   R+   SN  + D+ I  L     V   ++A D  +   R+  N G
Sbjct  218  GDIHNGSSSISQIGGRQRQKSNDPARDLSIQVLEKFSLVT--KFARDTTSQLFRENHNNG  275

Query  327  KPILTKSSFRKHD----HDEEPATKVQPL-----INYNKFDNVSLVWGKPRQPSMGPQEW  479
               + + ++        H   P T+  P+      +  +FD ++LVWGKPRQP +G +EW
Sbjct  276  LGSMDRKNYNHSAVNIPHKTPPGTEEGPIESPVPSDPIEFDKLTLVWGKPRQPPLGSEEW  335

Query  480  ATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSE  659
            ATFLDSEGRVM+ +ALRKRIFYGG+E++LR+EVW FLLGYH+YDSTYAER+ L   KK E
Sbjct  336  ATFLDSEGRVMDSKALRKRIFYGGVEHTLRREVWAFLLGYHAYDSTYAERECLRYNKKLE  395

Query  660  YETIKNQWKSISREQAK  710
            YET+K QW+SIS EQAK
Sbjct  396  YETVKKQWQSISPEQAK  412



>ref|XP_008456989.1| PREDICTED: TBC1 domain family member 15 [Cucumis melo]
Length=655

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EWATFLD+EGRV++  +LRKRIFYGG+E++LRKEVW FLL
Sbjct  311  QFDKLTLVWGKPRQPPLGSEEWATFLDAEGRVLDSTSLRKRIFYGGVEHNLRKEVWAFLL  370

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+H+YDSTYAER+ L S+K+SEY TIKNQW+SIS EQAK
Sbjct  371  GFHAYDSTYAEREYLQSIKRSEYLTIKNQWQSISPEQAK  409


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + STS++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSTSSELEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +LR I QG  + 
Sbjct  61   SERISGRLRLIKQGSCLF  78



>gb|AIU48673.1| RabGAP/TBC domain-containing protein, partial [Phaseolus vulgaris]
Length=623

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 119/189 (63%), Gaps = 10/189 (5%)
 Frame = +3

Query  159  IQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQIN----QG  326
            +  GS+S+T  + R     + + D+ I  L     V   ++A +  +   R+ N    + 
Sbjct  200  VNNGSSSVTHFHGRPRQKVDPARDISIQVLEKFSLVT--KFARETTSQLFRENNGFSERR  257

Query  327  KPILTKSSFRKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEG  503
             PI T     +  H EE  +    L ++  +FDN+SLVWGKPRQP +G +EW  FLDSEG
Sbjct  258  TPIQTHP---RRSHVEEKTSDESCLALDSQEFDNLSLVWGKPRQPPLGSEEWIIFLDSEG  314

Query  504  RVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQW  683
            RV + +ALRKR+FYGGL++ LR EVW  LLGY+ YDSTYAER+ L S+KKSEYE IKNQW
Sbjct  315  RVTDSEALRKRVFYGGLDHELRNEVWGLLLGYYPYDSTYAEREFLKSIKKSEYENIKNQW  374

Query  684  KSISREQAK  710
            +SIS  QAK
Sbjct  375  QSISSAQAK  383



>gb|AIU48663.1| RabGAP/TBC domain-containing protein, partial [Pandanus utilis]
Length=264

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDN-VSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFY  545
            D        P+I  +  DN ++LVWGK RQP +  +EW+ FLDSEGR+M+ +ALRKRIFY
Sbjct  72   DTHTVADETPVIADSLDDNKLNLVWGKSRQPPLCLEEWSAFLDSEGRIMDSKALRKRIFY  131

Query  546  GGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GG+E++LRKEVWKFLLGYH YDSTYAER+ LASVKK+EY+TIK+QW+SIS  QAK
Sbjct  132  GGVEHNLRKEVWKFLLGYHGYDSTYAEREYLASVKKTEYQTIKSQWQSISSAQAK  186



>gb|AIU48687.1| RabGAP/TBC domain-containing protein, partial [Houttuynia cordata]
Length=622

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 99/124 (80%), Gaps = 5/124 (4%)
 Frame = +3

Query  339  TKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNP  518
             KS+  + +  E  ATKV       + D +SLVWGKPRQPS+  +EW TFLDSEGR+ +P
Sbjct  264  VKSNEVQKNSTEVSATKVNM-----EVDKLSLVWGKPRQPSLSLEEWETFLDSEGRITDP  318

Query  519  QALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISR  698
             ALRKR+FYGG+E++LRK++WKFLLGY+SYDSTYAER+ L+S+KKSEY TIK+QWKSIS 
Sbjct  319  SALRKRVFYGGVEHNLRKDIWKFLLGYYSYDSTYAEREYLSSIKKSEYNTIKHQWKSISS  378

Query  699  EQAK  710
            +QA+
Sbjct  379  QQAR  382



>ref|XP_011020167.1| PREDICTED: TBC1 domain family member 15 [Populus euphratica]
Length=660

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EWATFLDSEGRVM+ +AL+KRIFYGG+E++ R+EVW FLL
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWATFLDSEGRVMDSKALKKRIFYGGVEHTTRREVWPFLL  373

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTYAER+ L S KKSEYET++ QW+SIS EQAK
Sbjct  374  GYHAYDSTYAEREYLKSSKKSEYETVRQQWQSISTEQAK  412


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            E+ D SD+  YAAS+QQGSASM  TRS+  + ++S+  +   I  L D V ++P QYAS+
Sbjct  5    ELHDLSDDADYAASLQQGSASMMITRSDSGRSTSSSVPEGAEIVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>gb|AIU48649.1| RabGAP/TBC domain-containing protein, partial [Sarcandra glabra]
Length=355

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 95/114 (83%), Gaps = 5/114 (4%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DE PAT   P+    +FD ++LVWGKPRQP +G +EW+TFLD+EGR+M+ +ALRKRIFYG
Sbjct  7    DEIPATS-DPV----EFDKLTLVWGKPRQPPLGFEEWSTFLDAEGRIMDSKALRKRIFYG  61

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E++LRKEVWK LLG + +DSTYAER+ +AS+KK EYETIK QW+SIS EQAK
Sbjct  62   GVEHNLRKEVWKILLGCYEFDSTYAEREYVASIKKKEYETIKCQWQSISLEQAK  115



>ref|XP_004508468.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Cicer 
arietinum]
Length=705

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQP +G +EW TFLDSEGRV N +ALRKRIFYGGL++ LR EVW  LL
Sbjct  360  EFDELSLVWGKPRQPPLGSEEWITFLDSEGRVTNSEALRKRIFYGGLDHKLRNEVWGLLL  419

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY+ YDSTYAER+ L SVKKSEYETIKNQW+SIS  QAK
Sbjct  420  GYYPYDSTYAEREFLKSVKKSEYETIKNQWQSISSAQAK  458



>ref|XP_004139297.1| PREDICTED: TBC1 domain family member 15 [Cucumis sativus]
 gb|KGN60701.1| hypothetical protein Csa_2G007450 [Cucumis sativus]
Length=655

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +3

Query  369  DEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFY  545
            D E  T   P++ +  +FD ++LVWGKPRQP +G +EWATFLD+EGRV++  +LRKRIFY
Sbjct  295  DLEKVTDDSPVVQDPIQFDKLTLVWGKPRQPPLGSEEWATFLDAEGRVLDSTSLRKRIFY  354

Query  546  GGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GG+E++LRKEVW FLLG+H+Y+STYAER+ L S+K+SEY TIKNQW+SIS EQAK
Sbjct  355  GGVEHNLRKEVWAFLLGFHAYNSTYAEREYLQSIKRSEYLTIKNQWQSISPEQAK  409


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + S+S++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSSSSEHEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +LR I QG  + 
Sbjct  61   SERISGRLRLIKQGSCLF  78



>gb|AIU48639.1| RabGAP/TBC domain-containing protein, partial [Aquilegia coerulea]
Length=625

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWG+PRQP +G +EWATFLD+EGR+++ ++LRKRIFYGGLE+ +R EVWKFLL
Sbjct  287  EFDKLTLVWGQPRQPPLGSEEWATFLDAEGRILDSKSLRKRIFYGGLEHQIRNEVWKFLL  346

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH YDSTYAER+ LASVKK++YET+K+QW+SIS  QA+
Sbjct  347  GYHEYDSTYAEREYLASVKKADYETLKSQWQSISPAQAR  385



>gb|AIU48660.1| RabGAP/TBC domain-containing protein, partial [Chloranthus japonicus]
Length=627

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 104/143 (73%), Gaps = 6/143 (4%)
 Frame = +3

Query  285  SDWINNQLRQINQGKPILTKSSFRKHD-HDEEPATKVQPLINYNKFDNVSLVWGKPRQPS  461
            SD+   Q +   Q  P+ T +S       DE PAT   P+    +FD ++LVWGKPRQP 
Sbjct  250  SDFSAYQGKHQIQSDPVCTGNSNDSQKVSDEIPATS-DPV----EFDKLTLVWGKPRQPP  304

Query  462  MGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLA  641
            MG +EWATFLD+EGR+M+ + LRKRIFYGG+E+SLRKEVWK LLG + +DSTYAER+ L 
Sbjct  305  MGFEEWATFLDAEGRIMDSKGLRKRIFYGGVEHSLRKEVWKLLLGCYEFDSTYAEREYLD  364

Query  642  SVKKSEYETIKNQWKSISREQAK  710
            + KK+EYETIK QW+SIS EQAK
Sbjct  365  ATKKTEYETIKCQWQSISLEQAK  387



>gb|KDO80165.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=356

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +3

Query  402  INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVW  581
            +++ +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW
Sbjct  7    VSFWQFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  66

Query  582  KFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
             FLLGY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  67   AFLLGYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  109



>ref|XP_003609386.1| TBC1 domain family member [Medicago truncatula]
 gb|AES91583.1| RabGAP/TBC domain protein [Medicago truncatula]
Length=666

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FDN+SLVWGKPRQ  +G +EW TF+DSEGRV++ +ALRKRIFYGGL++ LR EVW  LL
Sbjct  321  EFDNLSLVWGKPRQSPLGSKEWITFVDSEGRVIDSEALRKRIFYGGLDHELRNEVWGLLL  380

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY+ YDSTYAER+ L SVKKSEYETIKNQW+SIS  QAK
Sbjct  381  GYYPYDSTYAEREFLKSVKKSEYETIKNQWQSISSAQAK  419



>gb|AIU48666.1| RabGAP/TBC domain-containing protein, partial [Medicago truncatula]
Length=626

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FDN+SLVWGKPRQ  +G +EW TF+DSEGRV++ +ALRKRIFYGGL++ LR EVW  LL
Sbjct  288  EFDNLSLVWGKPRQSPLGSKEWITFVDSEGRVIDSEALRKRIFYGGLDHELRNEVWGLLL  347

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY+ YDSTYAER+ L SVKKSEYETIKNQW+SIS  QAK
Sbjct  348  GYYPYDSTYAEREFLKSVKKSEYETIKNQWQSISSAQAK  386



>gb|KDO80163.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=473

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLL
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  373  GYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  411



>ref|XP_009127224.1| PREDICTED: TBC1 domain family member 15 [Brassica rapa]
Length=672

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQP MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEETYNDIDVPADPLEFNKLSLVWGKPRQPPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            R+FYGG+E+ LRKEVW FLLGYH+Y+STYAER+ L SVK+ EY T+K QW+SISREQAK
Sbjct  368  RVFYGGIEHHLRKEVWPFLLGYHAYESTYAEREYLRSVKQMEYATLKQQWQSISREQAK  426


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R +  K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCDSDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>gb|AIU48656.1| RabGAP/TBC domain-containing protein, partial [Glycine max]
Length=625

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 100/141 (71%), Gaps = 8/141 (6%)
 Frame = +3

Query  297  NNQLRQINQGKPILT---KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMG  467
            NN    I++   I T   KS+  ++  DE P       ++  +FDN+SLVWGKPRQP +G
Sbjct  250  NNGFSPIDRRTHIQTHPKKSNVEENTSDESPVA-----LDSQEFDNLSLVWGKPRQPPLG  304

Query  468  PQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASV  647
             +EW TF+DSEGRV + +ALRKR+FYGGL++ LR EVW  LLGY+ Y+STYAER+ L SV
Sbjct  305  SEEWITFMDSEGRVTDSEALRKRVFYGGLDHKLRNEVWGLLLGYYPYESTYAEREFLKSV  364

Query  648  KKSEYETIKNQWKSISREQAK  710
            KKSEY  IKNQW+SIS  QAK
Sbjct  365  KKSEYVNIKNQWQSISSAQAK  385



>gb|AIU48671.1| RabGAP/TBC domain-containing protein, partial [Prunus persica]
Length=589

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+E+ LRKEVW FLL
Sbjct  290  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGVEHELRKEVWPFLL  349

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDST AER+ L +VKKSE+ETIK QW+SIS EQAK
Sbjct  350  GYHAYDSTEAEREYLRAVKKSEFETIKKQWQSISPEQAK  388



>ref|XP_007204093.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
 gb|EMJ05292.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
Length=622

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+E+ LRKEVW FLL
Sbjct  313  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGVEHELRKEVWPFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDST AER+ L +VKKSE+ETIK QW+SIS EQAK
Sbjct  373  GYHAYDSTEAEREYLRAVKKSEFETIKKQWQSISPEQAK  411


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQHGSASMMRSDSGKHSSSSEHDGAEVVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|ACU19099.1| unknown [Glycine max]
Length=311

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  300  NQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQE  476
            N    I++   I T     K  + EE  +   P++ +  +FDN+SLVWGKPRQP +G +E
Sbjct  85   NGFSPIDRRTHIQTNLDHPKSSNVEENTSVESPVVLDSQEFDNLSLVWGKPRQPPLGSEE  144

Query  477  WATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKS  656
            W  FLDSEGRV + +ALRKR+FYGGL++ L+ EVW  LLGY+ Y+STYAER+ L SVKK 
Sbjct  145  WNAFLDSEGRVTDSEALRKRVFYGGLDHELQNEVWGLLLGYYPYESTYAEREFLKSVKKL  204

Query  657  EYETIKNQWKSISREQAK  710
            EYE IKNQW+SIS  QAK
Sbjct  205  EYENIKNQWQSISSAQAK  222



>emb|CDY27056.1| BnaA02g10760D [Brassica napus]
Length=672

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQP MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEEIYNDIDVPADPLEFNKLSLVWGKPRQPPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            R+FYGG+E+ LRKEVW FLLGYH+Y+STYAER+ L SVK+ EY T+K QW+SISREQAK
Sbjct  368  RVFYGGIEHHLRKEVWPFLLGYHAYESTYAEREYLRSVKQMEYATLKQQWQSISREQAK  426


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R    K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCESDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>gb|KDO80162.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=522

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLL
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  373  GYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  411



>gb|KDO80164.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=496

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLL
Sbjct  151  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLL  210

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  211  GYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  249



>gb|AIU48682.1| RabGAP/TBC domain-containing protein, partial [Lactuca sativa]
Length=351

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SLVWGKPRQ  +  +EW++FLD EGR+M+P AL+KRIFYGG+E++LRKEVW FLL
Sbjct  13   EFDKLSLVWGKPRQHPLEVEEWSSFLDYEGRIMDPDALKKRIFYGGVEHNLRKEVWAFLL  72

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY+SYDSTYAER+ + SVK +EY TIKNQW+SIS EQAK
Sbjct  73   GYYSYDSTYAERQYVVSVKTAEYMTIKNQWQSISPEQAK  111



>gb|AIU48662.1| RabGAP/TBC domain-containing protein, partial [Chimonanthus praecox]
Length=627

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +3

Query  405  NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWK  584
            N ++FD +SLVWGKPRQP +G +EWATFLD EGR+ +  AL+KRIFYGG+E+ LRKEVWK
Sbjct  286  NPSEFDQLSLVWGKPRQPPLGLEEWATFLDVEGRITDSNALKKRIFYGGVEHDLRKEVWK  345

Query  585  FLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            FLLG+++YDSTYAER+ L SVKK EYETIK+QW++IS  QAK
Sbjct  346  FLLGFYAYDSTYAEREYLESVKKLEYETIKSQWQNISPAQAK  387



>gb|KDO80161.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLL
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  373  GYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  411



>gb|KDO80160.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLL
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  373  GYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  411



>gb|AIU48668.1| RabGAP/TBC domain-containing protein, partial [Manihot esculenta]
Length=627

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EWATFLD EGRVM+ +ALRKRIFYGG+E++LR+E+W  LL
Sbjct  289  EFDKLTLVWGKPRQPPLGSEEWATFLDPEGRVMDSKALRKRIFYGGVEHTLRREIWPLLL  348

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTYAER+ L   KK EYET K QW+SIS EQAK
Sbjct  349  GYHTYDSTYAEREFLQHSKKFEYETTKRQWQSISPEQAK  387



>gb|KJB27078.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=656

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 133/221 (60%), Gaps = 14/221 (6%)
 Frame = +3

Query  78   PCLSADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSN-IRKWSTSNKSDDVGIACLND  254
            P + + P  +LARE     +       +   SAS+ + N  R+    + + D+ I  L  
Sbjct  194  PSMPSTP--VLARESTSHENRERPDVGVSDVSASIPQYNGRRRQKFHDPARDISIQVLEK  251

Query  255  KVAVNPMQYASDWINNQLRQI--NQGKPILTKSSFRKHDHDEEPATKVQPLINYN-----  413
               V   ++A +  +   R+   N  +P+  + S +  D+  +P+   + +   +     
Sbjct  252  FSFVT--KFARETTSQLFRESHSNGFRPLERRKSNQSDDYSHKPSDDAEGVAVQSPVAPD  309

Query  414  --KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKF  587
              +FD +SLVWGKPRQP +G +EW TFLDSEGRV++ +ALRKRIFYGG+E+ LRKEVW  
Sbjct  310  PVEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRVVDSKALRKRIFYGGIEHKLRKEVWAI  369

Query  588  LLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            LLGYH+Y+STYAERK   S+KK EYETIK+QW+SIS  QAK
Sbjct  370  LLGYHTYESTYAERKHQRSIKKIEYETIKSQWQSISPAQAK  410


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>ref|XP_008242808.1| PREDICTED: TBC1 domain family member 17 [Prunus mume]
Length=661

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+E+ LRKEVW FLL
Sbjct  313  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGVEHELRKEVWPFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDST AER  L +VKKSE+ETIK QW+SIS EQAK
Sbjct  373  GYHAYDSTEAERLYLRAVKKSEFETIKKQWQSISPEQAK  411


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQHGSASMMRSDSGKHSSSSEHDGAEVVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|AIU48654.1| RabGAP/TBC domain-containing protein, partial [Citrus sinensis]
Length=629

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +3

Query  351  FRKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            F K  +D E      P+  +  +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  AL
Sbjct  269  FDKASYDTETIVNEIPVAPDPVEFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNAL  328

Query  528  RKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQA  707
            RKRIFYGG+++ LR+EVW FLLGY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA
Sbjct  329  RKRIFYGGVDHKLRREVWAFLLGYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQA  388

Query  708  K  710
            +
Sbjct  389  R  389



>gb|AIU48650.1| RabGAP/TBC domain-containing protein, partial [Citrus clementina]
Length=629

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +3

Query  351  FRKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            F K  +D E      P+  +  +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  AL
Sbjct  269  FDKASYDTETIVNEIPVAPDPVEFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNAL  328

Query  528  RKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQA  707
            RKRIFYGG+++ LR+EVW FLLGY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA
Sbjct  329  RKRIFYGGVDHKLRREVWAFLLGYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQA  388

Query  708  K  710
            +
Sbjct  389  R  389



>ref|XP_006475896.1| PREDICTED: TBC1 domain family member 17-like [Citrus sinensis]
 gb|KDO80157.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=658

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLL
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  373  GYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  411



>ref|XP_006450870.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
 gb|ESR64110.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
Length=658

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLL
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  373  GYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  411



>gb|KDO80159.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=630

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLL
Sbjct  285  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLL  344

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  345  GYYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  383



>gb|AIU48648.1| RabGAP/TBC domain-containing protein, partial [Acorus calamus]
Length=550

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D +SLVWGKPRQ  +   EWATFLDSEGRV + +ALRKRIFYGG+EN+LRKEVW+ LLGY
Sbjct  214  DKLSLVWGKPRQSPLNYVEWATFLDSEGRVKDSEALRKRIFYGGVENNLRKEVWRILLGY  273

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H+YDSTYAER+ LASVKKSEYE IK+QW+SIS  QAK
Sbjct  274  HAYDSTYAEREYLASVKKSEYEVIKSQWQSISPAQAK  310



>gb|AIU48659.1| RabGAP/TBC domain-containing protein, partial [Iris japonica]
Length=629

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  411  NKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFL  590
             +FD +SLVWGKPRQP +  +EW TFLDSEGR+M+ +AL KRIFYGGLE+ LRKEVWKFL
Sbjct  290  TEFDKLSLVWGKPRQPPLTHEEWVTFLDSEGRIMDSKALIKRIFYGGLEHKLRKEVWKFL  349

Query  591  LGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            LGY+ Y+STYAER+ L  V+K++YETIK+QWKSIS  QA+
Sbjct  350  LGYYEYESTYAEREYLELVRKTDYETIKSQWKSISEVQAR  389



>ref|XP_003542634.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
Length=656

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  + EE  +   P+ ++  +FDN+SLVWGKPRQP +G +EW TF+DSEGRV + +ALR
Sbjct  289  KKSSNVEENTSDESPVALDSQEFDNLSLVWGKPRQPPLGSEEWITFMDSEGRVTDSEALR  348

Query  531  KRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            KR+FYGGL++ LR EVW  LLGY+ Y+STYAER+ L SVKKSEY  IKNQW+SIS  QAK
Sbjct  349  KRVFYGGLDHKLRNEVWGLLLGYYPYESTYAEREFLKSVKKSEYVNIKNQWQSISSAQAK  408


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+  +  +  I  L D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPREGAE--IVFLKDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPI  335
            AS+ I+ +L+ I Q   +
Sbjct  59   ASERISGRLKLIKQSSSL  76



>gb|AIU48674.1| RabGAP/TBC domain-containing protein, partial [Artemisia annua]
Length=233

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            + D ++LVWGKPRQP +GP+EW TF DSEGRV +  AL++RIFYGG+E+SLRKE+W  LL
Sbjct  16   ELDKLALVWGKPRQPPLGPEEWGTFYDSEGRVEDLNALKERIFYGGVEHSLRKEIWGILL  75

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G +++DSTY ERK + +VKKSEY++IKNQW+SISREQAK
Sbjct  76   GCYAHDSTYTERKHVMAVKKSEYDSIKNQWQSISREQAK  114



>gb|KHN22122.1| TBC1 domain family member 15 [Glycine soja]
Length=656

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  + EE  +   P+ ++  +FDN+SLVWGKPRQP +G +EW TF+DSEGRV + +ALR
Sbjct  289  KKSSNVEENTSDESPVALDSQEFDNLSLVWGKPRQPPLGSEEWITFMDSEGRVTDSEALR  348

Query  531  KRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            KR+FYGGL++ LR EVW  LLGY+ Y+STYAER+ L SVKKSEY  IKNQW+SIS  QAK
Sbjct  349  KRVFYGGLDHKLRNEVWGLLLGYYPYESTYAEREFLKSVKKSEYVNIKNQWQSISSAQAK  408


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+  +  +  I  L D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPREGAE--IVFLKDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPI  335
            AS+ I+ +L+ I Q   +
Sbjct  59   ASERISGRLKLIKQSSSL  76



>gb|AIU48657.1| RabGAP/TBC domain-containing protein, partial [Illicium henryi]
Length=619

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSY  608
            +LVWGK R P +G +EWATFLDSEGR+++ +ALRKRIFYGG+E+SLRKEVWKFLLGYH Y
Sbjct  292  NLVWGKKRLPPLGSEEWATFLDSEGRILDSKALRKRIFYGGVEHSLRKEVWKFLLGYHEY  351

Query  609  DSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            DSTYAER+ LA +KKSEYETIK QW++IS  QAK
Sbjct  352  DSTYAEREYLALIKKSEYETIKRQWENISAAQAK  385



>gb|KCW80045.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=527

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+E+ LR+EVW  LL
Sbjct  183  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGVEHRLRREVWALLL  242

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH++DSTYAER+ L S+KK EYETIK+QW+SIS EQAK
Sbjct  243  GYHAFDSTYAEREYLRSMKKLEYETIKHQWQSISAEQAK  281



>gb|AIU48645.1| RabGAP/TBC domain-containing protein, partial [Pinellia ternata]
Length=624

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +F+ + L+WGKPRQ  +  +EW+ FLDSEGR+M+P ALRKRIFYGG+E+ LRKEVWKFLL
Sbjct  286  EFERLPLIWGKPRQGPLDFKEWSAFLDSEGRIMDPDALRKRIFYGGVEHDLRKEVWKFLL  345

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDST+AER+ +ASVKKSEYE +K+QW+SIS  QAK
Sbjct  346  GYHAYDSTFAEREYIASVKKSEYEILKSQWQSISPAQAK  384



>gb|AIU48655.1| RabGAP/TBC domain-containing protein, partial [Eucalyptus grandis]
Length=624

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+E+ LR+EVW  LL
Sbjct  287  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGVEHRLRREVWALLL  346

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH++DSTYAER+ L S+KK EYETIK+QW+SIS EQAK
Sbjct  347  GYHAFDSTYAEREYLRSMKKLEYETIKHQWQSISAEQAK  385



>ref|XP_010047970.1| PREDICTED: TBC1 domain family member 15 [Eucalyptus grandis]
 gb|KCW80044.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=654

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+E+ LR+EVW  LL
Sbjct  310  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGVEHRLRREVWALLL  369

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH++DSTYAER+ L S+KK EYETIK+QW+SIS EQAK
Sbjct  370  GYHAFDSTYAEREYLRSMKKLEYETIKHQWQSISAEQAK  408


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS +QGS SM RS+  K S+S + +   +  + D V ++P Q+A
Sbjct  1    MHETELHDLSDDADYAASQRQGSVSMQRSDSAKTSSSAEPEGAELVYVKDNVTIHPSQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            ++ I  +L  I QG  +L
Sbjct  61   AERIGGRLMLIKQGACLL  78



>gb|AIU48665.1| RabGAP/TBC domain-containing protein, partial [Aristolochia tagala]
Length=616

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D +SLVWGKPRQP +G  EW  FLDSEGR+ +  +LRKRIFYGG+E+ LRKEVWKFLLG+
Sbjct  280  DKISLVWGKPRQPPLGFDEWTIFLDSEGRITDSDSLRKRIFYGGVEHGLRKEVWKFLLGF  339

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H+YDSTYAER+ L+  KK EYETIK QWK+IS EQAK
Sbjct  340  HAYDSTYAEREYLSVTKKLEYETIKCQWKNISAEQAK  376



>emb|CDY65323.1| BnaC02g44880D [Brassica napus]
Length=672

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQ  MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEEIYNDIDVPADPLEFNKLSLVWGKPRQSPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            R+FYGG+E+ LRKEVW FLLGYH+Y+STYAER+ L SVK+ EY T+K QW+SISREQAK
Sbjct  368  RVFYGGIEHHLRKEVWPFLLGYHAYESTYAEREYLRSVKQMEYATLKQQWQSISREQAK  426


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R +  K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCDSDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>ref|XP_008785780.1| PREDICTED: TBC1 domain family member 15 [Phoenix dactylifera]
Length=666

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD + LVWGK R+P +  +EWA FLDSEGRVM+ +A RKRIFYGG+E++LRKEVWK+LL
Sbjct  321  EFDKLPLVWGKQREPPLCLEEWAAFLDSEGRVMDSKAFRKRIFYGGVEHNLRKEVWKYLL  380

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH YDSTYAER+ LA+VK+SEYE IK+QW+SIS  QAK
Sbjct  381  GYHEYDSTYAEREYLAAVKRSEYEIIKSQWQSISATQAK  419



>gb|AIU48675.1| RabGAP/TBC domain-containing protein, partial [Ricinus communis]
Length=610

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 123/195 (63%), Gaps = 12/195 (6%)
 Frame = +3

Query  153  ASIQQGSASMTRSNIRKWSTSNK-SDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGK  329
             +I +GS+S+ + + R+    N  + D+ I  L     V   ++A +   +QL   N G 
Sbjct  179  GNIHRGSSSIPQHDGRQRHKGNDPARDLSIQVLEKFSLVT--KFARE-TTSQLFWENNGF  235

Query  330  PILTKSSFRKHDHD--------EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWAT  485
              + + S+ +   D        EE + +     +  +FD ++LVWGKPRQP +G +EWAT
Sbjct  236  DAIERKSYNQSSLDCPKTPKDTEEVSIQSAVPSDPLEFDKLTLVWGKPRQPPLGFEEWAT  295

Query  486  FLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYE  665
            FLDSEGRV + +ALRKRIFYGG+ ++LR+EVW FLLGYH+YDST AER+ L   KK EYE
Sbjct  296  FLDSEGRVTDSKALRKRIFYGGVGHTLRREVWAFLLGYHAYDSTSAERECLQYTKKLEYE  355

Query  666  TIKNQWKSISREQAK  710
            T+K QW+SIS EQAK
Sbjct  356  TVKKQWQSISPEQAK  370



>ref|XP_002527173.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35186.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EWATFLDSEGRV + +ALRKRIFYGG+ ++LR+EVW FLL
Sbjct  299  EFDKLTLVWGKPRQPPLGFEEWATFLDSEGRVTDSKALRKRIFYGGVGHTLRREVWAFLL  358

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDST AER+ L   KK EYET+K QW+SIS EQAK
Sbjct  359  GYHAYDSTSAERECLQYTKKLEYETVKKQWQSISPEQAK  397



>ref|XP_011017820.1| PREDICTED: TBC1 domain family member 17-like isoform X3 [Populus 
euphratica]
Length=637

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+E+S  KEVW  LL
Sbjct  329  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGVEHSTCKEVWPLLL  388

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDS YAER+ L S KKSEYET+K QW+SIS EQAK
Sbjct  389  GYHAYDSAYAEREYLKSTKKSEYETVKQQWQSISTEQAK  427


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQG  326
             I+ +L+ I QG
Sbjct  65   RISGRLKLIKQG  76



>ref|XP_003549744.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
 gb|KHN15067.1| TBC1 domain family member 15 [Glycine soja]
Length=655

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  297  NNQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQ  473
            +N    I++   I T     K  + EE  +   P++ +  +FDN+SLVWGKPRQP +G +
Sbjct  269  SNGFSPIDRRTHIQTNLDHPKSSNVEENTSVESPVVLDSQEFDNLSLVWGKPRQPPLGSE  328

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKK  653
            EW  FLDSEGRV + +ALRKR+FYGGL++ L+ EVW  LLGY+ Y+STYAER+ L SVKK
Sbjct  329  EWNAFLDSEGRVTDSEALRKRVFYGGLDHELQNEVWGLLLGYYPYESTYAEREFLKSVKK  388

Query  654  SEYETIKNQWKSISREQAK  710
             EYE IKNQW+SIS  QAK
Sbjct  389  LEYENIKNQWQSISSAQAK  407


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+     ++  +   D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPRNGAEIVFS--KDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+ I Q   + 
Sbjct  59   ASERISGRLKLIKQSSSLF  77



>gb|AIU48690.1| RabGAP/TBC domain-containing protein, partial [Trachycarpus fortunei]
Length=627

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD + LVWGK R+P +  +EWA FLDSEGRVM+ +ALRKRIFYGG+E++LRKEVWK LL
Sbjct  289  EFDKLPLVWGKQREPPLCLEEWAAFLDSEGRVMDSKALRKRIFYGGVEHNLRKEVWKVLL  348

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH YDSTYAER+ LA+VKKSEY  IK+QW+SIS  QAK
Sbjct  349  GYHEYDSTYAEREYLATVKKSEYNIIKSQWQSISATQAK  387



>ref|XP_011017816.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011017817.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
Length=676

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+E+S  KEVW  LL
Sbjct  329  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGVEHSTCKEVWPLLL  388

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDS YAER+ L S KKSEYET+K QW+SIS EQAK
Sbjct  389  GYHAYDSAYAEREYLKSTKKSEYETVKQQWQSISTEQAK  427


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>ref|XP_011017818.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Populus 
euphratica]
Length=661

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+E+S  KEVW  LL
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGVEHSTCKEVWPLLL  373

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDS YAER+ L S KKSEYET+K QW+SIS EQAK
Sbjct  374  GYHAYDSAYAEREYLKSTKKSEYETVKQQWQSISTEQAK  412


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>ref|XP_006372159.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|ERP49956.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=630

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+E+S  KEVW  LL
Sbjct  283  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGVEHSTCKEVWPLLL  342

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTYAER+ L S KKSEYE +K QW+SIS EQAK
Sbjct  343  GYHAYDSTYAEREYLKSTKKSEYEIVKQQWQSISTEQAK  381



>ref|XP_004287286.1| PREDICTED: TBC1 domain family member 15 [Fragaria vesca subsp. 
vesca]
Length=659

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD  SLVWGKPRQP +   EW TFLDSEGR+ + +ALRKRIFYGG+E+ LRKEVW FLL
Sbjct  313  EFDKNSLVWGKPRQPPLEFDEWRTFLDSEGRITDSEALRKRIFYGGVEHKLRKEVWPFLL  372

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTYAER+ L ++KK+E+ET+K QW+SIS EQA+
Sbjct  373  GYHAYDSTYAEREYLKAMKKAEFETVKKQWQSISPEQAR  411



>gb|AIU48670.1| RabGAP/TBC domain-containing protein, partial [Populus trichocarpa]
Length=627

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+E+S  KEVW  LL
Sbjct  289  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGVEHSTCKEVWPLLL  348

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTYAER+ L S KKSEYE +K QW+SIS EQAK
Sbjct  349  GYHAYDSTYAEREYLKSTKKSEYEIVKQQWQSISTEQAK  387



>ref|XP_002324638.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|EEF03203.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=661

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+E+S  KEVW  LL
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGVEHSTCKEVWPLLL  373

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDSTYAER+ L S KKSEYE +K QW+SIS EQAK
Sbjct  374  GYHAYDSTYAEREYLKSTKKSEYEIVKQQWQSISTEQAK  412


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQGSASM  TRS+  K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDADYAASLQQGSASMMMTRSDSGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>ref|XP_006855176.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Amborella 
trichopoda]
 gb|ERN16643.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
Length=688

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 114/168 (68%), Gaps = 7/168 (4%)
 Frame = +3

Query  225  DDVGIACLNDKVAVNPM--QYASDWINNQLRQINQ--GKPILTKSSFRKHDHDEEPATKV  392
            D++G      +V  +P+  Q   D ++ +L+  NQ    P L K + R     E  AT V
Sbjct  283  DNIGGYEKQQQVHSSPVKNQVGGDPVSQELQDKNQIISDP-LEKIACRNGKLCEAAATLV  341

Query  393  QP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSL  566
                LI+  + +  SLVWGKPR P +G +EWATFLD EGR+++ +ALRKRIFYGG+E+ L
Sbjct  342  GTFELIDSKEAEQQSLVWGKPRLPPLGHEEWATFLDEEGRIVDSKALRKRIFYGGVEHGL  401

Query  567  RKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            RKEVWKFLLGY+ + STYAER+ L ++K+SEYETIK+QW+SIS  QA+
Sbjct  402  RKEVWKFLLGYNEFHSTYAEREFLETMKRSEYETIKHQWQSISPAQAR  449



>ref|XP_010911930.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Elaeis guineensis]
Length=532

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = +3

Query  237  IACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNK  416
            I  L+  +A  P+ + S  +   L  + Q   I+  +       D+     V    +  +
Sbjct  135  IVVLSSGLAFPPLYFYSGGVREFLGTLKQHIFIMRSA-------DDANVFLVNDFQDPLQ  187

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLG  596
            FD + LVWGK R+  +   EWA FLDSEGRV++ +ALRKRIFYGG E++LRKEVWKFLLG
Sbjct  188  FDKLPLVWGKQRESPLCLAEWAAFLDSEGRVVDSKALRKRIFYGGAEHNLRKEVWKFLLG  247

Query  597  YHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            YH YDST+AER+ LA+VKKSEY+ IK+QW+SIS  QAK
Sbjct  248  YHEYDSTFAEREYLAAVKKSEYDIIKSQWQSISATQAK  285



>gb|AIU48680.1| RabGAP/TBC domain-containing protein, partial [Schrenkiella parvula]
Length=628

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            KH +DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR+R
Sbjct  271  KHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALRER  330

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            +FYGG+E+ LR+EVW FLLGY++YDSTYAER+ L +VK+ EY T+K QW+SIS EQAK
Sbjct  331  VFYGGIEHQLRREVWPFLLGYYAYDSTYAEREYLRAVKRMEYATLKQQWQSISPEQAK  388



>ref|XP_009363991.1| PREDICTED: TBC1 domain family member 15 [Pyrus x bretschneideri]
Length=658

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +A RKRIFYGG+E+ LRKEVW FLL
Sbjct  312  EFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEAFRKRIFYGGVEHKLRKEVWPFLL  371

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH++DST AER+ L +VKKSE+ETIK QW+SIS EQAK
Sbjct  372  GYHAFDSTDAEREYLRAVKKSEFETIKKQWQSISPEQAK  410


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS++ GSASM RS+  K S+S++ D   +  L D V ++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLRHGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVTIHPTQFTSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I  G  + 
Sbjct  65   SGRLRLIKHGSSLF  78



>ref|XP_010557604.1| PREDICTED: TBC1 domain family member 15 [Tarenaya hassleriana]
Length=669

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EE  T V+   +  +F+ +SLVWGKPRQ  +G +EWA FLDSEGRVM+ +ALR R+FYGG
Sbjct  311  EEIPTDVEVPADPLEFNKMSLVWGKPRQSPLGRREWAAFLDSEGRVMDSKALRDRVFYGG  370

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            +E++LR+EVW FLLGY++YDSTYAER+ L SV++ EY T+K QW+SIS EQAK
Sbjct  371  IEDALRREVWPFLLGYYAYDSTYAEREYLRSVRRMEYATVKQQWQSISPEQAK  423


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E  D SD+  YAAS QQGSASM R +  K S+ ++ +   I  L D VA++P Q+A
Sbjct  1    MEESEFQDLSDDADYAASQQQGSASMMRCDSGKRSSPSEQEGGEIVYLKDNVAIHPTQFA  60

Query  285  SDWINNQLR  311
            S+ I+ +L+
Sbjct  61   SERISGRLK  69



>gb|AIU48689.1| RabGAP/TBC domain-containing protein, partial [Alisma plantago-aquatica]
Length=628

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +F+ +SLVWGKPRQ  MG  EWA FLDSEGR+M+P+AL+++IFYGGL+  LRKE WKFLL
Sbjct  290  EFEKMSLVWGKPRQQPMGFDEWANFLDSEGRIMDPEALKRQIFYGGLKPGLRKEAWKFLL  349

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY+ YDSTYAER+ L+  KK EYETIK+QWKSIS  QA+
Sbjct  350  GYYPYDSTYAEREYLSVTKKGEYETIKSQWKSISSAQAR  388



>ref|XP_006401805.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43258.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=675

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 116/180 (64%), Gaps = 6/180 (3%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFR  356
            S+     R+ +T   S++ G   ++ +    P+    + ++N   + +   P     S+ 
Sbjct  254  SLVTKFARETTTQLFSENNGFGSVDKRWNNQPVHNYDEKLSNIAEEKDHEGP----HSYP  309

Query  357  KHDH--DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            + DH  DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  310  EKDHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALR  369

Query  531  KRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            +R+FYGG+E+ LR+EVW FLLGY++YDSTYAER+ L +VK+ EY T+K QW+SIS EQAK
Sbjct  370  ERVFYGGIEHQLRREVWPFLLGYYAYDSTYAEREYLRAVKRMEYATLKQQWQSISPEQAK  429


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS  QGSASM R +  K S S++ +   +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQLQGSASMMRCDSEKRSLSSEHEGAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_006401806.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43259.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=681

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 116/180 (64%), Gaps = 6/180 (3%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFR  356
            S+     R+ +T   S++ G   ++ +    P+    + ++N   + +   P     S+ 
Sbjct  260  SLVTKFARETTTQLFSENNGFGSVDKRWNNQPVHNYDEKLSNIAEEKDHEGP----HSYP  315

Query  357  KHDH--DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            + DH  DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  316  EKDHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALR  375

Query  531  KRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            +R+FYGG+E+ LR+EVW FLLGY++YDSTYAER+ L +VK+ EY T+K QW+SIS EQAK
Sbjct  376  ERVFYGGIEHQLRREVWPFLLGYYAYDSTYAEREYLRAVKRMEYATLKQQWQSISPEQAK  435


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS  QGSASM R +  K S S++ +   +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQLQGSASMMRCDSEKRSLSSEHEGAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_008377303.1| PREDICTED: TBC1 domain family member 17 [Malus domestica]
Length=660

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD VS+ WG PRQP +G  EW TF+DSEGR++N +A RKRIFYGG+E+ LRKEVW FLL
Sbjct  314  EFDKVSMEWGNPRQPPLGSDEWETFMDSEGRIVNSEAFRKRIFYGGVEHKLRKEVWPFLL  373

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH+YDST AER+ L +  KSE+ET+K QW+SIS EQAK
Sbjct  374  GYHAYDSTDAEREYLRAXXKSEFETVKKQWQSISXEQAK  412


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASLQHGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I  G  + 
Sbjct  65   SGRLRLIKHGSSLF  78



>gb|AIU48664.1| RabGAP/TBC domain-containing protein, partial [Asparagus officinalis]
Length=625

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            K D ++LVWGKPRQ  +G +EW  FLDSEGR+++ +ALRKRIFYGG+E+ LRKE+WKFLL
Sbjct  289  KSDELNLVWGKPRQRPLGVEEWEAFLDSEGRIVDSKALRKRIFYGGVEHGLRKEIWKFLL  348

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDST+AER+ LA+VKK EYETIK+QW++IS  QA+
Sbjct  349  GYYAYDSTFAEREYLAAVKKLEYETIKSQWQNISEAQAR  387



>gb|AIU48640.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis lyrata]
Length=627

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 120/195 (62%), Gaps = 11/195 (6%)
 Frame = +3

Query  150  AASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGK  329
            +A I    +S+ +S +RK  + + + D+ I  L     V   ++A D    QL   N G 
Sbjct  196  SADIGNRVSSVIQSGLRKHKSHDPTRDLSIHLLEKFSLVT--KFARD-TTTQLFSENNGF  252

Query  330  PILTKS----SFRKHDH----DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWAT  485
              + K       R +      DEE +  +    +  +F+ +SLVWGKPRQP MG +E+  
Sbjct  253  GSVDKRWNNLPIRHYSENLLKDEEISNDIDVPADPLEFNKLSLVWGKPRQPPMGHKEFTA  312

Query  486  FLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYE  665
             LDSEGRV+  +ALR+R+FYGG+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY 
Sbjct  313  LLDSEGRVVESKALRERVFYGGIEHQLRREVWPFLLGYYAYDSTYAEREYLRSVKRMEYA  372

Query  666  TIKNQWKSISREQAK  710
            T+K QW+SIS EQAK
Sbjct  373  TLKQQWQSISPEQAK  387



>gb|AIU48677.1| RabGAP/TBC domain-containing protein, partial [Yucca filamentosa]
Length=624

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D ++LVWGKPRQ  +   EW  FLDSEGR+M+ +ALRKRIFYGG+E+++RKE+WKFLLGY
Sbjct  290  DGLNLVWGKPRQKPLSIDEWGDFLDSEGRIMDSKALRKRIFYGGVEHNMRKEIWKFLLGY  349

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            + YDST+AER  LASVKKSEYE IK+QW++IS  QAK
Sbjct  350  YPYDSTFAERNYLASVKKSEYEIIKSQWQNISTAQAK  386



>ref|XP_010911929.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Elaeis guineensis]
Length=667

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD + LVWGK R+  +   EWA FLDSEGRV++ +ALRKRIFYGG E++LRKEVWKFLL
Sbjct  322  EFDKLPLVWGKQRESPLCLAEWAAFLDSEGRVVDSKALRKRIFYGGAEHNLRKEVWKFLL  381

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH YDST+AER+ LA+VKKSEY+ IK+QW+SIS  QAK
Sbjct  382  GYHEYDSTFAEREYLAAVKKSEYDIIKSQWQSISATQAK  420



>gb|AIU48691.1| RabGAP/TBC domain-containing protein, partial [Cabomba caroliniana]
Length=409

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            + D +SLVWGKPR   +G +EW+ FLD+EGR+ + +ALR++IFYGG++  LRKEVWKFLL
Sbjct  77   EIDKLSLVWGKPRLHHLGSEEWSKFLDAEGRITDSKALREQIFYGGVKPQLRKEVWKFLL  136

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQA  707
            GYH YDSTYAER+ LA  KKSEYETIKNQW+SIS  QA
Sbjct  137  GYHEYDSTYAEREYLAVAKKSEYETIKNQWQSISPTQA  174



>gb|AIU48653.1| RabGAP/TBC domain-containing protein, partial [Capsella rubella]
Length=626

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 119/198 (60%), Gaps = 17/198 (9%)
 Frame = +3

Query  150  AASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI------NNQLR  311
            +A +    +S+ +  +RK  + + + D+ I  L     V   ++A D        NN   
Sbjct  195  SADVGNRVSSVNQYGLRKQKSHDPTRDLSIHLLEKFSLVT--KFARDTTTQLFSENNGFG  252

Query  312  QI-----NQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQE  476
             I     NQ  P    + F+    DEE A  V    +  + + +SLVWGKPRQP MG +E
Sbjct  253  SIDKRWNNQPSPHYLDNPFK----DEEIANNVDVPDDPLEVNKLSLVWGKPRQPPMGRKE  308

Query  477  WATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKS  656
            +  FLDSEGRV+  +ALR+R+FYGG+E+ LR EVW FLLGY++YDSTYAER+ L SVK+ 
Sbjct  309  FTAFLDSEGRVVESKALRERVFYGGIEHQLRSEVWPFLLGYYAYDSTYAEREYLRSVKQM  368

Query  657  EYETIKNQWKSISREQAK  710
            EY T+K QW+SIS EQAK
Sbjct  369  EYATLKQQWQSISPEQAK  386



>gb|AIU48641.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis thaliana]
Length=626

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 116/190 (61%), Gaps = 18/190 (9%)
 Frame = +3

Query  174  ASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQG---------  326
            +S+++S  RK  + + + D+ I  L     V   ++A D    QL   N G         
Sbjct  204  SSVSQSGFRKQKSHDPTRDLSIHLLEKFSLVT--KFARD-TTTQLFSENNGFGSIDKRWN  260

Query  327  -KPILTKS-SFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
             +PI   S +  K D          PL    +FD +SL+WGKPRQP MG +E+   LDSE
Sbjct  261  NQPIRHYSENLLKDDEISYIDVPADPL----EFDKLSLMWGKPRQPPMGHKEFTALLDSE  316

Query  501  GRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQ  680
            GRV+  +ALR+R+FYGG+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY T+K Q
Sbjct  317  GRVVESKALRERVFYGGIEHQLRREVWPFLLGYYAYDSTYAEREYLRSVKRMEYATLKQQ  376

Query  681  WKSISREQAK  710
            W+SIS EQAK
Sbjct  377  WQSISPEQAK  386



>ref|XP_011627325.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Amborella 
trichopoda]
Length=661

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSY  608
            SLVWGKPR P +G +EWATFLD EGR+++ +ALRKRIFYGG+E+ LRKEVWKFLLGY+ +
Sbjct  329  SLVWGKPRLPPLGHEEWATFLDEEGRIVDSKALRKRIFYGGVEHGLRKEVWKFLLGYNEF  388

Query  609  DSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
             STYAER+ L ++K+SEYETIK+QW+SIS  QA+
Sbjct  389  HSTYAEREFLETMKRSEYETIKHQWQSISPAQAR  422



>ref|XP_002864184.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40443.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
Length=674

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 125/214 (58%), Gaps = 29/214 (14%)
 Frame = +3

Query  150  AASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD-------------  290
            +A I    +S+ +S +RK  + + + D+ I  L     V   ++A D             
Sbjct  217  SADIGNRVSSVIQSGLRKHKSHDPTRDLSIHLLEKFSLVT--KFARDTTTQLFSENNGFG  274

Query  291  -----WIN-------NQLRQINQGKPILTKSSFRKHD--HDEEPATKVQPLINYNKFDNV  428
                 W N        +L  I + K    + S+ ++D   DEE +  +    +  +F+ +
Sbjct  275  SVDKRWNNLPVHSYPEKLSNIAEEKHNEIRHSYSENDLLKDEEISNDIDVPADPLEFNKL  334

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSY  608
            SLVWGKPRQP MG +E+   LDSEGRV+  +ALR+R+FYGG+E+ LR+EVW FLLGY++Y
Sbjct  335  SLVWGKPRQPPMGHKEFTALLDSEGRVVESKALRERVFYGGIEHQLRREVWPFLLGYYAY  394

Query  609  DSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            DSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  395  DSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  428


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S+ ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSDSGKRSSPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>gb|KJB54007.1| hypothetical protein B456_009G016100 [Gossypium raimondii]
Length=657

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLG  596
             D +SL WGKPRQP +G +EWATFLDSEGRV++ +ALRKRIFYGG+E+ LRKEVW+ LLG
Sbjct  312  LDKLSLAWGKPRQPPLGLEEWATFLDSEGRVVDSKALRKRIFYGGVEHKLRKEVWEILLG  371

Query  597  YHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            Y SY+STYAE++   S +K+EYE IKNQW+SIS EQ K
Sbjct  372  YQSYESTYAEKEYQRSNRKTEYEIIKNQWQSISPEQEK  409


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   EI D SD+  YAAS QQGSASM R    K S+SN+ +   +  + D V ++P Q+A
Sbjct  1    MQETEIHDLSDDADYAASQQQGSASMMRCESGKRSSSNEPEGAEVVYMKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I Q   + 
Sbjct  61   SERISGRLKLIKQSSSLF  78



>ref|XP_006280129.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
 gb|EOA13027.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
Length=672

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 113/180 (63%), Gaps = 6/180 (3%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKP--ILTKSS  350
            S+     R  +T   S++ G   ++ +    P+    + ++N   + +Q  P   L    
Sbjct  251  SLVTKFARDTTTQLFSENNGFGSIDKRWNNQPVHSYPEKLSNIAEEKHQESPHSYLDNDP  310

Query  351  FRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            F+    DEE A  V    +  + + +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  311  FK----DEEIANNVDVPDDPLEVNKLSLVWGKPRQPPMGRKEFTAFLDSEGRVVESKALR  366

Query  531  KRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            +R+FYGG+E+ LR EVW FLLGY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  367  ERVFYGGIEHQLRSEVWPFLLGYYAYDSTYAEREYLRSVKQMEYATLKQQWQSISPEQAK  426


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM R +  K S+ ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRCDSGKRSSPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010482626.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  373  GIEHQLRREVWPFLLGYYTYDSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  426


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010442797.1| PREDICTED: TBC1 domain family member 15-like [Camelina sativa]
Length=672

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  373  GIEHQLRREVWPFLLGYYTYDSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  426


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|NP_200071.2| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96237.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=673

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD +SL+WGKPRQP MG +E+   LDSEGRV+  +ALR+R+FYGG+E+ LR+EVW FLL
Sbjct  329  EFDKLSLMWGKPRQPPMGHKEFTALLDSEGRVVESKALRERVFYGGIEHQLRREVWPFLL  388

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  389  GYYAYDSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  427


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010445073.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  373  GIEHQLRREVWPFLLGYYTYDSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  426


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010482625.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  319  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  378

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  379  GIEHQLRREVWPFLLGYYTYDSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  432


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010482627.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Camelina 
sativa]
Length=679

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  320  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  379

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  380  GIEHQLRREVWPFLLGYYTYDSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  433


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010445069.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  319  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  378

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  379  GIEHQLRREVWPFLLGYYTYDSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  432


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>gb|AIU48661.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
demersum]
Length=615

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = +3

Query  321  QGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
            Q  P++T +        ++ A +V  ++++ +FD + LVWGKPRQPS+  QEW  F+DSE
Sbjct  253  QENPLVTSAPEYGQLDTKKVADEVPVVLDHLEFDKLPLVWGKPRQPSLSLQEWEKFMDSE  312

Query  501  GRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQ  680
            GR+ + ++LR+ +FYGG+++SLRKEVWKFLLG + YDSTYAERK    V+KSEYE+IK Q
Sbjct  313  GRINDSKSLRRHVFYGGVDHSLRKEVWKFLLGCYPYDSTYAERKYQDDVRKSEYESIKCQ  372

Query  681  WKSISREQAK  710
            W+SI  EQAK
Sbjct  373  WQSIYPEQAK  382



>ref|XP_011469988.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 5/113 (4%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DE P  +  PL    +FD  SLVWGKPR P +   EW TFLDSEGR+M+ +ALRKRIFYG
Sbjct  278  DESPVPQ-DPL----EFDKNSLVWGKPRHPPLETDEWHTFLDSEGRIMDSEALRKRIFYG  332

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQA  707
            G+E+ LRKEV  FLLGYH+YDSTYAER+ L + KK+E+ET+K QW+ I  EQA
Sbjct  333  GVEHKLRKEVRPFLLGYHAYDSTYAEREYLKATKKAEFETVKKQWQGIPPEQA  385



>ref|XP_009420718.1| PREDICTED: TBC1 domain family member 15 [Musa acuminata subsp. 
malaccensis]
Length=667

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +3

Query  327  KPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGR  506
            KPI T S  +K D +  P     PL    +F+ + LVWGK R   +  +EWA FLDSEGR
Sbjct  299  KPIST-SDDKKKDSNVIPVA-ADPL----EFEKLPLVWGKQRMHPLCLEEWAAFLDSEGR  352

Query  507  VMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWK  686
            +++ +ALR+RIFYGG++ ++RKEVWKFLLGYH YDSTYAER+ L SVKKSEYE IK+QW+
Sbjct  353  ILDSKALRERIFYGGVDQNIRKEVWKFLLGYHEYDSTYAEREYLTSVKKSEYEVIKSQWQ  412

Query  687  SISREQAK  710
            SIS  QAK
Sbjct  413  SISAVQAK  420



>ref|XP_008362894.1| PREDICTED: TBC1 domain family member 17-like [Malus domestica]
Length=659

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  HD   A +  P+  +  +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +  R
Sbjct  292  QKXSHDSNRAPEKSPVPPDSLEFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEXXR  351

Query  531  KRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            KRIFYGG+E++LRKEVW FLLGYH++ ST AER+ L +VKKSE+ETIK QW+ IS EQAK
Sbjct  352  KRIFYGGVEHNLRKEVWPFLLGYHAFHSTDAEREYLRAVKKSEFETIKKQWQGISPEQAK  411


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D VA++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLQXGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVAIHPTQFVSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|AIU48683.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=615

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = +3

Query  321  QGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
            Q  P++T +        ++ A +V  ++++ +FD + LVWGKPRQP++  QEW  F+DSE
Sbjct  253  QENPLVTSAPEYGQLDTKKVADEVPVVLDHLEFDKLPLVWGKPRQPALSLQEWEKFMDSE  312

Query  501  GRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQ  680
            GR+ + ++LR+ +FYGG+++SLRKEVWKFLLG + YDSTYAERK    V+KSEYE+IK Q
Sbjct  313  GRINDSKSLRRHVFYGGVDHSLRKEVWKFLLGCYPYDSTYAERKYQDDVRKSEYESIKCQ  372

Query  681  WKSISREQAK  710
            W+SI  EQAK
Sbjct  373  WQSIYPEQAK  382



>ref|XP_010687933.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +  +EW TFLDSEGRV++ +ALRKRIFYGG+ + LRKE+W FLL
Sbjct  277  EFDKLALVWGKPRQPPLTKEEWITFLDSEGRVVDSKALRKRIFYGGVSHELRKEIWPFLL  336

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G + Y+STYAER+ L SV+K +YE IK QW+SIS EQAK
Sbjct  337  GCYDYNSTYAEREYLRSVRKQDYEIIKLQWQSISPEQAK  375



>ref|XP_010687932.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=656

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            +FD ++LVWGKPRQP +  +EW TFLDSEGRV++ +ALRKRIFYGG+ + LRKE+W FLL
Sbjct  311  EFDKLALVWGKPRQPPLTKEEWITFLDSEGRVVDSKALRKRIFYGGVSHELRKEIWPFLL  370

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G + Y+STYAER+ L SV+K +YE IK QW+SIS EQAK
Sbjct  371  GCYDYNSTYAEREYLRSVRKQDYEIIKLQWQSISPEQAK  409



>gb|AIU48686.1| RabGAP/TBC domain-containing protein, partial [Ginkgo biloba]
Length=617

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSY  608
            +LVWGKPR P +G +EWATF+DSEGRV++ +ALRKRIFYGG+E++LR+EVWKFLL Y+ +
Sbjct  291  TLVWGKPRLPPLGIEEWATFVDSEGRVVDSKALRKRIFYGGIEHNLRQEVWKFLLDYYKF  350

Query  609  DSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            DSTYAER  LAS KK EY T+K QW+S+S  QAK
Sbjct  351  DSTYAERDYLASTKKEEYRTLKAQWQSVSPSQAK  384



>gb|KFK26862.1| hypothetical protein AALP_AA8G303600 [Arabis alpina]
Length=675

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  +    +  +F  +SLVWGKPRQ  MG +E+  FLDSEGRV++P+ LR+R+FYG
Sbjct  316  DEEISNDIDVPADPLEFTKLSLVWGKPRQSPMGREEFTAFLDSEGRVVDPKGLRERVFYG  375

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            G+E+ LR+EVW FLLGYH+YDST AER+   SVK +EYE +K QWKSIS EQAK
Sbjct  376  GIEHQLRREVWPFLLGYHAYDSTDAEREYHRSVKLTEYEDLKLQWKSISAEQAK  429


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  102  AMLAREIIDPSDNI-YYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQ  278
            +M A E+ D SD+  Y AAS QQGSASM R +  K S+S++ +   +    D VA++P Q
Sbjct  2    SMEASELQDLSDDADYAAASQQQGSASMMRCDSEKRSSSSEHEGAELIYTKDNVAIHPTQ  61

Query  279  YASDWINNQLRQINQ  323
            +AS+ I+ +L+   Q
Sbjct  62   FASERISGRLKLTKQ  76



>gb|AIU48642.1| RabGAP/TBC domain-containing protein, partial [Lilium brownii]
Length=620

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLL  593
            + + + L+WGK RQ  +  +EWA F+D+EGR+++ ++L+KRIFYGG+E++LRKEVWKFLL
Sbjct  282  EINKLPLIWGKQRQSPLCLEEWAAFIDTEGRIIDSESLKKRIFYGGVEHNLRKEVWKFLL  341

Query  594  GYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            GYH Y+STYAER  LAS+KKSEYETIK+QW++IS  QAK
Sbjct  342  GYHEYNSTYAERDYLASIKKSEYETIKSQWQNISAIQAK  380



>gb|AIU48688.1| RabGAP/TBC domain-containing protein, partial [Zea mays]
Length=450

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +  +EW +FLD EGR+M+ +ALRK++FYGG++++LRKEVWKFLLGY
Sbjct  114  DPLPLVWGKQRDHPLSVEEWTSFLDREGRIMDSKALRKKVFYGGVDHALRKEVWKFLLGY  173

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDSTYAER+ LA +K++EYE IK+QWKSIS  QAK
Sbjct  174  HEYDSTYAEREYLAVMKRAEYEVIKSQWKSISATQAK  210



>gb|AIU48679.1| RabGAP/TBC domain-containing protein, partial [Sorghum bicolor]
Length=616

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +  +EW  FLD EGRVM+ +ALRK++FYGG++++LRKEVWKFLLGY
Sbjct  280  DPLPLVWGKQRDRPLSVEEWTAFLDPEGRVMDSKALRKKVFYGGVDHALRKEVWKFLLGY  339

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDSTYAER+ LA++K++EYE +K+QWKSIS  QAK
Sbjct  340  HEYDSTYAEREYLAAMKRAEYEAVKSQWKSISATQAK  376



>ref|NP_001168835.1| uncharacterized protein LOC100382640 [Zea mays]
 gb|ACN30830.1| unknown [Zea mays]
 gb|AFW63576.2| hypothetical protein ZEAMMB73_375304 [Zea mays]
Length=671

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +  +EW +FLD EGR+M+ +ALRK++FYGG++++LRKEVWKFLLGY
Sbjct  328  DPLPLVWGKQRDHPLSVEEWTSFLDREGRIMDSKALRKKVFYGGVDHALRKEVWKFLLGY  387

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDSTYAER+ LA +K++EYE IK+QWKSIS  QAK
Sbjct  388  HEYDSTYAEREYLAVMKRAEYEVIKSQWKSISATQAK  424



>gb|AIU48672.1| RabGAP/TBC domain-containing protein, partial [Panicum virgatum]
Length=628

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +   EW  FLD EGRVM+ +ALRK++FYGG+E+ LRKEVWKFLLGY
Sbjct  292  DPLPLVWGKQRDCPLSVAEWTAFLDPEGRVMDSKALRKKVFYGGVEHVLRKEVWKFLLGY  351

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDSTYAER+ LA++K++EYE IK+QWKSIS  QAK
Sbjct  352  HEYDSTYAEREYLAAMKRAEYEAIKSQWKSISATQAK  388



>ref|XP_002452666.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
 gb|EES05642.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
Length=661

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +  +EW  FLD EGRVM+ +ALRK++FYGG++++LRKEVWKFLLGY
Sbjct  318  DPLPLVWGKQRDRPLSVEEWTAFLDPEGRVMDSKALRKKVFYGGVDHALRKEVWKFLLGY  377

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDSTYAER+ LA++K++EYE +K+QWKSIS  QAK
Sbjct  378  HEYDSTYAEREYLAAMKRAEYEAVKSQWKSISATQAK  414



>gb|AIU48667.1| RabGAP/TBC domain-containing protein, partial [Canna indica]
Length=628

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 95/143 (66%), Gaps = 5/143 (3%)
 Frame = +3

Query  285  SDWINN-QLRQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPS  461
            SD +N  + +Q N    + T SS  K    +       PL    +F+ + L+WGK R   
Sbjct  250  SDGLNAYEKKQQNNYSSVHTSSSDEKEKTSDMSPVASDPL----EFEELRLIWGKQRMHP  305

Query  462  MGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLA  641
            +  +EW +F DSEGR+ + +ALR+RIFYGG+E+ +RK+VWKFLLGYH YDST AER+ LA
Sbjct  306  LSFEEWTSFFDSEGRITDSKALRERIFYGGVEDDIRKKVWKFLLGYHEYDSTDAEREYLA  365

Query  642  SVKKSEYETIKNQWKSISREQAK  710
            SVKKSEY+ IK QWKSIS  QAK
Sbjct  366  SVKKSEYQVIKTQWKSISAAQAK  388



>gb|EEC73873.1| hypothetical protein OsI_08649 [Oryza sativa Indica Group]
Length=682

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  423  NVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYH  602
            N  L WGKPR+  +   EW +FLD EGRVM+ +ALRK++FYGG+++ LRKEVWKFLLGYH
Sbjct  335  NKILAWGKPREQPLSVDEWRSFLDPEGRVMDSKALRKKVFYGGIDHVLRKEVWKFLLGYH  394

Query  603  SYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
             YDSTYAER+ LA +K++EYE IK+QWKSIS  QAK
Sbjct  395  EYDSTYAEREYLAVMKRTEYEAIKSQWKSISSTQAK  430



>ref|NP_001047892.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAD72476.1| GTPase activating protein-like [Oryza sativa Japonica Group]
 dbj|BAF09806.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAG91061.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57667.1| hypothetical protein OsJ_08107 [Oryza sativa Japonica Group]
Length=679

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  423  NVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYH  602
            N  L WGKPR+  +   EW +FLD EGRVM+ +ALRK++FYGG+++ LRKEVWKFLLGYH
Sbjct  337  NKILAWGKPREQPLSVDEWRSFLDPEGRVMDSKALRKKVFYGGIDHVLRKEVWKFLLGYH  396

Query  603  SYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
             YDSTYAER+ LA +K++EYE IK+QWKSIS  QAK
Sbjct  397  EYDSTYAEREYLAVMKRTEYEAIKSQWKSISSTQAK  432



>gb|AIU48676.1| RabGAP/TBC domain-containing protein, partial [Dioscorea oppositifolia]
Length=625

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D+++LVWGKPRQP +  +EWA FLDSEGRV + +ALRKRIFYGG+E++LRKEVWKFLLGY
Sbjct  289  DSLNLVWGKPRQPPLKIEEWAAFLDSEGRVNDSKALRKRIFYGGVEHNLRKEVWKFLLGY  348

Query  600  HSYDSTYAERKLLASVKKSEYETIK  674
            H+YDSTYAER+ L++VKK+EYE IK
Sbjct  349  HTYDSTYAEREYLSAVKKTEYEKIK  373



>dbj|BAA98077.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42472.1| unknown protein [Arabidopsis thaliana]
 gb|ABH11525.1| rabGAP [Arabidopsis thaliana]
Length=338

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  435  VWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDS  614
            +WGKPRQP MG +E+   LDSEGRV+  +ALR+R+FYGG+E+ LR+EVW FLLGY++YDS
Sbjct  1    MWGKPRQPPMGHKEFTALLDSEGRVVESKALRERVFYGGIEHQLRREVWPFLLGYYAYDS  60

Query  615  TYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            TYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  61   TYAEREYLRSVKRMEYATLKQQWQSISPEQAK  92



>ref|XP_001783529.1| predicted protein [Physcomitrella patens]
 gb|EDQ51665.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  399  LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEV  578
            L++  + D+ +LVWG+ R P +G +EWATFLDSEGRV++P+AL+KR+F+GG+E +LR E+
Sbjct  139  LVDGTQNDSPALVWGRARPPPLGHEEWATFLDSEGRVVDPKALKKRVFHGGVEPNLRPEL  198

Query  579  WKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            WKFLLG++ +DSTYAER+ L ++K+ EY+ ++ QWK++S +QA+
Sbjct  199  WKFLLGHYKFDSTYAEREALVALKREEYKVLQTQWKTVSEDQAR  242



>ref|XP_006647781.1| PREDICTED: TBC1 domain family member 15-like [Oryza brachyantha]
Length=635

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSY  608
            SL WGK R+  +  +EW +FLD EGRV++ +ALR +IFYGG+++ LRKEVWKFLLGYH Y
Sbjct  295  SLAWGKQREQPLSVEEWRSFLDPEGRVVDSKALRNKIFYGGVDHVLRKEVWKFLLGYHEY  354

Query  609  DSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            DSTYAER+ LA +K++EYE IK+QWKSIS  QAK
Sbjct  355  DSTYAEREYLAVMKRAEYEAIKSQWKSISSMQAK  388



>gb|AIU48678.1| RabGAP/TBC domain-containing protein, partial [Setaria italica]
Length=628

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +  +EWA FLD EGRVM+ +ALRK++FYGG+++ LR++VWKFLLGY
Sbjct  292  DPLPLVWGKQRDRPLSAEEWAAFLDPEGRVMDSKALRKKVFYGGVDHVLREKVWKFLLGY  351

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDSTYAER+  A++K++EYE IK+QWKSI+  QAK
Sbjct  352  HEYDSTYAEREYHAAMKRAEYEAIKSQWKSITATQAK  388



>gb|AIU48646.1| RabGAP/TBC domain-containing protein, partial [Brachypodium distachyon]
Length=628

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +   EW  FLD EGR+M+ +ALRK++FYGG+++ LRKEVWKFLLGY
Sbjct  292  DELLLVWGKKRGSPLTVDEWRAFLDPEGRIMDSKALRKKVFYGGVDHVLRKEVWKFLLGY  351

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDST AER+ LA++K+ EYE IK+QWKSIS  QAK
Sbjct  352  HEYDSTQAEREYLAAMKREEYEAIKSQWKSISATQAK  388



>ref|XP_004953647.1| PREDICTED: TBC1 domain family member 15-like [Setaria italica]
Length=672

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +  +EWA FLD EGRVM+ +ALRK++FYGG+++ LR++VWKFLLGY
Sbjct  329  DPLPLVWGKQRDRPLSAEEWAAFLDPEGRVMDSKALRKKVFYGGVDHVLREKVWKFLLGY  388

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDSTYAER+  A++K++EYE IK+QWKSI+  QAK
Sbjct  389  HEYDSTYAEREYHAAMKRAEYEAIKSQWKSITATQAK  425



>ref|NP_001190524.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96238.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=690

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 17/116 (15%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQE-----------------WATFLDSEGRVMNPQALRKRIF  542
            +FD +SL+WGKPRQP MG +E                 +   LDSEGRV+  +ALR+R+F
Sbjct  329  EFDKLSLMWGKPRQPPMGHKERRNDISPSIKCRISTEYFTALLDSEGRVVESKALRERVF  388

Query  543  YGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            YGG+E+ LR+EVW FLLGY++YDSTYAER+ L SVK+ EY T+K QW+SIS EQAK
Sbjct  389  YGGIEHQLRREVWPFLLGYYAYDSTYAEREYLRSVKRMEYATLKQQWQSISPEQAK  444


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_003570212.1| PREDICTED: TBC1 domain family member 15 [Brachypodium distachyon]
Length=677

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +   EW  FLD EGR+M+ +ALRK++FYGG+++ LRKEVWKFLLGY
Sbjct  334  DELLLVWGKKRGSPLTVDEWRAFLDPEGRIMDSKALRKKVFYGGVDHVLRKEVWKFLLGY  393

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDST AER+ LA++K+ EYE IK+QWKSIS  QAK
Sbjct  394  HEYDSTQAEREYLAAMKREEYEAIKSQWKSISATQAK  430



>dbj|BAK05291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=680

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVW K R   +  +EW  FLD EGR+M+ +ALRK+IFYGG+++ LRKEVWKFLLGY
Sbjct  337  DELLLVWEKKRGSPLSVEEWRAFLDPEGRIMDSKALRKKIFYGGVDHVLRKEVWKFLLGY  396

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            H YDST AER+ LA++K+ EYE IK+QWKSIS  QAK
Sbjct  397  HEYDSTQAEREYLAAMKREEYEAIKSQWKSISTTQAK  433



>gb|AIU48644.1| RabGAP/TBC domain-containing protein, partial [Musa acuminata]
Length=319

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKK  653
            +WA FLDSEGR+++ +ALR+RIFYGG++ ++RKEVWKFLLGYH YDSTYAER+ L SVKK
Sbjct  1    QWAAFLDSEGRILDSKALRERIFYGGVDQNIRKEVWKFLLGYHEYDSTYAEREYLTSVKK  60

Query  654  SEYETIKNQWKSISREQAK  710
            SEYE IK+QW+SIS  QAK
Sbjct  61   SEYEVIKSQWQSISAVQAK  79



>gb|KDO80158.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=638

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +3

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLG  596
            +D  ++V   P  P   P EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+EVW FLLG
Sbjct  296  YDTETIVNEIPVAPD--PVEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVWAFLLG  353

Query  597  YHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            Y++YDSTYAER+ L  +KKSEYE IK QW+SIS EQA+
Sbjct  354  YYAYDSTYAEREYLRCIKKSEYENIKRQWQSISPEQAR  391



>gb|EMT03185.1| TBC1 domain family member 15 [Aegilops tauschii]
Length=591

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGY  599
            D + LVWGK R   +  +EW  FLD EGR+M+ +ALRK+IFYGG+++ LRKEVWKFLL Y
Sbjct  289  DELLLVWGKKRGNPLSVEEWRAFLDPEGRIMDSKALRKKIFYGGVDHVLRKEVWKFLLSY  348

Query  600  HSYDSTYAERKLLASVKKSEYETIKNQWK  686
            H YDST AER+ LA++K+ EYE IK+QWK
Sbjct  349  HEYDSTQAEREYLAAMKREEYEAIKSQWK  377



>ref|XP_006381119.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 ref|XP_006381120.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 gb|ERP58916.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 gb|ERP58917.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
Length=315

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKS  689
            M+ +AL+KRIFYGG+E++ R+EVW FLLGYH+YDSTYAER+ L S KKSEYET++ QW+S
Sbjct  1    MDSKALKKRIFYGGVEHTTRREVWPFLLGYHAYDSTYAEREYLKSSKKSEYETVRQQWQS  60

Query  690  ISREQAK  710
            IS EQAK
Sbjct  61   ISTEQAK  67



>ref|XP_005649420.1| RabGAP/TBC [Coccomyxa subellipsoidea C-169]
 gb|EIE24876.1| RabGAP/TBC [Coccomyxa subellipsoidea C-169]
Length=656

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +3

Query  375  EPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            E AT V    L++ +  ++ + V   PR P M  +E+ +FL S+GR+ N +A+R R+FY 
Sbjct  315  EAATAVGAFELLDRDLLESATSVRNAPRPPPMHHEEFCSFLGSDGRIANEKAMRARVFYS  374

Query  549  GLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQA  707
            G E  +R+EVWKFLLG +  DST AER  +   KK  Y TIK+QW SI  +QA
Sbjct  375  GCEPEVRREVWKFLLGLYPADSTAAERAAIMKEKKHRYATIKSQWTSIGPDQA  427



>ref|XP_636536.1| RabGAP/TBC domain-containing protein [Dictyostelium discoideum 
AX4]
 gb|EAL63027.1| RabGAP/TBC domain-containing protein [Dictyostelium discoideum 
AX4]
Length=829

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = +3

Query  423  NVSLVWGKPRQPS--MGPQEWATFLDSEGRVM--NPQALRKRIFYGGLENSLRKEVWKFL  590
            N S+  G  R+    M P EW ++ D EGR+   N Q L K+IFYGG+E S+R+EVW FL
Sbjct  484  NFSIELGANRRECNPMSPSEWYSYFDDEGRICLANQQILLKKIFYGGIEESIRQEVWPFL  543

Query  591  LGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQ  704
            LG +S+DSTY+ R+++   K  +Y+T+K QW+SIS EQ
Sbjct  544  LGVYSFDSTYSSREVVKYEKTQQYQTVKRQWESISCEQ  581



>ref|XP_002673421.1| rabGTPase-activating protein [Naegleria gruberi]
 gb|EFC40677.1| rabGTPase-activating protein [Naegleria gruberi]
Length=717

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  447  PRQPS-MGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYA  623
            PR  + +  + W T+ D EGR+ + QAL+++I+YGG+ENS+RKEVWKFLLG++ ++STY+
Sbjct  392  PRMDTPITAESWKTYFDEEGRIKDFQALKEKIYYGGVENSIRKEVWKFLLGFYPHNSTYS  451

Query  624  ERKLLASVKKSEYETIKNQWKSISREQ  704
            ER++L   K+ EY   K+QW +IS  Q
Sbjct  452  EREVLLEEKRKEYYGYKSQWTTISTIQ  478



>ref|XP_003292326.1| hypothetical protein DICPUDRAFT_89768 [Dictyostelium purpureum]
 gb|EGC31138.1| hypothetical protein DICPUDRAFT_89768 [Dictyostelium purpureum]
Length=827

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = +3

Query  423  NVSLVWGKPRQPS--MGPQEWATFLDSEGRVM--NPQALRKRIFYGGLENSLRKEVWKFL  590
            N S+  G  R+    + P EW ++ D EGR+   N Q L K+IFYGG+++S+R++VW FL
Sbjct  484  NFSIELGVNRRECNPLSPSEWYSYFDDEGRICLANQQILLKKIFYGGIDDSIRQDVWPFL  543

Query  591  LGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQ  704
            LG++S+DSTY+ R+++   K  +Y TIK QW+SIS EQ
Sbjct  544  LGFYSFDSTYSSREVVKYEKTQQYFTIKRQWESISCEQ  581



>ref|XP_002972350.1| hypothetical protein SELMODRAFT_97576 [Selaginella moellendorffii]
 gb|EFJ26436.1| hypothetical protein SELMODRAFT_97576 [Selaginella moellendorffii]
Length=337

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKK  653
            +W +FLD EGRV NP  L+KRIF GG+E S+R  VWKFLL + S+DST  ER  L   ++
Sbjct  3    QWNSFLDGEGRVTNPNELKKRIFRGGVEPSMRPLVWKFLLEFFSFDSTSKERDALLVKRR  62

Query  654  SEYETIKNQWKSISREQAK  710
             EY  +K QW+S+S EQAK
Sbjct  63   EEYRVLKAQWQSVSIEQAK  81



>ref|XP_004338737.1| TBC domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR16724.1| TBC domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=418

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+  + PQEW +F D  GR+ N + LRK+IFYGG++ S+R+EVWK+LL Y+ +DST  +R
Sbjct  76   RKAPLSPQEWRSFFDETGRITNERKLRKKIFYGGVDPSIRREVWKYLLRYYPFDSTQEDR  135

Query  630  KLLASVKKSEYETIKNQWKSISREQ  704
             ++   K  EY   K QW+SI+ EQ
Sbjct  136  LIIRQSKAVEYRMYKTQWESITPEQ  160



>ref|XP_007435599.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 17 
[Python bivittatus]
Length=641

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+  +  QEW   LD +GRV++P  LRKRIF GGL  SLRKEVWK+LLGY+ +D+T  E 
Sbjct  266  RESPITEQEWEQHLDPDGRVLDPIGLRKRIFAGGLSMSLRKEVWKYLLGYYCWDNTSEEN  325

Query  630  KLLASVKKSEYETIKNQWKSISREQAK  710
            K     K  EY  +K QWKS+S EQ +
Sbjct  326  KAQVRRKTDEYFRMKLQWKSVSEEQEQ  352



>ref|XP_002971826.1| hypothetical protein SELMODRAFT_96534 [Selaginella moellendorffii]
 gb|EFJ26743.1| hypothetical protein SELMODRAFT_96534 [Selaginella moellendorffii]
Length=351

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  459  SMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLL  638
            S+   +W +FLD EGRV +P  L+KRIF GG+E S+R  VWKFLL + S+DST  +R  L
Sbjct  12   SLARFQWNSFLDGEGRVTDPNELKKRIFRGGVEPSMRPLVWKFLLEFFSFDSTSKQRDAL  71

Query  639  ASVKKSEYETIKNQWKSISREQAK  710
               ++ EY  +K QW+S+S EQAK
Sbjct  72   LVKRREEYRVLKAQWQSVSIEQAK  95



>ref|XP_001642096.1| predicted protein [Nematostella vectensis]
 gb|EDO50033.1| predicted protein, partial [Nematostella vectensis]
Length=491

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+  +   EW T LD  GRV+N + L +RIF GG+  SLR +VW+FLLGY+ Y  T+  R
Sbjct  163  REEPLSEDEWRTMLDKSGRVINIKKLHERIFRGGISPSLRGDVWRFLLGYYKYGCTFESR  222

Query  630  KLLASVKKSEYETIKNQWKSISREQAK  710
            K L   K+ EY+T+K QW++IS +Q K
Sbjct  223  KTLCRAKEDEYQTMKMQWQTISAKQEK  249



>ref|XP_002190300.1| PREDICTED: TBC1 domain family member 15 [Taeniopygia guttata]
Length=667

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 85/161 (53%), Gaps = 16/161 (10%)
 Frame = +3

Query  258  VAVNPMQYASDWINNQLR---QINQGKPILTKSSFR-------KHDHDEEPATKVQPLIN  407
            V +      +++I   LR   Q NQ +P    + F        K +  EEP  +V   IN
Sbjct  226  VTMGKFSKVTNYIVGSLRSSDQANQRRPPSEMADFLNDAIPGLKINQQEEPGFEVITRIN  285

Query  408  YNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKF  587
              K   VS      R+  +  +EWA  +DSEGR+++   +++ IF GGL ++LRKE WKF
Sbjct  286  LGKQPEVS------RREPVSAEEWAKNMDSEGRILDVDYIKRLIFKGGLCHTLRKEAWKF  339

Query  588  LLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            LLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  340  LLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  380



>ref|XP_005242171.1| PREDICTED: TBC1 domain family member 15 [Falco peregrinus]
Length=698

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 73/118 (62%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K + +EEP  +V   I+  K  +VS      R+P +  +EWA  +DSEGR++N   +++ 
Sbjct  300  KINQEEEPGFEVITRIDLGKQPDVS-----RREPVLA-EEWAKNMDSEGRILNVDYIKQS  353

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  354  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERASLQKRKTDEYFRMKLQWKSVSEEQEK  411



>ref|XP_008327394.1| PREDICTED: TBC1 domain family member 17 [Cynoglossus semilaevis]
Length=642

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +3

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKK  653
            +W  FLD+EGRVMNP+ ++K +F GG+++SLRKEVW FLLG++ ++ST  ER+ + S K 
Sbjct  277  KWEEFLDAEGRVMNPEHIKKLVFKGGIQSSLRKEVWMFLLGFYPWNSTAKEREDILSSKT  336

Query  654  SEYETIKNQWKSISREQ  704
             EY  +K QW+SIS EQ
Sbjct  337  DEYFRMKVQWRSISEEQ  353



>ref|XP_005991037.1| PREDICTED: TBC1 domain family member 17 [Latimeria chalumnae]
Length=653

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+  +  QEW   LD+ GRV+N   L++RIF GGL + +RKEVWKFLLGY  +DST  ER
Sbjct  278  REEPVSEQEWEGHLDAAGRVLNVDKLKQRIFKGGLSHEIRKEVWKFLLGYFPWDSTSEER  337

Query  630  KLLASVKKSEYETIKNQWKSISREQAK  710
            + L   K  EY  +K QWKS++ EQ +
Sbjct  338  QALVKRKADEYFRMKLQWKSVTEEQER  364



>ref|XP_005081528.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Mesocricetus 
auratus]
Length=672

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N +++++R
Sbjct  271  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKSVDSEGRLLNVESMKQR  324

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL +SLRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  325  IFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  382



>gb|KFZ52722.1| TBC1 domain family member 15, partial [Caprimulgus carolinensis]
Length=483

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  86   KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKSMDSEGRILNADYIKQL  139

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  140  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  197



>ref|XP_010176692.1| PREDICTED: TBC1 domain family member 15, partial [Caprimulgus 
carolinensis]
Length=498

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  101  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKSMDSEGRILNADYIKQL  154

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  155  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  212



>ref|XP_005081527.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Mesocricetus 
auratus]
Length=689

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N +++++R
Sbjct  288  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKSVDSEGRLLNVESMKQR  341

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL +SLRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  342  IFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  399



>gb|KFZ49120.1| TBC1 domain family member 15, partial [Podiceps cristatus]
Length=658

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N + +++ 
Sbjct  260  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVEYIKRL  313

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  314  IFKGGLCHALRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  371



>ref|XP_007531341.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Erinaceus 
europaeus]
Length=445

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N + +++ 
Sbjct  42   KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVENMKQM  95

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL + LRK+ WKFLLGY  +DST  ER LL   K  EY  +K QWKS+S EQ K
Sbjct  96   IFRGGLSHVLRKQAWKFLLGYFPWDSTKEERTLLQKQKTDEYFRMKLQWKSVSEEQEK  153



>ref|XP_010123979.1| PREDICTED: TBC1 domain family member 15 [Chlamydotis macqueenii]
Length=690

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  292  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKRL  345

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  346  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  403



>gb|ERE88321.1| TBC1 domain family member 15-like protein [Cricetulus griseus]
Length=655

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N + +++R
Sbjct  253  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKSVDSEGRLLNVENMKQR  306

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL +SLRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  307  IFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  364



>ref|XP_002406773.1| rabGAP domain-containing protein, putative [Ixodes scapularis]
 gb|EEC03560.1| rabGAP domain-containing protein, putative [Ixodes scapularis]
Length=504

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R   +G  EWA   D+EGRVM+ Q LR+RIF GG+E  LRKEVW FLL Y+S++STY ER
Sbjct  103  RSDPLGHIEWALSYDNEGRVMHEQELRERIFRGGVEPELRKEVWTFLLDYYSFESTYKER  162

Query  630  KLLASVKKSEYETIKNQWKSISREQ  704
            +      K +Y  +K QWKS S +Q
Sbjct  163  EARRKSLKDDYYRMKLQWKSFSEDQ  187



>ref|XP_009975733.1| PREDICTED: TBC1 domain family member 15, partial [Tauraco erythrolophus]
 gb|KFU99368.1| TBC1 domain family member 15, partial [Tauraco erythrolophus]
Length=659

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQS  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  372



>ref|XP_009863167.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15-like, 
partial [Apaloderma vittatum]
Length=552

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ IF GG
Sbjct  159  EEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQSIFKGG  212

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            L ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  213  LSHTLRKEAWKFLLGYFPWNSTKEERANLQRRKTDEYFRMKLQWKSVSEEQEK  265



>ref|XP_007638185.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Cricetulus 
griseus]
 ref|XP_007637007.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Cricetulus 
griseus]
Length=709

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N + +++R
Sbjct  307  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKSVDSEGRLLNVENMKQR  360

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL +SLRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  361  IFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  418



>ref|XP_009946918.1| PREDICTED: TBC1 domain family member 15, partial [Leptosomus 
discolor]
 gb|KFQ08803.1| TBC1 domain family member 15, partial [Leptosomus discolor]
Length=659

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKRL  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  372



>gb|KFP37050.1| TBC1 domain family member 15, partial [Chlamydotis macqueenii]
Length=659

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKRL  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  372



>ref|XP_010560088.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Haliaeetus 
leucocephalus]
Length=667

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  269  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQL  322

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  323  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  380



>gb|EOA97812.1| TBC1 domain family member 15, partial [Anas platyrhynchos]
Length=661

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  278  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSTEEWAKNMDSEGRILNVDYIKQS  331

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  332  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  389



>ref|XP_009461518.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15 
[Nipponia nippon]
Length=686

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ IF GG
Sbjct  293  EEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQLIFKGG  346

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            L +SLRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  347  LCHSLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  399



>ref|XP_011572962.1| PREDICTED: TBC1 domain family member 15 [Aquila chrysaetos canadensis]
Length=667

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  269  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQL  322

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  323  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  380



>ref|XP_005024460.1| PREDICTED: TBC1 domain family member 15 [Anas platyrhynchos]
Length=695

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  297  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSTEEWAKNMDSEGRILNVDYIKQS  350

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  351  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  408



>ref|XP_008938492.1| PREDICTED: TBC1 domain family member 21, partial [Merops nubicus]
Length=554

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  156  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVNYIKQL  209

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  210  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  267



>ref|XP_009584974.1| PREDICTED: TBC1 domain family member 15, partial [Fulmarus glacialis]
Length=659

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQL  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  372



>ref|XP_008354495.1| PREDICTED: GTPase-activating protein gyp7-like [Malus domestica]
Length=398

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  HD   A +  P+  +  +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +A+R
Sbjct  292  QKXSHDSNRAPEKSPVPPDSLEFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEAIR  351

Query  531  KRIFYGGLENSLRKEVWKFLLGYHSYD  611
            KRIFYGG+E++LRKEV+  LL   +YD
Sbjct  352  KRIFYGGVEHNLRKEVF-ILLYVGNYD  377


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D VA++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLQXGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVAIHPTQFVSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>ref|XP_005358112.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Microtus 
ochrogaster]
Length=673

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+  +  +EW   +DSEGR++N ++++++IF GGL +SLRK+ WKFLLGY  +DST  ER
Sbjct  296  RREPVSLEEWTKSVDSEGRLLNVESMKQKIFRGGLSHSLRKQAWKFLLGYFPWDSTKEER  355

Query  630  KLLASVKKSEYETIKNQWKSISREQAK  710
              L   K  EY  +K QWKSIS EQ K
Sbjct  356  AQLQKQKTDEYFRMKLQWKSISEEQEK  382



>gb|KFQ18609.1| TBC1 domain family member 15, partial [Merops nubicus]
Length=555

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  157  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVNYIKQL  210

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  211  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  268



>gb|KFP24887.1| TBC1 domain family member 15, partial [Colius striatus]
Length=524

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQS  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  372



>gb|KGL95544.1| TBC1 domain family member 15, partial [Charadrius vociferus]
Length=660

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  262  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVNYIKRL  315

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  316  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKEKTDEYFRMKLQWKSVSDEQEK  373



>ref|XP_010196615.1| PREDICTED: TBC1 domain family member 15, partial [Colius striatus]
Length=523

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQS  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  372



>ref|XP_005358111.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Microtus 
ochrogaster]
Length=690

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+  +  +EW   +DSEGR++N ++++++IF GGL +SLRK+ WKFLLGY  +DST  ER
Sbjct  313  RREPVSLEEWTKSVDSEGRLLNVESMKQKIFRGGLSHSLRKQAWKFLLGYFPWDSTKEER  372

Query  630  KLLASVKKSEYETIKNQWKSISREQAK  710
              L   K  EY  +K QWKSIS EQ K
Sbjct  373  AQLQKQKTDEYFRMKLQWKSISEEQEK  399



>gb|KFV88938.1| TBC1 domain family member 15, partial [Fulmarus glacialis]
Length=660

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  262  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQL  315

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  316  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  373



>ref|XP_009504749.1| PREDICTED: TBC1 domain family member 15, partial [Phalacrocorax 
carbo]
 gb|KFW91990.1| TBC1 domain family member 15, partial [Phalacrocorax carbo]
Length=659

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQL  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  372



>gb|KFM03402.1| TBC1 domain family member 15, partial [Aptenodytes forsteri]
Length=659

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQL  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  372



>ref|XP_009271513.1| PREDICTED: TBC1 domain family member 15 [Aptenodytes forsteri]
Length=664

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  266  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKQL  319

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  320  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  377



>gb|KFP22081.1| TBC1 domain family member 15, partial [Egretta garzetta]
Length=657

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ IF GG
Sbjct  264  EEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKRLIFKGG  317

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            L ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  318  LCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  370



>ref|XP_009644606.1| PREDICTED: TBC1 domain family member 15 [Egretta garzetta]
Length=695

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ IF GG
Sbjct  302  EEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVDYIKRLIFKGG  355

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            L ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  356  LCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  408



>ref|XP_009085252.1| PREDICTED: TBC1 domain family member 15 [Serinus canaria]
Length=667

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 85/161 (53%), Gaps = 16/161 (10%)
 Frame = +3

Query  258  VAVNPMQYASDWINNQLR---QINQGKPILTKSSFR-------KHDHDEEPATKVQPLIN  407
            V +      +++I   LR   Q NQ +P    + F        K +  EEP  +V   I+
Sbjct  226  VTMGKFSKVTNYIVGSLRSSDQSNQRRPPSEMADFLNDTIPGLKINQQEEPGFEVITRID  285

Query  408  YNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKF  587
              K   VS      R+  +  +EWA  +DSEGR+++   +++ IF GGL ++LRKE WKF
Sbjct  286  LGKQPEVS------RREPVSAEEWAKNMDSEGRILDVDYIKRLIFKGGLCHTLRKEAWKF  339

Query  588  LLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            LLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  340  LLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  380



>gb|KFP53694.1| TBC1 domain family member 15, partial [Cathartes aura]
Length=659

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   V+      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  261  KINQQEEPGFEVITRIDLGKQPEVT------RREPVSAEEWAKNMDSEGRILNVDYIKRL  314

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  315  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKSKTDEYFRMKLQWKSVSEEQEK  372



>ref|NP_001072902.1| TBC1 domain family, member 17 [Xenopus (Silurana) tropicalis]
 gb|AAI21503.1| TBC1 domain family, member 17 [Xenopus (Silurana) tropicalis]
Length=651

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            RQ  +  QEW ++ D EG V+  +AL++RIF GGL    RKE WKFLLGY+S++ST  ER
Sbjct  276  RQEPVSEQEWESYFDPEGHVVEVEALKRRIFSGGLSPGTRKEAWKFLLGYYSWNSTVEER  335

Query  630  KLLASVKKSEYETIKNQWKSISREQAK  710
            K     K  EY  +K QWKS++ +Q K
Sbjct  336  KTTVREKTDEYFRMKLQWKSVTEDQEK  362



>dbj|BAE87494.1| unnamed protein product [Macaca fascicularis]
Length=341

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N  ++++ 
Sbjct  172  KINQQEEPGFEVITRIDLGERPVVQ------RKEPVSLEEWTKNIDSEGRILNVDSMKQM  225

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S+EQ K
Sbjct  226  IFRGGLSHALRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSQEQEK  283



>ref|XP_005480662.1| PREDICTED: TBC1 domain family member 15 [Zonotrichia albicollis]
Length=666

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 85/161 (53%), Gaps = 16/161 (10%)
 Frame = +3

Query  258  VAVNPMQYASDWINNQLR---QINQGKPILTKSSF-------RKHDHDEEPATKVQPLIN  407
            V +      +++I   LR   Q NQ +P    + F        K +  EEP  +V   I+
Sbjct  225  VTMGKFSKVTNYIVGTLRSSDQSNQRRPPSEMADFFNDTIPGLKINQQEEPGFEVITRID  284

Query  408  YNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKF  587
              K   VS      R+  +  +EWA  +DSEGR+++   +++ IF GGL ++LRKE WKF
Sbjct  285  LGKQPEVS------RREPVSAEEWAKNMDSEGRILDVDYIKRLIFKGGLCHTLRKEAWKF  338

Query  588  LLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            LLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  339  LLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  379



>ref|XP_007531340.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Erinaceus 
europaeus]
Length=575

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N + +++ 
Sbjct  172  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVENMKQM  225

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL + LRK+ WKFLLGY  +DST  ER LL   K  EY  +K QWKS+S EQ K
Sbjct  226  IFRGGLSHVLRKQAWKFLLGYFPWDSTKEERTLLQKQKTDEYFRMKLQWKSVSEEQEK  283



>ref|XP_004602734.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Sorex araneus]
Length=674

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N +++++ 
Sbjct  271  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVESMKQM  324

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL +SLRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  325  IFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  382



>ref|XP_010078295.1| PREDICTED: TBC1 domain family member 15 [Pterocles gutturalis]
Length=656

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ IF GG
Sbjct  269  EEPGFEVITRIDLGKQPEVS------RREPVSTEEWANNMDSEGRILNVDYIKRLIFKGG  322

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            L ++LRKE WKFLLGY  + ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  323  LCHTLRKEAWKFLLGYFPWHSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  375



>ref|XP_007531339.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Erinaceus 
europaeus]
Length=592

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N + +++ 
Sbjct  189  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVENMKQM  242

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL + LRK+ WKFLLGY  +DST  ER LL   K  EY  +K QWKS+S EQ K
Sbjct  243  IFRGGLSHVLRKQAWKFLLGYFPWDSTKEERTLLQKQKTDEYFRMKLQWKSVSEEQEK  300



>ref|XP_004602733.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Sorex araneus]
Length=691

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N +++++ 
Sbjct  288  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVESMKQM  341

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL +SLRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  342  IFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  399



>ref|XP_005143065.1| PREDICTED: TBC1 domain family member 15 [Melopsittacus undulatus]
Length=667

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +D+EGR++N   +++ 
Sbjct  269  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDAEGRILNVDYIKQS  322

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  323  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  380



>ref|XP_009886127.1| PREDICTED: TBC1 domain family member 15 [Charadrius vociferus]
Length=770

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ IF GG
Sbjct  377  EEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVNYIKRLIFKGG  430

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            L ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  431  LCHTLRKEAWKFLLGYFPWNSTKEERANLQKEKTDEYFRMKLQWKSVSDEQEK  483



>gb|KFV12457.1| TBC1 domain family member 15, partial [Pterocles gutturalis]
Length=652

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ IF GG
Sbjct  265  EEPGFEVITRIDLGKQPEVS------RREPVSTEEWANNMDSEGRILNVDYIKRLIFKGG  318

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            L ++LRKE WKFLLGY  + ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  319  LCHTLRKEAWKFLLGYFPWHSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  371



>dbj|BAE00843.1| unnamed protein product [Macaca fascicularis]
Length=445

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N  ++++ 
Sbjct  42   KINQQEEPGFEVITRIDLGERPVVQ------RKEPVSLEEWTKNIDSEGRILNVDSMKQM  95

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S+EQ K
Sbjct  96   IFRGGLSHALRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSQEQEK  153



>ref|XP_005795977.1| PREDICTED: TBC1 domain family member 15-like [Xiphophorus maculatus]
Length=655

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 66/116 (57%), Gaps = 6/116 (5%)
 Frame = +3

Query  363  DHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIF  542
            +  EEP  +V   I+      VS      R   +   EW+   D EGR+ N  ALR+RIF
Sbjct  272  NQQEEPGFEVITRIDLGTRPQVS------RAEPVSADEWSKHQDPEGRIENEAALRQRIF  325

Query  543  YGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
             GGL +++R+E WKFLLGY+ + ST  ERK L   K  EY  +K QWKSIS EQ +
Sbjct  326  KGGLCHAMRREAWKFLLGYYPWTSTLEERKSLQKAKTDEYFRMKLQWKSISEEQER  381



>ref|XP_006989060.1| PREDICTED: TBC1 domain family member 15 [Peromyscus maniculatus 
bairdii]
Length=637

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N +++++ 
Sbjct  234  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKSVDSEGRLLNVESMKQM  287

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL +SLRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  288  IFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  345



>ref|XP_008153766.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15 
[Eptesicus fuscus]
Length=765

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N   +++ 
Sbjct  362  KINQQEEPGFEVITRIDLGERPVVQ------RRDPVSLEEWTKNIDSEGRILNVDTMKQM  415

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+VWKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  416  IFRGGLSHALRKQVWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  473



>ref|XP_007441051.1| PREDICTED: TBC1 domain family member 15 [Python bivittatus]
Length=662

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K           RQP +  +EW   +DSEGR++N  ++++ 
Sbjct  265  KINQQEEPGFEVITRIDLGKRPE-----AHRRQP-VSVEEWTKNMDSEGRILNVDSIKQM  318

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKEVWKFLLGY+ ++ST  ER  +   K  EY  +K QWKS+S EQ K
Sbjct  319  IFRGGLCHALRKEVWKFLLGYYPWNSTRDERTSMQKRKTDEYFRMKLQWKSVSEEQEK  376



>gb|EFA85722.1| RabGAP/TBC domain-containing protein [Polysphondylium pallidum 
PN500]
Length=783

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = +3

Query  462  MGPQEWATFLDSEGRV--MNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKL  635
            +   EW ++ D EGR+  MN Q L+K+IFYGG+  S+R EVW FLL ++ +DST++ R++
Sbjct  478  LNANEWYSYFDEEGRISIMNQQLLQKKIFYGGVHESIRAEVWPFLLNFYPFDSTHSTREV  537

Query  636  LASVKKSEYETIKNQWKSISREQ  704
            +   K  EY TIK QW+SIS +Q
Sbjct  538  IKYEKTREYFTIKKQWQSISADQ  560



>ref|XP_010223867.1| PREDICTED: TBC1 domain family member 15 [Tinamus guttatus]
Length=703

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   V+      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  305  KINQQEEPGFEVITRIDLGKQPEVT------RREPVTAEEWAKNMDSEGRILNVDYIKQL  358

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  359  IFKGGLCHALRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  416



>emb|CAF89095.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=424

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+P +  ++W+   DSEG++ +   L++ IF GGL +++RKE WKFLLGY  +DST  ER
Sbjct  188  RKPPVSVEDWSRHQDSEGKMRDVPHLKQAIFKGGLCSAVRKEAWKFLLGYFPWDSTLEER  247

Query  630  KLLASVKKSEYETIKNQWKSISREQAK  710
            K+L  VK  EY  +K QWKSIS EQ +
Sbjct  248  KVLQRVKTDEYYRMKLQWKSISEEQER  274



>gb|KGL84754.1| TBC1 domain family member 15, partial [Tinamus guttatus]
Length=660

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   V+      R+  +  +EWA  +DSEGR++N   +++ 
Sbjct  262  KINQQEEPGFEVITRIDLGKQPEVT------RREPVTAEEWAKNMDSEGRILNVDYIKQL  315

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  316  IFKGGLCHALRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  373



>ref|XP_006719630.1| PREDICTED: TBC1 domain family member 15 isoform X5 [Homo sapiens]
 ref|XP_011536984.1| PREDICTED: TBC1 domain family member 15 isoform X5 [Homo sapiens]
 ref|XP_011536985.1| PREDICTED: TBC1 domain family member 15 isoform X5 [Homo sapiens]
 gb|EAW97276.1| TBC1 domain family, member 15, isoform CRA_d [Homo sapiens]
 dbj|BAF84995.1| unnamed protein product [Homo sapiens]
Length=445

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N   +++ 
Sbjct  42   KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVDNMKQM  95

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKSIS+EQ K
Sbjct  96   IFRGGLSHALRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSISQEQEK  153



>ref|XP_005039952.1| PREDICTED: TBC1 domain family member 15 [Ficedula albicollis]
Length=674

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR+++   +++ 
Sbjct  282  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILDVDYIKRL  335

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  336  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  393



>ref|XP_005469062.1| PREDICTED: TBC1 domain family member 17 [Oreochromis niloticus]
Length=628

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKK  653
            +W  FLDSEGRV  P+ +++ +F GG+ +SLRKEVWKFLLG++ ++ST  ER+ +  VK 
Sbjct  278  KWEEFLDSEGRVTCPEKIKELVFRGGITHSLRKEVWKFLLGFYPWNSTAKEREDILRVKT  337

Query  654  SEYETIKNQWKSISREQ  704
             EY  +K QWKS+S EQ
Sbjct  338  DEYFRMKVQWKSVSEEQ  354



>ref|XP_010753848.1| PREDICTED: TBC1 domain family member 17 [Larimichthys crocea]
Length=627

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKK  653
            +W  FLD EGRV NP+ +++ +F GG++ SLRKEVWKFLLG++ ++ST  ER+ +  VK 
Sbjct  277  KWEEFLDPEGRVQNPERIKELVFRGGIKPSLRKEVWKFLLGFYPWNSTTKEREDILRVKT  336

Query  654  SEYETIKNQWKSISREQ  704
             EY  +K QWKS+S EQ
Sbjct  337  DEYFRMKVQWKSVSEEQ  353



>ref|XP_005884185.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Myotis brandtii]
Length=748

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N   +++ 
Sbjct  345  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVDNMKQM  398

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+VWKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  399  IFRGGLSHALRKQVWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  456



>gb|EPQ18866.1| TBC1 domain family member 15 [Myotis brandtii]
Length=908

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N   +++ 
Sbjct  505  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVDNMKQM  558

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+VWKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  559  IFRGGLSHALRKQVWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  616



>ref|XP_009962025.1| PREDICTED: TBC1 domain family member 15, partial [Tyto alba]
Length=668

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  K   VS      R+  +  +EWA  +DSEGR+++   +++ 
Sbjct  270  KINQQEEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILDVDYIKQL  323

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  324  IFKGGLCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  381



>gb|ETE68555.1| TBC1 domain family member 17 [Ophiophagus hannah]
Length=644

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+  +  QEW   LD +GRV++P  LRKRIF GGL  SLRKEVWK+LL Y+S+ +T  E 
Sbjct  269  RETPVTEQEWEQHLDPDGRVLDPIGLRKRIFAGGLSMSLRKEVWKYLLNYYSWGNTSEEN  328

Query  630  KLLASVKKSEYETIKNQWKSISREQ  704
            K     K  EY  +K QWKS+S EQ
Sbjct  329  KAQVRRKTDEYFRMKLQWKSVSEEQ  353



>ref|XP_005884184.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Myotis brandtii]
Length=765

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N   +++ 
Sbjct  362  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVDNMKQM  415

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+VWKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  416  IFRGGLSHALRKQVWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  473



>ref|XP_006146258.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Tupaia chinensis]
Length=675

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 68/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   IN  +   V       R+  +  +EW   +DSEGR++N   +++ 
Sbjct  272  KINQQEEPGFEVITKINLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVDDMKQM  325

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  326  IFRGGLSHALRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFKMKLQWKSVSEEQEK  383



>ref|XP_006759815.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15 
[Myotis davidii]
Length=720

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N   +++ 
Sbjct  345  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVDNMKQM  398

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+VWKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  399  IFRGGLSHALRKQVWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  456



>gb|ELK33247.1| TBC1 domain family member 15 [Myotis davidii]
Length=720

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N   +++ 
Sbjct  320  KINQQEEPGFEVITRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVDNMKQM  373

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL ++LRK+VWKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  374  IFRGGLSHALRKQVWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  431



>ref|XP_005431957.1| PREDICTED: TBC1 domain family member 15 [Falco cherrug]
Length=631

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = +3

Query  375  EPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            EP  +V   I+  K  +VS      R+P +  +EWA  +DSEGR++N   +++ IF GGL
Sbjct  303  EPGFEVITRIDLGKQPDVS-----RREPVLA-EEWAKNMDSEGRILNVDYIKQSIFKGGL  356

Query  555  ENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
             ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  357  CHTLRKEAWKFLLGYFPWNSTKEERASLQKRKTDEYFRMKLQWKSVSEEQEK  408



>ref|XP_004632275.1| PREDICTED: TBC1 domain family member 15 [Octodon degus]
Length=675

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 6/118 (5%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            K +  EEP  +V   I+  +   V       R+  +  +EW   +DSEGR++N + +++ 
Sbjct  273  KINQQEEPGFEVVTRIDLGERPVVQ------RREPVSLEEWTKNIDSEGRILNVENMKQM  326

Query  537  IFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            IF GGL +SLRK+ WKFLLGY  +DST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  327  IFRGGLSHSLRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEEQEK  384



>ref|XP_008294681.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Stegastes 
partitus]
Length=628

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAERKLLASVKK  653
            +W  F+DSEGRV NP+ +++ +F GG+  SLRKEVWKFLLG++ ++ST  ER+ +  VK 
Sbjct  278  KWEEFVDSEGRVKNPEKVKELVFRGGITPSLRKEVWKFLLGFYPWNSTTKEREDILRVKT  337

Query  654  SEYETIKNQWKSISREQ  704
             EY  +K QWKS+S EQ
Sbjct  338  DEYFRMKVQWKSVSEEQ  354



>ref|XP_010131193.1| PREDICTED: TBC1 domain family member 15 [Buceros rhinoceros silvestris]
Length=625

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            +EP  +V   I+  K   VS      R+  +  +EWA  +DSEGR++N   +++ IF GG
Sbjct  232  DEPGFEVITRIDLGKQPEVS------RREPVSAEEWAKNMDSEGRILNVNYIKQLIFKGG  285

Query  552  LENSLRKEVWKFLLGYHSYDSTYAERKLLASVKKSEYETIKNQWKSISREQAK  710
            L ++LRKE WKFLLGY  ++ST  ER  L   K  EY  +K QWKS+S EQ K
Sbjct  286  LCHTLRKEAWKFLLGYFPWNSTKEERANLQKRKTDEYFRMKLQWKSVSEEQEK  338



>ref|XP_006014956.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Alligator 
sinensis]
Length=654

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKEVWKFLLGYHSYDSTYAER  629
            R+P +   EW   LD EGRV N   LR+RIF GGL   LRK+VWK+LLGY+S+D+T  E 
Sbjct  277  REPPVTELEWEQHLDPEGRVTNVDRLRRRIFAGGLSTGLRKDVWKYLLGYYSWDNTSEEN  336

Query  630  KLLASVKKSEYETIKNQWKSISREQAK  710
            +     K  EY  +K QWKS+S EQ +
Sbjct  337  RAHVRRKTDEYFRMKLQWKSVSEEQEQ  363



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1267397107886